F282917

General Info

Members Datasets Scaffolds Average Seq Length
184 125 183 177

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0092987|Ga0373925_0092987_1641_2270
Length 200
Sequence MVNRKDVTVPDFYKTYINALEEDTLQEALANNTRRFRKLLKQIPHKKINYAYAEGKWTVKELLQHIIDAERVFIYRALTFARQDPAPLPGFDENNWAITAKAPKRKWHELVDEFKALRSANELFLNSLDDDQLQQTGSANNNAISVAGLAFVCAGHVAHHMRIIRERYLGDQPADRKIETVKIDEKVKKGKARENAKIVR

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
53 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
79 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
82 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
86 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
87 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
88 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
89 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
90 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
91 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
92 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
93 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
96 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
97 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
98 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
99 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
100 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
104 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
105 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
106 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
107 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
108 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
110 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
111 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
112 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
113 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
114 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
115 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
116 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
117 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
118 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
119 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
120 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
121 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
122 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
123 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
124 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
125 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0
Isolates 0.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.15
Nodule 0
Rhizoplane 1.63
Rhizosphere 82.61
Stem 0
Stem Tuber 0
Unclassified 7.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10025891 3300003320 Bacteria 12464
2 rootH2_10038350 3300003320 Bacteria 1613
3 rootH2_10073961 3300003320 Bacteria 6648
4 rootH2_10073962 3300003320 Bacteria 6663
5 rootH1_10317655 3300003323 Bacteria 1432
6 Ga0065714_10177454 3300005288 Bacteria 977
7 Ga0070683_100007472 3300005329 Bacteria 9233
8 Ga0070683_100344428 3300005329 Bacteria 1419
9 Ga0068869_100008019 3300005334 Bacteria 6783
10 Ga0070689_100155771 3300005340 Bacteria 1844
11 Ga0070691_10035367 3300005341 Unclassified 2352
12 Ga0070691_10085957 3300005341 Bacteria 1545
13 Ga0070661_100008101 3300005344 Bacteria 7250
14 Ga0070675_100023329 3300005354 Bacteria 4947
15 Ga0070673_100134740 3300005364 Bacteria 2077
16 Ga0070688_100165005 3300005365 Bacteria 1524
17 Ga0070667_100502973 3300005367 Unclassified 1111
18 Ga0070667_100699968 3300005367 Unclassified 937
19 Ga0070663_100727186 3300005455 Unclassified 846
20 Ga0070662_100684576 3300005457 Bacteria 867
21 Ga0070681_10011897 3300005458 Bacteria 8629
22 Ga0068867_100493552 3300005459 Unclassified 1051
23 Ga0070698_100475056 3300005471 Unclassified 1187
24 Ga0070684_100010052 3300005535 Bacteria 7479
25 Ga0070684_100123108 3300005535 Bacteria 2334
26 Ga0068853_100080292 3300005539 Unclassified 2853
27 Ga0068853_100357316 3300005539 Bacteria 1360
28 Ga0070665_100549813 3300005548 Bacteria 1167
29 Ga0068855_100009740 3300005563 Bacteria 11590
30 Ga0068855_100020864 3300005563 Bacteria 7857
31 Ga0070664_100034288 3300005564 Bacteria 4257
32 Ga0068857_100058730 3300005577 Bacteria 3417
33 Ga0068857_100300865 3300005577 Bacteria 1479
34 Ga0068857_100396194 3300005577 Bacteria 1284
35 Ga0068857_100463883 3300005577 Bacteria 1185
36 Ga0068856_100034229 3300005614 Bacteria 4977
37 Ga0068859_100359700 3300005617 Bacteria 1550
38 Ga0068859_100447098 3300005617 Bacteria 1388
39 Ga0068864_100006888 3300005618 Bacteria 9315
40 Ga0068860_100270164 3300005843 Bacteria 1659
41 Ga0081539_10061765 3300005985 Bacteria 2051
42 Ga0070717_10485032 3300006028 Bacteria 1116
43 Ga0075367_10522501 3300006178 Unclassified 753
44 Ga0097620_100447084 3300006931 Bacteria 1388
45 Ga0105240_10001362 3300009093 Bacteria 41962
46 Ga0105240_10010681 3300009093 Bacteria 12885
47 Ga0105240_10135779 3300009093 Bacteria 2946
48 Ga0105240_10304167 3300009093 Unclassified 1823
49 Ga0111539_11204081 3300009094 Bacteria 880
50 Ga0111539_11330248 3300009094 Bacteria 834
51 Ga0105247_10000640 3300009101 Bacteria 28018
52 Ga0114129_10004008 3300009147 Bacteria 20804
53 Ga0105237_10002550 3300009545 Bacteria 22531
54 Ga0105237_10020008 3300009545 Bacteria 6910
55 Ga0105237_10150331 3300009545 Unclassified 2325
56 Ga0105237_11966008 3300009545 Bacteria 593
57 Ga0105238_10515875 3300009551 Bacteria 1197
58 Ga0105238_10579716 3300009551 Bacteria 1128
59 Ga0105238_11251606 3300009551 Bacteria 767
60 Ga0105249_10460669 3300009553 Bacteria 1311
61 Ga0105239_10000101 3300010375 Bacteria 119610
62 Ga0105239_10033999 3300010375 Bacteria 5597
63 Ga0105239_10072009 3300010375 Bacteria 3798
64 Ga0105239_10090995 3300010375 Unclassified 3366
65 Ga0157370_10072509 3300013104 Bacteria 3249
66 Ga0157370_10086580 3300013104 Unclassified 2943
67 Ga0157369_10026341 3300013105 Bacteria 6451
68 Ga0157374_10000002 3300013296 Bacteria 1054226
69 Ga0157374_10002944 3300013296 Bacteria 14266
70 Ga0157374_10372195 3300013296 Bacteria 1422
71 Ga0157374_10623836 3300013296 Bacteria 1089
72 Ga0163162_10576061 3300013306 Bacteria 1253
73 Ga0163162_11465217 3300013306 Bacteria 777
74 Ga0157372_10026800 3300013307 Bacteria 6274
75 Ga0157372_10028770 3300013307 Bacteria 6065
76 Ga0157372_10148098 3300013307 Bacteria 2708
77 Ga0157375_10043185 3300013308 Bacteria 4370
78 Ga0163163_10000638 3300014325 Bacteria 30140
79 Ga0163163_10346331 3300014325 Unclassified 1541
80 Ga0157377_10009808 3300014745 Bacteria 4718
81 Ga0157379_10445984 3300014968 Bacteria 1194
82 Ga0157376_10001775 3300014969 Bacteria 14350
83 Ga0157376_10859415 3300014969 Bacteria 923
84 Ga0163161_10211744 3300017792 Bacteria 1497
85 Ga0209646_1000869 3300025246 Bacteria 10077
86 Ga0207710_10020538 3300025900 Bacteria 2824
87 Ga0207647_10020425 3300025904 Bacteria 4442
88 Ga0207707_10521034 3300025912 Bacteria 1012
89 Ga0207695_10000060 3300025913 Bacteria 360217
90 Ga0207695_10000272 3300025913 Bacteria 129871
91 Ga0207695_10097515 3300025913 Bacteria 2941
92 Ga0207695_10146328 3300025913 Bacteria 2307
93 Ga0207671_10001990 3300025914 Bacteria 22531
94 Ga0207671_10013192 3300025914 Bacteria 6594
95 Ga0207671_11204764 3300025914 Bacteria 592
96 Ga0207649_10152974 3300025920 Bacteria 1591
97 Ga0207694_10137017 3300025924 Unclassified 1967
98 Ga0207694_10326608 3300025924 Bacteria 1267
99 Ga0207694_10353329 3300025924 Bacteria 1217
100 Ga0207659_10005451 3300025926 Bacteria 7714
101 Ga0207706_10034232 3300025933 Bacteria 4519
102 Ga0207670_10024231 3300025936 Bacteria 3791
103 Ga0207669_10692214 3300025937 Unclassified 837
104 Ga0207689_10022263 3300025942 Bacteria 5328
105 Ga0207661_10489735 3300025944 Bacteria 1123
106 Ga0207679_10487502 3300025945 Bacteria 1098
107 Ga0207667_10002109 3300025949 Bacteria 24936
108 Ga0207667_10025081 3300025949 Bacteria 6536
109 Ga0207667_10162713 3300025949 Bacteria 2295
110 Ga0207712_10475288 3300025961 Bacteria 1064
111 Ga0207658_10551426 3300025986 Unclassified 1031
112 Ga0207677_10018708 3300026023 Bacteria 4162
113 Ga0207677_11203231 3300026023 Bacteria 694
114 Ga0207639_10005158 3300026041 Bacteria 8808
115 Ga0207639_10207089 3300026041 Bacteria 1686
116 Ga0207702_10032597 3300026078 Unclassified 4348
117 Ga0207648_10572794 3300026089 Bacteria 1039
118 Ga0207676_10011775 3300026095 Bacteria 6257
119 Ga0207676_10039538 3300026095 Bacteria 3609
120 Ga0207676_11613176 3300026095 Bacteria 647
121 Ga0207674_10017465 3300026116 Bacteria 7828
122 Ga0207674_10038300 3300026116 Bacteria 4978
123 Ga0207674_10201766 3300026116 Bacteria 1938
124 Ga0268266_10627907 3300028379 Bacteria 1033
125 Ga0268264_10120360 3300028381 Bacteria 2313
126 Ga0307513_10392515 3300031456 Bacteria 1124
127 Ga0307509_10380759 3300031507 Bacteria 1124
128 Ga0307408_100000054 3300031548 Bacteria 146208
129 Ga0307508_10004548 3300031616 Bacteria 13511
130 Ga0307510_10055647 3300033180 Bacteria 4129
131 Ga0373925_0092987 3300037068 Bacteria 2308
132 Ga0436365_0274296 3300039437 Bacteria 1971
133 Ga0439439_0032110 3300041406 Bacteria 1340
134 Ga0451789_0196882 3300041443 Bacteria 1034
135 Ga0451800_1067277 3300041459 Bacteria 718
136 Ga0451833_0528375 3300041491 Unclassified 986
137 Ga0451849_1485621 3300041505 Bacteria 839
138 Ga0439449_0075077 3300042007 Bacteria 1246
139 Ga0439462_0074416 3300042015 Bacteria 924
140 Ga0439462_0132728 3300042015 Bacteria 696
141 Ga0466969_0001691 3300044656 Bacteria 11789
142 Ga0466972_0000083 3300044658 Bacteria 87204
143 Ga0466972_0024493 3300044658 Bacteria 2995
144 Ga0466966_0000389 3300044684 Bacteria 28532
145 Ga0466961_0034248 3300044693 Bacteria 3261
146 Ga0466964_0239432 3300044706 Unclassified 889
147 Ga0466971_0244399 3300044719 Bacteria 854
148 Ga0466968_0023701 3300044735 Bacteria 2503
149 Ga0466970_0112116 3300044765 Bacteria 1490
150 Ga0466970_0132384 3300044765 Bacteria 1370
151 Ga0466970_0192422 3300044765 Bacteria 1134
152 Ga0466957_0006890 3300044842 Bacteria 6421
153 Ga0466957_0027610 3300044842 Unclassified 3375
154 Ga0466957_0298186 3300044842 Bacteria 1082
155 Ga0466959_0000025 3300045049 Bacteria 120128
156 Ga0466959_0008005 3300045049 Bacteria 7447
157 Ga0495606_0247300 3300046507 Unclassified 991
158 Ga0495608_0205106 3300046511 Unclassified 1241
159 Ga0495632_0239702 3300046519 Unclassified 816
160 Ga0495611_0001291 3300046648 Bacteria 12780
161 Ga0495625_0044698 3300046660 Unclassified 3205
162 Ga0496110_0145336 3300048913 Bacteria 2145
163 Ga0501047_0037567 3300049581 Bacteria 4682
164 Ga0501047_0413221 3300049581 Bacteria 1181
165 Ga0501225_0040400 3300049705 Bacteria 1286
166 Ga0501083_0064598 3300049744 Unclassified 2439
167 Ga0501044_0016696 3300049823 Bacteria 7881
168 nmdc:mga05p37_102863_c1 3300050507 Bacteria 3517
169 Ga0500578_0000066 3300053086 Bacteria 116854
170 Ga0500578_0073441 3300053086 Bacteria 2179
171 Ga0500646_0016478 3300053090 Bacteria 1930
172 Ga0500583_0000002 3300053092 Bacteria 232826
173 Ga0500583_0002659 3300053092 Bacteria 5429
174 Ga0500618_054890 3300053125 Bacteria 899
175 Ga0500652_199719 3300053131 Bacteria 812
176 Ga0500559_0208006 3300053136 Bacteria 923
177 Ga0500588_0013476 3300053146 Unclassified 2052
178 Ga0500589_038583 3300053147 Bacteria 2230
179 Ga0500604_0020243 3300053151 Bacteria 1871
180 Ga0500616_0005279 3300053153 Bacteria 8828
181 Ga0500622_0017860 3300053156 Bacteria 3774
182 Ga0500611_039878 3300053727 Unclassified 1025
183 Ga0466962_0024961 3300061719 Bacteria 2870

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031548 Ga0307408_100000054 Ga0307408_10000005485 163
2 3300046511 Ga0495608_0205106 Ga0495608_0205106_13_510 163
3 iso_pu_bacteria 2738541278 2738728208 165
4 3300005577 Ga0068857_100300865 Ga0068857_1003008652 167
5 3300005985 Ga0081539_10061765 Ga0081539_100617652 167
6 3300009101 Ga0105247_10000640 Ga0105247_1000064011 167
7 3300025900 Ga0207710_10020538 Ga0207710_100205382 167
8 3300026095 Ga0207676_10039538 Ga0207676_100395382 167
9 3300026095 Ga0207676_11613176 Ga0207676_116131761 167
10 3300026116 Ga0207674_10201766 Ga0207674_102017662 167
11 3300028379 Ga0268266_10627907 Ga0268266_106279071 167
12 3300049744 Ga0501083_0064598 Ga0501083_0064598_1564_2070 167
13 3300005288 Ga0065714_10177454 Ga0065714_101774542 168
14 3300005367 Ga0070667_100502973 Ga0070667_1005029732 168
15 3300005457 Ga0070662_100684576 Ga0070662_1006845762 168
16 3300005617 Ga0068859_100359700 Ga0068859_1003597002 168
17 3300009553 Ga0105249_10460669 Ga0105249_104606692 168
18 3300013104 Ga0157370_10072509 Ga0157370_100725093 168
19 3300013307 Ga0157372_10148098 Ga0157372_101480983 168
20 3300025920 Ga0207649_10152974 Ga0207649_101529741 168
21 3300025961 Ga0207712_10475288 Ga0207712_104752882 168
22 3300025986 Ga0207658_10551426 Ga0207658_105514262 168
23 3300039437 Ga0436365_0274296 Ga0436365_0274296_1286_1795 168
24 3300048913 Ga0496110_0145336 Ga0496110_0145336_1337_1849 168
25 3300003320 rootH2_10025891 rootH2_100258912 169
26 3300003320 rootH2_10038350 rootH2_100383502 169
27 3300003320 rootH2_10073961 rootH2_100739615 169
28 3300003320 rootH2_10073962 rootH2_100739624 169
29 3300003323 rootH1_10317655 rootH1_103176551 169
30 3300005329 Ga0070683_100007472 Ga0070683_1000074722 169
31 3300005329 Ga0070683_100344428 Ga0070683_1003444282 169
32 3300005334 Ga0068869_100008019 Ga0068869_1000080193 169
33 3300005340 Ga0070689_100155771 Ga0070689_1001557712 169
34 3300005341 Ga0070691_10035367 Ga0070691_100353672 169
35 3300005341 Ga0070691_10085957 Ga0070691_100859572 169
36 3300005344 Ga0070661_100008101 Ga0070661_1000081013 169
37 3300005354 Ga0070675_100023329 Ga0070675_1000233292 169
38 3300005364 Ga0070673_100134740 Ga0070673_1001347402 169
39 3300005365 Ga0070688_100165005 Ga0070688_1001650052 169
40 3300005367 Ga0070667_100699968 Ga0070667_1006999682 169
41 3300005455 Ga0070663_100727186 Ga0070663_1007271862 169
42 3300005458 Ga0070681_10011897 Ga0070681_100118972 169
43 3300005459 Ga0068867_100493552 Ga0068867_1004935522 169
44 3300005471 Ga0070698_100475056 Ga0070698_1004750562 169
45 3300005535 Ga0070684_100010052 Ga0070684_1000100523 169
46 3300005535 Ga0070684_100123108 Ga0070684_1001231082 169
47 3300005539 Ga0068853_100080292 Ga0068853_1000802922 169
48 3300005539 Ga0068853_100357316 Ga0068853_1003573162 169
49 3300005548 Ga0070665_100549813 Ga0070665_1005498132 169
50 3300005563 Ga0068855_100009740 Ga0068855_1000097409 169
51 3300005563 Ga0068855_100020864 Ga0068855_1000208643 169
52 3300005564 Ga0070664_100034288 Ga0070664_1000342885 169
53 3300005577 Ga0068857_100058730 Ga0068857_1000587302 169
54 3300005577 Ga0068857_100396194 Ga0068857_1003961941 169
55 3300005577 Ga0068857_100463883 Ga0068857_1004638831 169
56 3300005614 Ga0068856_100034229 Ga0068856_1000342294 169
57 3300005617 Ga0068859_100447098 Ga0068859_1004470982 169
58 3300005618 Ga0068864_100006888 Ga0068864_1000068881 169
59 3300005843 Ga0068860_100270164 Ga0068860_1002701642 169
60 3300006028 Ga0070717_10485032 Ga0070717_104850322 169
61 3300006178 Ga0075367_10522501 Ga0075367_105225011 169
62 3300006931 Ga0097620_100447084 Ga0097620_1004470842 169
63 3300009093 Ga0105240_10001362 Ga0105240_1000136213 169
64 3300009093 Ga0105240_10010681 Ga0105240_100106817 169
65 3300009093 Ga0105240_10135779 Ga0105240_101357792 169
66 3300009093 Ga0105240_10304167 Ga0105240_103041672 169
67 3300009094 Ga0111539_11204081 Ga0111539_112040812 169
68 3300009094 Ga0111539_11330248 Ga0111539_113302482 169
69 3300009147 Ga0114129_10004008 Ga0114129_1000400812 169
70 3300009545 Ga0105237_10002550 Ga0105237_1000255011 169
71 3300009545 Ga0105237_10020008 Ga0105237_100200084 169
72 3300009545 Ga0105237_10150331 Ga0105237_101503311 169
73 3300009545 Ga0105237_11966008 Ga0105237_119660081 169
74 3300009551 Ga0105238_10515875 Ga0105238_105158752 169
75 3300009551 Ga0105238_10579716 Ga0105238_105797162 169
76 3300009551 Ga0105238_11251606 Ga0105238_112516062 169
77 3300010375 Ga0105239_10000101 Ga0105239_1000010134 169
78 3300010375 Ga0105239_10033999 Ga0105239_100339994 169
79 3300010375 Ga0105239_10072009 Ga0105239_100720092 169
80 3300010375 Ga0105239_10090995 Ga0105239_100909953 169
81 3300013104 Ga0157370_10086580 Ga0157370_100865802 169
82 3300013105 Ga0157369_10026341 Ga0157369_100263414 169
83 3300013296 Ga0157374_10000002 Ga0157374_10000002751 169
84 3300013296 Ga0157374_10002944 Ga0157374_1000294413 169
85 3300013296 Ga0157374_10372195 Ga0157374_103721952 169
86 3300013296 Ga0157374_10623836 Ga0157374_106238362 169
87 3300013306 Ga0163162_10576061 Ga0163162_105760612 169
88 3300013306 Ga0163162_11465217 Ga0163162_114652171 169
89 3300013307 Ga0157372_10026800 Ga0157372_100268002 169
90 3300013307 Ga0157372_10028770 Ga0157372_100287703 169
91 3300013308 Ga0157375_10043185 Ga0157375_100431852 169
92 3300014325 Ga0163163_10000638 Ga0163163_1000063833 169
93 3300014325 Ga0163163_10346331 Ga0163163_103463312 169
94 3300014745 Ga0157377_10009808 Ga0157377_100098081 169
95 3300014968 Ga0157379_10445984 Ga0157379_104459842 169
96 3300014969 Ga0157376_10001775 Ga0157376_100017759 169
97 3300014969 Ga0157376_10859415 Ga0157376_108594152 169
98 3300017792 Ga0163161_10211744 Ga0163161_102117442 169
99 3300025246 Ga0209646_1000869 Ga0209646_100086911 169
100 3300025904 Ga0207647_10020425 Ga0207647_100204252 169
101 3300025912 Ga0207707_10521034 Ga0207707_105210342 169
102 3300025913 Ga0207695_10000060 Ga0207695_10000060280 169
103 3300025913 Ga0207695_10000272 Ga0207695_1000027275 169
104 3300025913 Ga0207695_10097515 Ga0207695_100975152 169
105 3300025913 Ga0207695_10146328 Ga0207695_101463282 169
106 3300025914 Ga0207671_10001990 Ga0207671_1000199011 169
107 3300025914 Ga0207671_10013192 Ga0207671_100131924 169
108 3300025914 Ga0207671_11204764 Ga0207671_112047641 169
109 3300025924 Ga0207694_10137017 Ga0207694_101370172 169
110 3300025924 Ga0207694_10326608 Ga0207694_103266082 169
111 3300025924 Ga0207694_10353329 Ga0207694_103533292 169
112 3300025926 Ga0207659_10005451 Ga0207659_100054518 169
113 3300025933 Ga0207706_10034232 Ga0207706_100342322 169
114 3300025936 Ga0207670_10024231 Ga0207670_100242312 169
115 3300025937 Ga0207669_10692214 Ga0207669_106922141 169
116 3300025942 Ga0207689_10022263 Ga0207689_100222632 169
117 3300025944 Ga0207661_10489735 Ga0207661_104897352 169
118 3300025945 Ga0207679_10487502 Ga0207679_104875022 169
119 3300025949 Ga0207667_10002109 Ga0207667_1000210921 169
120 3300025949 Ga0207667_10025081 Ga0207667_100250813 169
121 3300025949 Ga0207667_10162713 Ga0207667_101627132 169
122 3300026023 Ga0207677_10018708 Ga0207677_100187083 169
123 3300026023 Ga0207677_11203231 Ga0207677_112032311 169
124 3300026041 Ga0207639_10005158 Ga0207639_100051582 169
125 3300026041 Ga0207639_10207089 Ga0207639_102070892 169
126 3300026078 Ga0207702_10032597 Ga0207702_100325976 169
127 3300026089 Ga0207648_10572794 Ga0207648_105727941 169
128 3300026095 Ga0207676_10011775 Ga0207676_100117751 169
129 3300026116 Ga0207674_10017465 Ga0207674_100174652 169
130 3300026116 Ga0207674_10038300 Ga0207674_100383005 169
131 3300028381 Ga0268264_10120360 Ga0268264_101203602 169
132 3300031456 Ga0307513_10392515 Ga0307513_103925151 169
133 3300031507 Ga0307509_10380759 Ga0307509_103807591 169
134 3300031616 Ga0307508_10004548 Ga0307508_100045483 169
135 3300033180 Ga0307510_10055647 Ga0307510_100556473 169
136 3300037068 Ga0373925_0092987 Ga0373925_0092987_1641_2270 169
137 3300041406 Ga0439439_0032110 Ga0439439_0032110_640_1227 169
138 3300041443 Ga0451789_0196882 Ga0451789_0196882_192_773 169
139 3300041459 Ga0451800_1067277 Ga0451800_1067277_27_608 169
140 3300041491 Ga0451833_0528375 Ga0451833_0528375_224_811 169
141 3300041505 Ga0451849_1485621 Ga0451849_1485621_187_756 169
142 3300042007 Ga0439449_0075077 Ga0439449_0075077_468_1055 169
143 3300042015 Ga0439462_0074416 Ga0439462_0074416_297_884 169
144 3300042015 Ga0439462_0132728 Ga0439462_0132728_65_652 169
145 3300044656 Ga0466969_0001691 Ga0466969_0001691_2879_3469 169
146 3300044658 Ga0466972_0000083 Ga0466972_0000083_18839_19399 169
147 3300044658 Ga0466972_0024493 Ga0466972_0024493_886_1485 169
148 3300044684 Ga0466966_0000389 Ga0466966_0000389_4860_5450 169
149 3300044693 Ga0466961_0034248 Ga0466961_0034248_1850_2449 169
150 3300044706 Ga0466964_0239432 Ga0466964_0239432_85_681 169
151 3300044719 Ga0466971_0244399 Ga0466971_0244399_154_669 169
152 3300044735 Ga0466968_0023701 Ga0466968_0023701_700_1296 169
153 3300044765 Ga0466970_0112116 Ga0466970_0112116_722_1327 169
154 3300044765 Ga0466970_0132384 Ga0466970_0132384_665_1174 169
155 3300044765 Ga0466970_0192422 Ga0466970_0192422_418_1008 169
156 3300044842 Ga0466957_0006890 Ga0466957_0006890_3290_3805 169
157 3300044842 Ga0466957_0027610 Ga0466957_0027610_904_1413 169
158 3300044842 Ga0466957_0298186 Ga0466957_0298186_411_1004 169
159 3300045049 Ga0466959_0000025 Ga0466959_0000025_36314_36904 169
160 3300045049 Ga0466959_0008005 Ga0466959_0008005_2188_2697 169
161 3300046507 Ga0495606_0247300 Ga0495606_0247300_323_832 169
162 3300046519 Ga0495632_0239702 Ga0495632_0239702_200_778 169
163 3300046648 Ga0495611_0001291 Ga0495611_0001291_4411_4920 169
164 3300046660 Ga0495625_0044698 Ga0495625_0044698_1375_1890 169
165 3300049581 Ga0501047_0037567 Ga0501047_0037567_3039_3620 169
166 3300049581 Ga0501047_0413221 Ga0501047_0413221_29_613 169
167 3300049705 Ga0501225_0040400 Ga0501225_0040400_251_838 169
168 3300049823 Ga0501044_0016696 Ga0501044_0016696_1333_1914 169
169 3300050507 nmdc:mga05p37_102863_c1 nmdc:mga05p37_102863_c1_1840_2460 169
170 3300053086 Ga0500578_0000066 Ga0500578_0000066_35359_35943 169
171 3300053086 Ga0500578_0073441 Ga0500578_0073441_612_1226 169
172 3300053090 Ga0500646_0016478 Ga0500646_0016478_494_1075 169
173 3300053092 Ga0500583_0000002 Ga0500583_0000002_50525_51118 169
174 3300053092 Ga0500583_0002659 Ga0500583_0002659_1394_1984 169
175 3300053125 Ga0500618_054890 Ga0500618_054890_132_755 169
176 3300053131 Ga0500652_199719 Ga0500652_199719_93_680 169
177 3300053136 Ga0500559_0208006 Ga0500559_0208006_163_792 169
178 3300053146 Ga0500588_0013476 Ga0500588_0013476_1518_2033 169
179 3300053147 Ga0500589_038583 Ga0500589_038583_367_954 169
180 3300053151 Ga0500604_0020243 Ga0500604_0020243_1245_1832 169
181 3300053153 Ga0500616_0005279 Ga0500616_0005279_5326_5904 169
182 3300053156 Ga0500622_0017860 Ga0500622_0017860_558_1139 169
183 3300053727 Ga0500611_039878 Ga0500611_039878_78_659 169
184 3300061719 Ga0466962_0024961 Ga0466962_0024961_2080_2589 169

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

28

164

0.97

PF05163

DinB

DinB family

14

162

0.92

PF04978

DUF664

Protein of unknown function (DUF664)

24

170

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nsf-assembly1.cif.gz_A crystal structure of the mycothiol-dependent maleylpyruvate isomerase 0.8331 25 160
2nsg-assembly1.cif.gz_A crystal structure of the mycothiol-dependent maleylpyruvate isomerase h52a mutant 0.8326 25 160
2rd9-assembly1.cif.gz_A crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution 0.8321 25 168
2yqy-assembly2.cif.gz_B crystal structure of tt2238, a four-helix bundle protein 0.8311 25 165
2rd9-assembly3.cif.gz_B crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution 0.8127 25 168
ID Description Score Start End Superfamily
2nsgA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8326 25 160 1.20.120.450
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8311 25 165 1.20.120.450
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8004 25 165 1.20.120.450
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7816 25 165 1.20.120.450
af_O53728_4_171_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7586 25 162 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A7W1GYM8-F1-model_v4 DinB family protein 0.9876 56 168
AF-A0A357JEA8-F1-model_v4 DNA damage-inducible protein DinB 0.9873 60 169
AF-A0A7Y3GR22-F1-model_v4 DinB family protein 0.9865 57 169
AF-A0A4V1ZTF5-F1-model_v4 DinB family protein 0.9843 1 169
AF-A0A6N6KCU0-F1-model_v4 DinB family protein 0.9832 10 169

Feature Viewer

pLDDT pTM Quality
96.43 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map