F282913
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 184 | 38 | 182 | 226 |
Family's Representative Sequence
| Representative Sequence | 3300036647|Ga0316582_0051441|Ga0316582_0051441_173_916 |
| Length | 247 |
| Sequence | LLDLLDERGELSICPKGKQANMTGNIVDRIDDWVPIRQVLVSVSDKTGLDRLVPALIETNPGVRFYSTGGTCRHLAGILGPEAAAAHLTRVSDYTGQPETQGGLVKTLDFKIYLGLLTETYNEAHLADLTRAGALPLDMVVCNLYPFQATVARPGVTVEEARANVDIGGPCMLRAAAKNYLRVAAVVDPGDYVDLAADLKAHDGRINLARRFALAQKAFAHTAQYDAAISRFLAGQDPAQVPAAYVL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2523533628 | Maridesulfovibrio zosterae DSM 11974 | Isolate | Rhizosphere |
| 2 | 2740891818 | Desulfofaba hansenii DSM 12642 | Isolate | Unclassified |
| 3 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 4 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 5 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 6 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 7 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 8 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 9 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 10 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 11 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 12 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 13 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 14 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 15 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 16 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 17 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 18 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 19 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 20 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 21 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 22 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 23 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 24 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 25 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 26 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 27 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 28 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 29 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 30 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 31 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 32 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 33 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 34 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 35 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 36 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 37 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 38 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.83 |
| Metatranscriptomes | 1.09 |
| Isolates | 1.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.54 |
| Rhizosphere | 76.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 23.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265334_10030930 | 3300028573 | Bacteria | 2141 |
| 2 | Ga0265323_10019525 | 3300028653 | Bacteria | 2613 |
| 3 | Ga0265323_10069915 | 3300028653 | Bacteria | 1202 |
| 4 | Ga0265322_10008856 | 3300028654 | Bacteria | 2926 |
| 5 | Ga0265338_10050662 | 3300028800 | Bacteria | 3750 |
| 6 | Ga0265330_10135493 | 3300031235 | Bacteria | 1047 |
| 7 | Ga0265320_10002960 | 3300031240 | Bacteria | 11614 |
| 8 | Ga0265320_10015542 | 3300031240 | Bacteria | 4300 |
| 9 | Ga0265329_10009646 | 3300031242 | Bacteria | 3586 |
| 10 | Ga0265316_10004671 | 3300031344 | Bacteria | 13564 |
| 11 | Ga0265316_10005291 | 3300031344 | Bacteria | 12587 |
| 12 | Ga0265316_10045403 | 3300031344 | Bacteria | 3488 |
| 13 | Ga0265316_10160192 | 3300031344 | Bacteria | 1682 |
| 14 | Ga0265316_10309843 | 3300031344 | Bacteria | 1149 |
| 15 | Ga0316575_10000435 | 3300031665 | Bacteria | 11926 |
| 16 | Ga0316575_10000736 | 3300031665 | Bacteria | 9836 |
| 17 | Ga0316575_10006976 | 3300031665 | Bacteria | 4086 |
| 18 | Ga0316575_10037024 | 3300031665 | Bacteria | 1921 |
| 19 | Ga0316575_10038310 | 3300031665 | Unclassified | 1890 |
| 20 | Ga0316575_10044330 | 3300031665 | Bacteria | 1764 |
| 21 | Ga0316575_10048006 | 3300031665 | Bacteria | 1697 |
| 22 | Ga0316575_10075183 | 3300031665 | Bacteria | 1359 |
| 23 | Ga0316579_10006834 | 3300031691 | Bacteria | 4676 |
| 24 | Ga0316579_10015669 | 3300031691 | Bacteria | 3297 |
| 25 | Ga0316579_10024961 | 3300031691 | Bacteria | 2694 |
| 26 | Ga0316579_10028623 | 3300031691 | Bacteria | 2537 |
| 27 | Ga0316579_10042415 | 3300031691 | Bacteria | 2114 |
| 28 | Ga0265342_10013796 | 3300031712 | Bacteria | 5395 |
| 29 | Ga0265342_10116200 | 3300031712 | Bacteria | 1510 |
| 30 | Ga0316576_10000114 | 3300031727 | Bacteria | 30289 |
| 31 | Ga0316576_10001636 | 3300031727 | Bacteria | 12254 |
| 32 | Ga0316576_10001937 | 3300031727 | Bacteria | 11560 |
| 33 | Ga0316576_10007603 | 3300031727 | Bacteria | 6836 |
| 34 | Ga0316576_10008461 | 3300031727 | Bacteria | 6565 |
| 35 | Ga0316576_10010844 | 3300031727 | Bacteria | 5942 |
| 36 | Ga0316576_10012906 | 3300031727 | Bacteria | 5529 |
| 37 | Ga0316576_10031600 | 3300031727 | Bacteria | 3758 |
| 38 | Ga0316576_10033982 | 3300031727 | Bacteria | 3633 |
| 39 | Ga0316576_10039352 | 3300031727 | Bacteria | 3394 |
| 40 | Ga0316576_10056560 | 3300031727 | Bacteria | 2865 |
| 41 | Ga0316576_10122951 | 3300031727 | Bacteria | 1949 |
| 42 | Ga0316576_10182400 | 3300031727 | Archaea | 1583 |
| 43 | Ga0316576_10217845 | 3300031727 | Bacteria | 1436 |
| 44 | Ga0316576_10219206 | 3300031727 | Bacteria | 1431 |
| 45 | Ga0316576_10331980 | 3300031727 | Bacteria | 1133 |
| 46 | Ga0316578_10000606 | 3300031728 | Bacteria | 12538 |
| 47 | Ga0316578_10002914 | 3300031728 | Bacteria | 7672 |
| 48 | Ga0316578_10005305 | 3300031728 | Bacteria | 6231 |
| 49 | Ga0316578_10007391 | 3300031728 | Bacteria | 5505 |
| 50 | Ga0316578_10024016 | 3300031728 | Bacteria | 3417 |
| 51 | Ga0316578_10045756 | 3300031728 | Bacteria | 2549 |
| 52 | Ga0316578_10075846 | 3300031728 | Bacteria | 1995 |
| 53 | Ga0316578_10097977 | 3300031728 | Bacteria | 1756 |
| 54 | Ga0316578_10119466 | 3300031728 | Bacteria | 1584 |
| 55 | Ga0316578_10180919 | 3300031728 | Bacteria | 1270 |
| 56 | Ga0316578_10283863 | 3300031728 | Bacteria | 991 |
| 57 | Ga0316577_10002562 | 3300031733 | Bacteria | 9025 |
| 58 | Ga0316577_10003913 | 3300031733 | Bacteria | 7601 |
| 59 | Ga0316577_10004365 | 3300031733 | Bacteria | 7295 |
| 60 | Ga0316577_10031491 | 3300031733 | Bacteria | 2964 |
| 61 | Ga0316577_10033838 | 3300031733 | Bacteria | 2856 |
| 62 | Ga0316577_10056988 | 3300031733 | Bacteria | 2181 |
| 63 | Ga0316577_10058665 | 3300031733 | Bacteria | 2149 |
| 64 | Ga0316577_10060303 | 3300031733 | Unclassified | 2118 |
| 65 | Ga0316577_10068672 | 3300031733 | Bacteria | 1980 |
| 66 | Ga0316577_10305164 | 3300031733 | Bacteria | 902 |
| 67 | Ga0316583_10000201 | 3300032133 | Bacteria | 15671 |
| 68 | Ga0316583_10004070 | 3300032133 | Bacteria | 5198 |
| 69 | Ga0316583_10061843 | 3300032133 | Bacteria | 1311 |
| 70 | Ga0316585_10000212 | 3300032137 | Bacteria | 12013 |
| 71 | Ga0316585_10008906 | 3300032137 | Bacteria | 2915 |
| 72 | Ga0316585_10014993 | 3300032137 | Unclassified | 2321 |
| 73 | Ga0316585_10058903 | 3300032137 | Bacteria | 1238 |
| 74 | Ga0316585_10116877 | 3300032137 | Bacteria | 877 |
| 75 | Ga0316580_10007021 | 3300032139 | Bacteria | 3339 |
| 76 | Ga0316580_10008167 | 3300032139 | Bacteria | 3133 |
| 77 | Ga0316580_10010758 | 3300032139 | Bacteria | 2770 |
| 78 | Ga0316580_10029465 | 3300032139 | Bacteria | 1698 |
| 79 | Ga0316580_10030757 | 3300032139 | Bacteria | 1663 |
| 80 | Ga0316592_1003436 | 3300033524 | Bacteria | 2852 |
| 81 | Ga0316592_1015046 | 3300033524 | Bacteria | 1609 |
| 82 | Ga0316574_0000089 | 3300035398 | Bacteria | 26124 |
| 83 | Ga0316574_0000798 | 3300035398 | Bacteria | 13667 |
| 84 | Ga0316574_0006656 | 3300035398 | Bacteria | 6267 |
| 85 | Ga0316574_0027954 | 3300035398 | Bacteria | 3398 |
| 86 | Ga0316574_0057593 | 3300035398 | Bacteria | 2433 |
| 87 | Ga0316574_0068646 | 3300035398 | Bacteria | 2235 |
| 88 | Ga0316574_0673799 | 3300035398 | Bacteria | 635 |
| 89 | Ga0316582_0000910 | 3300036647 | Bacteria | 12147 |
| 90 | Ga0316582_0001494 | 3300036647 | Bacteria | 10328 |
| 91 | Ga0316582_0001988 | 3300036647 | Bacteria | 9368 |
| 92 | Ga0316582_0002896 | 3300036647 | Bacteria | 8240 |
| 93 | Ga0316582_0026222 | 3300036647 | Bacteria | 3506 |
| 94 | Ga0316582_0027672 | 3300036647 | Bacteria | 3427 |
| 95 | Ga0316582_0037861 | 3300036647 | Bacteria | 2994 |
| 96 | Ga0316582_0051441 | 3300036647 | Bacteria | 2614 |
| 97 | Ga0316582_0068283 | 3300036647 | Bacteria | 2295 |
| 98 | Ga0316582_0077746 | 3300036647 | Bacteria | 2160 |
| 99 | Ga0316582_0088592 | 3300036647 | Bacteria | 2033 |
| 100 | Ga0316582_0109186 | 3300036647 | Bacteria | 1840 |
| 101 | Ga0316582_0109672 | 3300036647 | Bacteria | 1835 |
| 102 | Ga0316582_0138661 | 3300036647 | Bacteria | 1639 |
| 103 | Ga0316582_0251209 | 3300036647 | Bacteria | 1212 |
| 104 | Ga0316582_0349131 | 3300036647 | Unclassified | 1018 |
| 105 | Ga0316582_0499542 | 3300036647 | Unclassified | 838 |
| 106 | Ga0316584_0002953 | 3300036712 | Bacteria | 10930 |
| 107 | Ga0316584_0004230 | 3300036712 | Bacteria | 9480 |
| 108 | Ga0316584_0008389 | 3300036712 | Bacteria | 7119 |
| 109 | Ga0316584_0009499 | 3300036712 | Bacteria | 6754 |
| 110 | Ga0316584_0014577 | 3300036712 | Bacteria | 5600 |
| 111 | Ga0316584_0018227 | 3300036712 | Bacteria | 5062 |
| 112 | Ga0316584_0037483 | 3300036712 | Bacteria | 3602 |
| 113 | Ga0316584_0049987 | 3300036712 | Bacteria | 3125 |
| 114 | Ga0316584_0052924 | 3300036712 | Bacteria | 3037 |
| 115 | Ga0316584_0055665 | 3300036712 | Bacteria | 2961 |
| 116 | Ga0316584_0078881 | 3300036712 | Bacteria | 2466 |
| 117 | Ga0316584_0096455 | 3300036712 | Bacteria | 2213 |
| 118 | Ga0316584_0134487 | 3300036712 | Bacteria | 1846 |
| 119 | Ga0316584_0150690 | 3300036712 | Bacteria | 1731 |
| 120 | Ga0316584_0203091 | 3300036712 | Bacteria | 1462 |
| 121 | Ga0316584_0203535 | 3300036712 | Bacteria | 1460 |
| 122 | Ga0316584_0424067 | 3300036712 | Bacteria | 944 |
| 123 | Ga0316584_0429638 | 3300036712 | Bacteria | 937 |
| 124 | Ga0316581_0006097 | 3300037588 | Bacteria | 3176 |
| 125 | Ga0316581_0030450 | 3300037588 | Unclassified | 1624 |
| 126 | Ga0316581_0047753 | 3300037588 | Unclassified | 1310 |
| 127 | Ga0316581_0090810 | 3300037588 | Unclassified | 940 |
| 128 | Ga0400484_04313 | 3300038725 | Bacteria | 10069 |
| 129 | Ga0400484_28884 | 3300038725 | Bacteria | 2986 |
| 130 | Ga0400484_28931 | 3300038725 | Bacteria | 10560 |
| 131 | Ga0400484_33781 | 3300038725 | Bacteria | 3061 |
| 132 | Ga0400490_20282 | 3300038726 | Bacteria | 7474 |
| 133 | Ga0400490_21533 | 3300038726 | Bacteria | 2009 |
| 134 | Ga0400490_29127 | 3300038726 | Bacteria | 1439 |
| 135 | Ga0400490_30536 | 3300038726 | Bacteria | 1183 |
| 136 | Ga0400490_31562 | 3300038726 | Bacteria | 25931 |
| 137 | Ga0400490_41208 | 3300038726 | Bacteria | 101235 |
| 138 | Ga0400490_55390 | 3300038726 | Bacteria | 6445 |
| 139 | Ga0400491_11133 | 3300038727 | Bacteria | 1994 |
| 140 | Ga0400485_04637 | 3300038735 | Bacteria | 6292 |
| 141 | Ga0400485_19300 | 3300038735 | Bacteria | 17712 |
| 142 | Ga0400485_20398 | 3300038735 | Bacteria | 31344 |
| 143 | Ga0400485_20517 | 3300038735 | Bacteria | 45673 |
| 144 | Ga0400488_16617 | 3300038741 | Bacteria | 2707 |
| 145 | Ga0400488_21495 | 3300038741 | Bacteria | 5941 |
| 146 | Ga0400488_23662 | 3300038741 | Bacteria | 8583 |
| 147 | Ga0400488_32474 | 3300038741 | Bacteria | 4708 |
| 148 | Ga0400488_53712 | 3300038741 | Bacteria | 9671 |
| 149 | Ga0400488_59805 | 3300038741 | Bacteria | 1471 |
| 150 | Ga0400486_02585 | 3300038742 | Bacteria | 13143 |
| 151 | Ga0400486_04466 | 3300038742 | Bacteria | 30371 |
| 152 | Ga0400486_13683 | 3300038742 | Bacteria | 28516 |
| 153 | Ga0400486_23095 | 3300038742 | Bacteria | 2553 |
| 154 | Ga0400486_30434 | 3300038742 | Bacteria | 24381 |
| 155 | Ga0400483_033880 | 3300039062 | Bacteria | 8743 |
| 156 | Ga0400483_040906 | 3300039062 | Bacteria | 1305 |
| 157 | Ga0400483_060240 | 3300039062 | Bacteria | 7259 |
| 158 | Ga0400483_075863 | 3300039062 | Bacteria | 91295 |
| 159 | Ga0400483_253686 | 3300039062 | Bacteria | 11625 |
| 160 | Ga0400483_280348 | 3300039062 | Bacteria | 7998 |
| 161 | Ga0400483_291779 | 3300039062 | Bacteria | 9057 |
| 162 | Ga0400489_27790 | 3300039093 | Bacteria | 84913 |
| 163 | Ga0400489_35047 | 3300039093 | Bacteria | 73845 |
| 164 | Ga0400489_57198 | 3300039093 | Bacteria | 2863 |
| 165 | Ga0400489_79164 | 3300039093 | Bacteria | 37365 |
| 166 | Ga0400489_90809 | 3300039093 | Bacteria | 20585 |
| 167 | Ga0400487_06497 | 3300039110 | Bacteria | 16496 |
| 168 | Ga0400487_36110 | 3300039110 | Bacteria | 1063 |
| 169 | Ga0400487_46803 | 3300039110 | Bacteria | 1270 |
| 170 | Ga0451795_0393842 | 3300041456 | Bacteria | 1763 |
| 171 | Ga0451577_0058036 | 3300042876 | Bacteria | 3450 |
| 172 | Ga0453683_0088776 | 3300044673 | Bacteria | 1938 |
| 173 | Ga0453683_0176882 | 3300044673 | Unclassified | 1352 |
| 174 | Ga0453684_0006059 | 3300044712 | Bacteria | 23367 |
| 175 | Ga0453684_0013913 | 3300044712 | Bacteria | 12978 |
| 176 | Ga0453684_0093213 | 3300044712 | Bacteria | 3710 |
| 177 | Ga0453684_0119254 | 3300044712 | Bacteria | 3189 |
| 178 | Ga0453684_0214323 | 3300044712 | Bacteria | 2236 |
| 179 | Ga0453684_0231822 | 3300044712 | Bacteria | 2131 |
| 180 | Ga0453684_0508067 | 3300044712 | Bacteria | 1333 |
| 181 | Ga0451576_0138960 | 3300045051 | Bacteria | 2534 |
| 182 | Ga0451576_0418930 | 3300045051 | Bacteria | 1405 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2523533628 | 2524003021 | 195 |
| 2 | 3300044712 | Ga0453684_0013913 | Ga0453684_0013913_1976_2569 | 197 |
| 3 | 3300035398 | Ga0316574_0673799 | Ga0316574_0673799_26_622 | 198 |
| 4 | 3300044673 | Ga0453683_0088776 | Ga0453683_0088776_188_784 | 198 |
| 5 | 3300044712 | Ga0453684_0119254 | Ga0453684_0119254_2243_2839 | 198 |
| 6 | 3300038726 | Ga0400490_31562 | Ga0400490_31562_15720_16319 | 199 |
| 7 | 3300039093 | Ga0400489_57198 | Ga0400489_57198_1315_1914 | 199 |
| 8 | 3300031344 | Ga0265316_10309843 | Ga0265316_103098432 | 210 |
| 9 | 3300036647 | Ga0316582_0499542 | Ga0316582_0499542_101_775 | 214 |
| 10 | iso_pu_bacteria | 2740891818 | 2740994718 | 221 |
| 11 | 3300035398 | Ga0316574_0057593 | Ga0316574_0057593_678_1349 | 223 |
| 12 | 3300036647 | Ga0316582_0000910 | Ga0316582_0000910_8946_9617 | 223 |
| 13 | 3300036647 | Ga0316582_0037861 | Ga0316582_0037861_167_838 | 223 |
| 14 | 3300036647 | Ga0316582_0088592 | Ga0316582_0088592_505_1176 | 223 |
| 15 | 3300036712 | Ga0316584_0002953 | Ga0316584_0002953_6319_6990 | 223 |
| 16 | 3300036712 | Ga0316584_0004230 | Ga0316584_0004230_4783_5454 | 223 |
| 17 | 3300036712 | Ga0316584_0055665 | Ga0316584_0055665_1654_2325 | 223 |
| 18 | 3300037588 | Ga0316581_0030450 | Ga0316581_0030450_85_756 | 223 |
| 19 | 3300039062 | Ga0400483_280348 | Ga0400483_280348_2734_3408 | 224 |
| 20 | 3300044712 | Ga0453684_0093213 | Ga0453684_0093213_2190_2867 | 224 |
| 21 | 3300045051 | Ga0451576_0418930 | Ga0451576_0418930_227_901 | 224 |
| 22 | 3300031240 | Ga0265320_10002960 | Ga0265320_100029605 | 225 |
| 23 | 3300031665 | Ga0316575_10000736 | Ga0316575_1000073612 | 225 |
| 24 | 3300031665 | Ga0316575_10006976 | Ga0316575_100069762 | 225 |
| 25 | 3300031665 | Ga0316575_10037024 | Ga0316575_100370241 | 225 |
| 26 | 3300031665 | Ga0316575_10038310 | Ga0316575_100383101 | 225 |
| 27 | 3300031665 | Ga0316575_10044330 | Ga0316575_100443302 | 225 |
| 28 | 3300031665 | Ga0316575_10048006 | Ga0316575_100480062 | 225 |
| 29 | 3300031665 | Ga0316575_10075183 | Ga0316575_100751832 | 225 |
| 30 | 3300031691 | Ga0316579_10006834 | Ga0316579_100068346 | 225 |
| 31 | 3300031691 | Ga0316579_10015669 | Ga0316579_100156692 | 225 |
| 32 | 3300031691 | Ga0316579_10024961 | Ga0316579_100249612 | 225 |
| 33 | 3300031691 | Ga0316579_10028623 | Ga0316579_100286232 | 225 |
| 34 | 3300031727 | Ga0316576_10000114 | Ga0316576_1000011422 | 225 |
| 35 | 3300031727 | Ga0316576_10001636 | Ga0316576_1000163611 | 225 |
| 36 | 3300031727 | Ga0316576_10007603 | Ga0316576_100076036 | 225 |
| 37 | 3300031727 | Ga0316576_10010844 | Ga0316576_100108442 | 225 |
| 38 | 3300031727 | Ga0316576_10056560 | Ga0316576_100565602 | 225 |
| 39 | 3300031727 | Ga0316576_10122951 | Ga0316576_101229512 | 225 |
| 40 | 3300031727 | Ga0316576_10219206 | Ga0316576_102192061 | 225 |
| 41 | 3300031728 | Ga0316578_10002914 | Ga0316578_100029145 | 225 |
| 42 | 3300031728 | Ga0316578_10005305 | Ga0316578_100053051 | 225 |
| 43 | 3300031728 | Ga0316578_10007391 | Ga0316578_100073917 | 225 |
| 44 | 3300031728 | Ga0316578_10024016 | Ga0316578_100240161 | 225 |
| 45 | 3300031728 | Ga0316578_10075846 | Ga0316578_100758463 | 225 |
| 46 | 3300031728 | Ga0316578_10097977 | Ga0316578_100979772 | 225 |
| 47 | 3300031728 | Ga0316578_10180919 | Ga0316578_101809192 | 225 |
| 48 | 3300031728 | Ga0316578_10283863 | Ga0316578_102838631 | 225 |
| 49 | 3300031733 | Ga0316577_10002562 | Ga0316577_100025623 | 225 |
| 50 | 3300031733 | Ga0316577_10003913 | Ga0316577_100039132 | 225 |
| 51 | 3300031733 | Ga0316577_10004365 | Ga0316577_100043656 | 225 |
| 52 | 3300031733 | Ga0316577_10031491 | Ga0316577_100314912 | 225 |
| 53 | 3300031733 | Ga0316577_10033838 | Ga0316577_100338382 | 225 |
| 54 | 3300031733 | Ga0316577_10056988 | Ga0316577_100569882 | 225 |
| 55 | 3300031733 | Ga0316577_10060303 | Ga0316577_100603032 | 225 |
| 56 | 3300032133 | Ga0316583_10000201 | Ga0316583_100002016 | 225 |
| 57 | 3300032133 | Ga0316583_10004070 | Ga0316583_100040703 | 225 |
| 58 | 3300032133 | Ga0316583_10061843 | Ga0316583_100618431 | 225 |
| 59 | 3300032137 | Ga0316585_10000212 | Ga0316585_100002122 | 225 |
| 60 | 3300032137 | Ga0316585_10008906 | Ga0316585_100089062 | 225 |
| 61 | 3300032137 | Ga0316585_10014993 | Ga0316585_100149932 | 225 |
| 62 | 3300032137 | Ga0316585_10058903 | Ga0316585_100589032 | 225 |
| 63 | 3300032137 | Ga0316585_10116877 | Ga0316585_101168771 | 225 |
| 64 | 3300032139 | Ga0316580_10007021 | Ga0316580_100070213 | 225 |
| 65 | 3300032139 | Ga0316580_10008167 | Ga0316580_100081674 | 225 |
| 66 | 3300032139 | Ga0316580_10010758 | Ga0316580_100107582 | 225 |
| 67 | 3300032139 | Ga0316580_10029465 | Ga0316580_100294651 | 225 |
| 68 | 3300032139 | Ga0316580_10030757 | Ga0316580_100307572 | 225 |
| 69 | 3300033524 | Ga0316592_1003436 | Ga0316592_10034364 | 225 |
| 70 | 3300033524 | Ga0316592_1015046 | Ga0316592_10150462 | 225 |
| 71 | 3300035398 | Ga0316574_0000089 | Ga0316574_0000089_14950_15627 | 225 |
| 72 | 3300035398 | Ga0316574_0006656 | Ga0316574_0006656_662_1339 | 225 |
| 73 | 3300035398 | Ga0316574_0027954 | Ga0316574_0027954_1460_2137 | 225 |
| 74 | 3300035398 | Ga0316574_0068646 | Ga0316574_0068646_225_902 | 225 |
| 75 | 3300036647 | Ga0316582_0001494 | Ga0316582_0001494_1434_2111 | 225 |
| 76 | 3300036647 | Ga0316582_0001988 | Ga0316582_0001988_5596_6273 | 225 |
| 77 | 3300036647 | Ga0316582_0026222 | Ga0316582_0026222_1919_2596 | 225 |
| 78 | 3300036647 | Ga0316582_0027672 | Ga0316582_0027672_730_1443 | 225 |
| 79 | 3300036647 | Ga0316582_0051441 | Ga0316582_0051441_173_916 | 225 |
| 80 | 3300036647 | Ga0316582_0068283 | Ga0316582_0068283_1055_1732 | 225 |
| 81 | 3300036647 | Ga0316582_0077746 | Ga0316582_0077746_505_1182 | 225 |
| 82 | 3300036647 | Ga0316582_0109672 | Ga0316582_0109672_190_867 | 225 |
| 83 | 3300036647 | Ga0316582_0138661 | Ga0316582_0138661_541_1218 | 225 |
| 84 | 3300036647 | Ga0316582_0251209 | Ga0316582_0251209_147_824 | 225 |
| 85 | 3300036647 | Ga0316582_0349131 | Ga0316582_0349131_325_1002 | 225 |
| 86 | 3300036712 | Ga0316584_0008389 | Ga0316584_0008389_2415_3158 | 225 |
| 87 | 3300036712 | Ga0316584_0018227 | Ga0316584_0018227_3387_4064 | 225 |
| 88 | 3300036712 | Ga0316584_0037483 | Ga0316584_0037483_2443_3120 | 225 |
| 89 | 3300036712 | Ga0316584_0049987 | Ga0316584_0049987_803_1480 | 225 |
| 90 | 3300036712 | Ga0316584_0096455 | Ga0316584_0096455_1117_1794 | 225 |
| 91 | 3300036712 | Ga0316584_0150690 | Ga0316584_0150690_815_1492 | 225 |
| 92 | 3300036712 | Ga0316584_0424067 | Ga0316584_0424067_253_930 | 225 |
| 93 | 3300037588 | Ga0316581_0006097 | Ga0316581_0006097_2150_2893 | 225 |
| 94 | 3300037588 | Ga0316581_0047753 | Ga0316581_0047753_56_733 | 225 |
| 95 | 3300038725 | Ga0400484_04313 | Ga0400484_04313_8542_9297 | 225 |
| 96 | 3300038726 | Ga0400490_21533 | Ga0400490_21533_240_917 | 225 |
| 97 | 3300038726 | Ga0400490_29127 | Ga0400490_29127_725_1402 | 225 |
| 98 | 3300038735 | Ga0400485_04637 | Ga0400485_04637_672_1349 | 225 |
| 99 | 3300038735 | Ga0400485_19300 | Ga0400485_19300_14588_15265 | 225 |
| 100 | 3300038735 | Ga0400485_20398 | Ga0400485_20398_24814_25491 | 225 |
| 101 | 3300038741 | Ga0400488_53712 | Ga0400488_53712_5699_6376 | 225 |
| 102 | 3300038741 | Ga0400488_59805 | Ga0400488_59805_90_767 | 225 |
| 103 | 3300038742 | Ga0400486_02585 | Ga0400486_02585_1783_2460 | 225 |
| 104 | 3300038742 | Ga0400486_13683 | Ga0400486_13683_4683_5360 | 225 |
| 105 | 3300038742 | Ga0400486_23095 | Ga0400486_23095_341_1018 | 225 |
| 106 | 3300038742 | Ga0400486_30434 | Ga0400486_30434_1704_2381 | 225 |
| 107 | 3300039062 | Ga0400483_075863 | Ga0400483_075863_75916_76593 | 225 |
| 108 | 3300039093 | Ga0400489_27790 | Ga0400489_27790_66460_67137 | 225 |
| 109 | 3300039093 | Ga0400489_79164 | Ga0400489_79164_15554_16231 | 225 |
| 110 | 3300039110 | Ga0400487_06497 | Ga0400487_06497_13817_14494 | 225 |
| 111 | 3300039110 | Ga0400487_36110 | Ga0400487_36110_350_1027 | 225 |
| 112 | 3300028653 | Ga0265323_10019525 | Ga0265323_100195252 | 226 |
| 113 | 3300028653 | Ga0265323_10069915 | Ga0265323_100699152 | 226 |
| 114 | 3300028654 | Ga0265322_10008856 | Ga0265322_100088563 | 226 |
| 115 | 3300031235 | Ga0265330_10135493 | Ga0265330_101354931 | 226 |
| 116 | 3300031242 | Ga0265329_10009646 | Ga0265329_100096462 | 226 |
| 117 | 3300031344 | Ga0265316_10005291 | Ga0265316_100052912 | 226 |
| 118 | 3300031344 | Ga0265316_10160192 | Ga0265316_101601922 | 226 |
| 119 | 3300031712 | Ga0265342_10013796 | Ga0265342_100137961 | 226 |
| 120 | 3300031727 | Ga0316576_10001937 | Ga0316576_100019373 | 226 |
| 121 | 3300031733 | Ga0316577_10068672 | Ga0316577_100686722 | 226 |
| 122 | 3300036712 | Ga0316584_0052924 | Ga0316584_0052924_2326_3006 | 226 |
| 123 | 3300036712 | Ga0316584_0203535 | Ga0316584_0203535_72_755 | 226 |
| 124 | 3300037588 | Ga0316581_0090810 | Ga0316581_0090810_109_789 | 226 |
| 125 | 3300038725 | Ga0400484_28931 | Ga0400484_28931_993_1673 | 226 |
| 126 | 3300038726 | Ga0400490_20282 | Ga0400490_20282_95_775 | 226 |
| 127 | 3300038726 | Ga0400490_41208 | Ga0400490_41208_11560_12246 | 226 |
| 128 | 3300038727 | Ga0400491_11133 | Ga0400491_11133_227_913 | 226 |
| 129 | 3300038741 | Ga0400488_16617 | Ga0400488_16617_1990_2670 | 226 |
| 130 | 3300038741 | Ga0400488_32474 | Ga0400488_32474_2865_3545 | 226 |
| 131 | 3300039062 | Ga0400483_040906 | Ga0400483_040906_191_871 | 226 |
| 132 | 3300039062 | Ga0400483_060240 | Ga0400483_060240_4350_5030 | 226 |
| 133 | 3300039062 | Ga0400483_253686 | Ga0400483_253686_3845_4525 | 226 |
| 134 | 3300039093 | Ga0400489_90809 | Ga0400489_90809_19877_20557 | 226 |
| 135 | 3300039110 | Ga0400487_46803 | Ga0400487_46803_404_1084 | 226 |
| 136 | 3300041456 | Ga0451795_0393842 | Ga0451795_0393842_512_1192 | 226 |
| 137 | 3300044673 | Ga0453683_0176882 | Ga0453683_0176882_337_1017 | 226 |
| 138 | 3300044712 | Ga0453684_0006059 | Ga0453684_0006059_18769_19449 | 226 |
| 139 | 3300044712 | Ga0453684_0231822 | Ga0453684_0231822_1100_1807 | 226 |
| 140 | 3300044712 | Ga0453684_0508067 | Ga0453684_0508067_102_785 | 226 |
| 141 | 3300031727 | Ga0316576_10008461 | Ga0316576_100084615 | 227 |
| 142 | 3300031727 | Ga0316576_10031600 | Ga0316576_100316004 | 227 |
| 143 | 3300031727 | Ga0316576_10217845 | Ga0316576_102178451 | 227 |
| 144 | 3300031728 | Ga0316578_10119466 | Ga0316578_101194662 | 227 |
| 145 | 3300036647 | Ga0316582_0109186 | Ga0316582_0109186_1014_1796 | 227 |
| 146 | 3300036712 | Ga0316584_0014577 | Ga0316584_0014577_2792_3574 | 227 |
| 147 | 3300036712 | Ga0316584_0429638 | Ga0316584_0429638_48_731 | 227 |
| 148 | 3300038725 | Ga0400484_28884 | Ga0400484_28884_2183_2866 | 227 |
| 149 | 3300038726 | Ga0400490_55390 | Ga0400490_55390_3334_4017 | 227 |
| 150 | 3300038735 | Ga0400485_20517 | Ga0400485_20517_24431_25114 | 227 |
| 151 | 3300038741 | Ga0400488_21495 | Ga0400488_21495_1933_2616 | 227 |
| 152 | 3300038742 | Ga0400486_04466 | Ga0400486_04466_20587_21270 | 227 |
| 153 | 3300039062 | Ga0400483_033880 | Ga0400483_033880_3417_4100 | 227 |
| 154 | 3300039062 | Ga0400483_291779 | Ga0400483_291779_4278_4961 | 227 |
| 155 | 3300039093 | Ga0400489_35047 | Ga0400489_35047_57637_58320 | 227 |
| 156 | 3300042876 | Ga0451577_0058036 | Ga0451577_0058036_941_1627 | 227 |
| 157 | 3300031733 | Ga0316577_10058665 | Ga0316577_100586652 | 228 |
| 158 | 3300031733 | Ga0316577_10305164 | Ga0316577_103051642 | 228 |
| 159 | 3300036712 | Ga0316584_0134487 | Ga0316584_0134487_469_1155 | 228 |
| 160 | 3300038725 | Ga0400484_33781 | Ga0400484_33781_807_1493 | 228 |
| 161 | 3300038726 | Ga0400490_30536 | Ga0400490_30536_185_871 | 228 |
| 162 | 3300038741 | Ga0400488_23662 | Ga0400488_23662_5780_6466 | 228 |
| 163 | 3300028573 | Ga0265334_10030930 | Ga0265334_100309302 | 229 |
| 164 | 3300028800 | Ga0265338_10050662 | Ga0265338_100506624 | 229 |
| 165 | 3300031240 | Ga0265320_10015542 | Ga0265320_100155424 | 229 |
| 166 | 3300031344 | Ga0265316_10004671 | Ga0265316_1000467110 | 229 |
| 167 | 3300031344 | Ga0265316_10045403 | Ga0265316_100454032 | 229 |
| 168 | 3300031665 | Ga0316575_10000435 | Ga0316575_100004353 | 229 |
| 169 | 3300031691 | Ga0316579_10042415 | Ga0316579_100424152 | 229 |
| 170 | 3300031712 | Ga0265342_10116200 | Ga0265342_101162002 | 229 |
| 171 | 3300031727 | Ga0316576_10012906 | Ga0316576_100129063 | 229 |
| 172 | 3300031727 | Ga0316576_10033982 | Ga0316576_100339824 | 229 |
| 173 | 3300031727 | Ga0316576_10039352 | Ga0316576_100393523 | 229 |
| 174 | 3300031727 | Ga0316576_10182400 | Ga0316576_101824002 | 229 |
| 175 | 3300031727 | Ga0316576_10331980 | Ga0316576_103319802 | 229 |
| 176 | 3300031728 | Ga0316578_10000606 | Ga0316578_1000060610 | 229 |
| 177 | 3300031728 | Ga0316578_10045756 | Ga0316578_100457562 | 229 |
| 178 | 3300035398 | Ga0316574_0000798 | Ga0316574_0000798_921_1610 | 229 |
| 179 | 3300036647 | Ga0316582_0002896 | Ga0316582_0002896_1694_2383 | 229 |
| 180 | 3300036712 | Ga0316584_0009499 | Ga0316584_0009499_1736_2425 | 229 |
| 181 | 3300036712 | Ga0316584_0078881 | Ga0316584_0078881_1618_2361 | 229 |
| 182 | 3300036712 | Ga0316584_0203091 | Ga0316584_0203091_466_1155 | 229 |
| 183 | 3300044712 | Ga0453684_0214323 | Ga0453684_0214323_1094_1795 | 229 |
| 184 | 3300045051 | Ga0451576_0138960 | Ga0451576_0138960_361_1053 | 229 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1pkx-assembly2.cif.gz_C | crystal structure of human atic in complex with xmp | 0.9518 | 16 | 210 |
| 1pl0-assembly2.cif.gz_C | crystal structure of human atic in complex with folate-based inhibitor, bw2315u89uc | 0.942 | 14 | 211 |
| 5uz0-assembly2.cif.gz_D | crystal structure of aicarft bound to an antifolate | 0.9355 | 14 | 216 |
| 1pl0-assembly2.cif.gz_D | crystal structure of human atic in complex with folate-based inhibitor, bw2315u89uc | 0.9352 | 16 | 216 |
| 1pl0-assembly1.cif.gz_B | crystal structure of human atic in complex with folate-based inhibitor, bw2315u89uc | 0.9351 | 16 | 216 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O35567_1_197_3.40.50.1380 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylglyoxal synthase-like domain | 0.9497 | 14 | 213 | 3.40.50.1380 |
| 4a1oA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylglyoxal synthase-like domain | 0.9416 | 10 | 213 | 3.40.50.1380 |
| af_Q86L14_1_198_3.40.50.1380 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylglyoxal synthase-like domain | 0.9296 | 17 | 214 | 3.40.50.1380 |
| af_O35567_1_197_3.40.50.1380 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylglyoxal synthase-like domain | 0.9262 | 14 | 213 | 3.40.50.1380 |
| af_Q8RWT5_65_266_3.40.50.1380 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylglyoxal synthase-like domain | 0.9246 | 16 | 216 | 3.40.50.1380 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V7DFG1-F1-model_v4 | MGS-like domain-containing protein | 0.9893 | 3 | 225 |
GO:0003937
GO:0004643 GO:0005829 GO:0006189 |
| AF-A0A7X1GQJ0-F1-model_v4 | MGS-like domain-containing protein | 0.9891 | 1 | 223 |
GO:0003937
GO:0004643 GO:0005829 GO:0006189 |
| AF-A0A447RBA6-F1-model_v4 | Phosphoribosylaminoimidazolecarboxamide formyltransferase and IMP cyclohydrolase | 0.9863 | 69 | 211 |
GO:0003937
GO:0004643 GO:0005829 GO:0006189 |
| AF-A0A837Q274-F1-model_v4 | deleted | 0.986 | 67 | 219 |
|
| AF-A0A2G6MQ85-F1-model_v4 | MGS-like domain-containing protein | 0.9858 | 1 | 226 |
GO:0003937
GO:0004643 GO:0005829 GO:0006189 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar