F282778

General Info

Members Datasets Scaffolds Average Seq Length
184 113 368 171

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10049982|Ga0265338_100499823
Length 198
Sequence MDIETEKRLALKARQITPPGASLRKMPGGLDIERLYDEHAQSLYAFLLNFTRNEADTRDLLQEMFVKLVREPKLLAGVREERAFLIRLAHNAAIDLMRRRGTRDRTKENFCAEMISPFAPTSDPDETIFRDELVEALGELPEEQRAVVHLKLWGGLTFEEIAAALEIPPNTAASRYRYGLDKLRGLLRPLYEEMKKAE

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
70 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
71 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
72 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
73 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
74 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
75 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
76 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
77 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
78 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
79 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
80 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
81 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
82 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
83 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
84 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
85 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
88 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
89 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
90 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
91 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
92 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
93 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
94 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
95 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
96 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
97 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
98 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
99 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
100 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
101 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
106 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
107 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
108 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
109 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
110 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
111 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
112 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
113 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 0
Rhizosphere 98.37
Stem 0
Stem Tuber 0
Unclassified 25.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10049982 3300028800 Bacteria 3784
2 rootH2_10048962 3300003320 Bacteria 17429
3 rootL2_10013812 3300003322 Bacteria 2579
4 Ga0070690_100002129 3300005330 Bacteria 10577
5 Ga0068869_100575056 3300005334 Bacteria 949
6 Ga0070689_100002384 3300005340 Bacteria 12254
7 Ga0070689_100024702 3300005340 Bacteria 4508
8 Ga0070689_100036547 3300005340 Bacteria 3757
9 Ga0070689_100239111 3300005340 Bacteria 1495
10 Ga0070689_100605174 3300005340 Bacteria 950
11 Ga0070689_101218970 3300005340 Unclassified 676
12 Ga0070687_100163990 3300005343 Unclassified 1316
13 Ga0070687_100463552 3300005343 Unclassified 845
14 Ga0070661_100000337 3300005344 Bacteria 37436
15 Ga0070675_100322277 3300005354 Bacteria 1365
16 Ga0070671_100526488 3300005355 Bacteria 1018
17 Ga0070671_100987521 3300005355 Unclassified 737
18 Ga0070688_100021736 3300005365 Bacteria 3751
19 Ga0070688_100058966 3300005365 Bacteria 2419
20 Ga0070688_100270241 3300005365 Unclassified 1218
21 Ga0070659_100453372 3300005366 Bacteria 1088
22 Ga0070709_10097205 3300005434 Bacteria 1954
23 Ga0070713_100320113 3300005436 Bacteria 1432
24 Ga0070711_101062586 3300005439 Unclassified 696
25 Ga0070678_100899693 3300005456 Bacteria 809
26 Ga0070685_10013843 3300005466 Bacteria 4265
27 Ga0070699_100623211 3300005518 Unclassified 984
28 Ga0070684_100087746 3300005535 Bacteria 2762
29 Ga0070686_100121754 3300005544 Unclassified 1792
30 Ga0068856_100038883 3300005614 Bacteria 4671
31 Ga0068856_101395672 3300005614 Unclassified 715
32 Ga0068856_101717360 3300005614 Unclassified 640
33 Ga0068859_100161569 3300005617 Bacteria 2319
34 Ga0068859_100420960 3300005617 Bacteria 1432
35 Ga0068859_100816937 3300005617 Bacteria 1019
36 Ga0068859_101264607 3300005617 Unclassified 813
37 Ga0068859_102237668 3300005617 Bacteria 603
38 Ga0068864_100770143 3300005618 Unclassified 944
39 Ga0068863_100106343 3300005841 Bacteria 2670
40 Ga0068863_100901652 3300005841 Bacteria 884
41 Ga0068858_100004908 3300005842 Bacteria 13109
42 Ga0068860_100145679 3300005843 Unclassified 2279
43 Ga0068862_100528152 3300005844 Bacteria 1124
44 Ga0081455_10180142 3300005937 Bacteria 1601
45 Ga0070717_10175561 3300006028 Bacteria 1865
46 Ga0075428_100430979 3300006844 Unclassified 1413
47 Ga0075431_100070611 3300006847 Bacteria 3604
48 Ga0075433_10258752 3300006852 Bacteria 1543
49 Ga0075434_100360571 3300006871 Bacteria 1475
50 Ga0075429_100022528 3300006880 Bacteria 5462
51 Ga0075436_100076603 3300006914 Bacteria 2316
52 Ga0097620_100161571 3300006931 Bacteria 2319
53 Ga0097620_100420929 3300006931 Bacteria 1432
54 Ga0097620_100816963 3300006931 Bacteria 1019
55 Ga0097620_101264327 3300006931 Unclassified 813
56 Ga0097620_102236861 3300006931 Bacteria 603
57 Ga0099794_10129523 3300007265 Bacteria 1273
58 Ga0105240_10004874 3300009093 Bacteria 20189
59 Ga0105240_10753123 3300009093 Bacteria 1059
60 Ga0111539_10333641 3300009094 Bacteria 1765
61 Ga0111539_10492361 3300009094 Bacteria 1428
62 Ga0111539_12408649 3300009094 Unclassified 611
63 Ga0105245_10097214 3300009098 Bacteria 2719
64 Ga0105241_10594709 3300009174 Bacteria 999
65 Ga0105248_10465777 3300009177 Bacteria 1425
66 Ga0105237_10014781 3300009545 Bacteria 8147
67 Ga0105238_10213218 3300009551 Bacteria 1907
68 Ga0105238_10392747 3300009551 Unclassified 1380
69 Ga0105239_10899390 3300010375 Bacteria 1016
70 Ga0157374_10345936 3300013296 Bacteria 1477
71 Ga0157378_10006076 3300013297 Bacteria 10582
72 Ga0163162_10234026 3300013306 Bacteria 1968
73 Ga0157372_10166031 3300013307 Bacteria 2553
74 Ga0157375_10031036 3300013308 Bacteria 5045
75 Ga0207699_10262616 3300025906 Unclassified 1194
76 Ga0207695_10043356 3300025913 Unclassified 4795
77 Ga0207695_10676021 3300025913 Bacteria 913
78 Ga0207671_10012788 3300025914 Bacteria 6728
79 Ga0207663_10905065 3300025916 Unclassified 706
80 Ga0207662_10198372 3300025918 Unclassified 1298
81 Ga0207662_10635001 3300025918 Bacteria 745
82 Ga0207649_10000481 3300025920 Bacteria 28440
83 Ga0207652_10576215 3300025921 Bacteria 1010
84 Ga0207694_10003771 3300025924 Bacteria 12004
85 Ga0207694_10584038 3300025924 Bacteria 939
86 Ga0207659_10211460 3300025926 Bacteria 1555
87 Ga0207700_10345481 3300025928 Bacteria 1295
88 Ga0207644_10474832 3300025931 Bacteria 1029
89 Ga0207690_10370704 3300025932 Bacteria 1136
90 Ga0207670_10003083 3300025936 Bacteria 8806
91 Ga0207670_10003272 3300025936 Bacteria 8579
92 Ga0207670_10063589 3300025936 Bacteria 2526
93 Ga0207670_10116102 3300025936 Bacteria 1937
94 Ga0207670_10474047 3300025936 Unclassified 1013
95 Ga0207670_10649525 3300025936 Bacteria 870
96 Ga0207661_10297722 3300025944 Bacteria 1446
97 Ga0207703_10009116 3300026035 Bacteria 7813
98 Ga0207702_10053628 3300026078 Bacteria 3414
99 Ga0207702_11441236 3300026078 Unclassified 682
100 Ga0207683_10201333 3300026121 Bacteria 1810
101 Ga0268264_10851123 3300028381 Bacteria 913
102 Ga0265326_10015497 3300028558 Bacteria 2211
103 Ga0265319_1018252 3300028563 Unclassified 2646
104 Ga0265319_1024541 3300028563 Bacteria 2168
105 Ga0265334_10005520 3300028573 Bacteria 5524
106 Ga0265334_10235083 3300028573 Unclassified 632
107 Ga0265318_10099322 3300028577 Bacteria 1071
108 Ga0265338_10000160 3300028800 Bacteria 122713
109 Ga0265338_10000310 3300028800 Bacteria 88170
110 Ga0265338_10000433 3300028800 Bacteria 75181
111 Ga0265338_10005563 3300028800 Bacteria 16390
112 Ga0265338_10012836 3300028800 Bacteria 9522
113 Ga0265338_10013582 3300028800 Bacteria 9177
114 Ga0265338_10014917 3300028800 Bacteria 8592
115 Ga0265338_10029970 3300028800 Bacteria 5378
116 Ga0265338_10053562 3300028800 Unclassified 3607
117 Ga0265338_10066757 3300028800 Bacteria 3111
118 Ga0265338_10122787 3300028800 Bacteria 2066
119 Ga0265338_10135083 3300028800 Unclassified 1941
120 Ga0265338_10137885 3300028800 Unclassified 1914
121 Ga0265324_10000403 3300029957 Bacteria 31109
122 Ga0265324_10014148 3300029957 Bacteria 2959
123 Ga0265324_10031737 3300029957 Bacteria 1848
124 Ga0265324_10042533 3300029957 Bacteria 1570
125 Ga0265324_10044813 3300029957 Bacteria 1524
126 Ga0265320_10487348 3300031240 Unclassified 544
127 Ga0265340_10232599 3300031247 Bacteria 824
128 Ga0265339_10029610 3300031249 Bacteria 3106
129 Ga0265339_10213566 3300031249 Bacteria 947
130 Ga0265327_10067753 3300031251 Bacteria 1797
131 Ga0265327_10197629 3300031251 Unclassified 912
132 Ga0265316_10068828 3300031344 Unclassified 2733
133 Ga0265314_10252430 3300031711 Bacteria 1012
134 Ga0265342_10163491 3300031712 Bacteria 1229
135 Ga0265342_10425192 3300031712 Bacteria 684
136 Ga0373954_0368836 3300035118 Bacteria 709
137 Ga0373955_0651157 3300035172 Unclassified 646
138 Ga0373931_0399271 3300035691 Unclassified 870
139 Ga0373933_0844206 3300035724 Unclassified 603
140 Ga0373947_0706130 3300035725 Unclassified 688
141 Ga0373937_0209868 3300036401 Bacteria 1832
142 Ga0451577_0001029 3300042876 Bacteria 40446
143 Ga0451577_0207868 3300042876 Bacteria 1768
144 Ga0451577_0521971 3300042876 Bacteria 1078
145 Ga0453683_0182862 3300044673 Bacteria 1330
146 Ga0453684_0000027 3300044712 Bacteria 778857
147 Ga0453684_0007658 3300044712 Bacteria 19763
148 Ga0453684_0550948 3300044712 Bacteria 1270
149 Ga0453684_0587828 3300044712 Unclassified 1222
150 Ga0453684_1361741 3300044712 Unclassified 738
151 Ga0451576_0151726 3300045051 Bacteria 2417
152 Ga0451576_0310691 3300045051 Bacteria 1649
153 Ga0451576_0514003 3300045051 Bacteria 1258
154 Ga0451576_0518719 3300045051 Bacteria 1252
155 Ga0451576_0574222 3300045051 Bacteria 1185
156 Ga0451576_1365255 3300045051 Bacteria 738
157 Ga0451576_1553443 3300045051 Unclassified 687
158 Ga0495592_0106696 3300046454 Bacteria 1988
159 Ga0495580_0513888 3300046472 Bacteria 799
160 Ga0495608_0753507 3300046511 Unclassified 577
161 Ga0495630_0043196 3300046517 Unclassified 3366
162 Ga0495630_0500064 3300046517 Unclassified 932
163 Ga0495586_0010739 3300046535 Bacteria 4870
164 Ga0495621_0127869 3300046539 Bacteria 987
165 Ga0495667_0040934 3300046559 Bacteria 3074
166 Ga0495680_0396629 3300047322 Unclassified 953
167 Ga0495675_0414619 3300047444 Unclassified 783
168 Ga0495684_0863942 3300047471 Bacteria 586
169 Ga0501032_0000141 3300049569 Bacteria 58799
170 Ga0501033_0000001 3300049570 Bacteria 795921
171 Ga0501038_0000020 3300049574 Bacteria 152738
172 Ga0501047_0595964 3300049581 Bacteria 927
173 Ga0501067_0121867 3300049583 Bacteria 1451
174 Ga0501080_0039571 3300049742 Unclassified 4400
175 Ga0501035_0113290 3300049822 Unclassified 2376
176 nmdc:mga09592_19687_c1 3300050508 Bacteria 5543
177 nmdc:mga06r32_101751_c1 3300050510 Unclassified 2820
178 nmdc:mga08y16_411576_c1 3300050511 Bacteria 1383
179 nmdc:mga08y16_631143_c1 3300050511 Bacteria 1077
180 nmdc:mga08y16_896670_c1 3300050511 Bacteria 873
181 Ga0495601_0231927 3300053077 Bacteria 1206
182 Ga0495601_0585448 3300053077 Unclassified 717
183 Ga0495619_0255344 3300053085 Bacteria 1215
184 Ga0500643_021356 3300053087 Bacteria 2099
185 Ga0265338_10049982
186 rootH2_10048962
187 rootL2_10013812
188 Ga0070690_100002129
189 Ga0068869_100575056
190 Ga0070689_100002384
191 Ga0070689_100024702
192 Ga0070689_100036547
193 Ga0070689_100239111
194 Ga0070689_100605174
195 Ga0070689_101218970
196 Ga0070687_100163990
197 Ga0070687_100463552
198 Ga0070661_100000337
199 Ga0070675_100322277
200 Ga0070671_100526488
201 Ga0070671_100987521
202 Ga0070688_100021736
203 Ga0070688_100058966
204 Ga0070688_100270241
205 Ga0070659_100453372
206 Ga0070709_10097205
207 Ga0070713_100320113
208 Ga0070711_101062586
209 Ga0070678_100899693
210 Ga0070685_10013843
211 Ga0070699_100623211
212 Ga0070684_100087746
213 Ga0070686_100121754
214 Ga0068856_100038883
215 Ga0068856_101395672
216 Ga0068856_101717360
217 Ga0068859_100161569
218 Ga0068859_100420960
219 Ga0068859_100816937
220 Ga0068859_101264607
221 Ga0068859_102237668
222 Ga0068864_100770143
223 Ga0068863_100106343
224 Ga0068863_100901652
225 Ga0068858_100004908
226 Ga0068860_100145679
227 Ga0068862_100528152
228 Ga0081455_10180142
229 Ga0070717_10175561
230 Ga0075428_100430979
231 Ga0075431_100070611
232 Ga0075433_10258752
233 Ga0075434_100360571
234 Ga0075429_100022528
235 Ga0075436_100076603
236 Ga0097620_100161571
237 Ga0097620_100420929
238 Ga0097620_100816963
239 Ga0097620_101264327
240 Ga0097620_102236861
241 Ga0099794_10129523
242 Ga0105240_10004874
243 Ga0105240_10753123
244 Ga0111539_10333641
245 Ga0111539_10492361
246 Ga0111539_12408649
247 Ga0105245_10097214
248 Ga0105241_10594709
249 Ga0105248_10465777
250 Ga0105237_10014781
251 Ga0105238_10213218
252 Ga0105238_10392747
253 Ga0105239_10899390
254 Ga0157374_10345936
255 Ga0157378_10006076
256 Ga0163162_10234026
257 Ga0157372_10166031
258 Ga0157375_10031036
259 Ga0207699_10262616
260 Ga0207695_10043356
261 Ga0207695_10676021
262 Ga0207671_10012788
263 Ga0207663_10905065
264 Ga0207662_10198372
265 Ga0207662_10635001
266 Ga0207649_10000481
267 Ga0207652_10576215
268 Ga0207694_10003771
269 Ga0207694_10584038
270 Ga0207659_10211460
271 Ga0207700_10345481
272 Ga0207644_10474832
273 Ga0207690_10370704
274 Ga0207670_10003083
275 Ga0207670_10003272
276 Ga0207670_10063589
277 Ga0207670_10116102
278 Ga0207670_10474047
279 Ga0207670_10649525
280 Ga0207661_10297722
281 Ga0207703_10009116
282 Ga0207702_10053628
283 Ga0207702_11441236
284 Ga0207683_10201333
285 Ga0268264_10851123
286 Ga0265326_10015497
287 Ga0265319_1018252
288 Ga0265319_1024541
289 Ga0265334_10005520
290 Ga0265334_10235083
291 Ga0265318_10099322
292 Ga0265338_10000160
293 Ga0265338_10000310
294 Ga0265338_10000433
295 Ga0265338_10005563
296 Ga0265338_10012836
297 Ga0265338_10013582
298 Ga0265338_10014917
299 Ga0265338_10029970
300 Ga0265338_10053562
301 Ga0265338_10066757
302 Ga0265338_10122787
303 Ga0265338_10135083
304 Ga0265338_10137885
305 Ga0265324_10000403
306 Ga0265324_10014148
307 Ga0265324_10031737
308 Ga0265324_10042533
309 Ga0265324_10044813
310 Ga0265320_10487348
311 Ga0265340_10232599
312 Ga0265339_10029610
313 Ga0265339_10213566
314 Ga0265327_10067753
315 Ga0265327_10197629
316 Ga0265316_10068828
317 Ga0265314_10252430
318 Ga0265342_10163491
319 Ga0265342_10425192
320 Ga0373954_0368836
321 Ga0373955_0651157
322 Ga0373931_0399271
323 Ga0373933_0844206
324 Ga0373947_0706130
325 Ga0373937_0209868
326 Ga0451577_0001029
327 Ga0451577_0207868
328 Ga0451577_0521971
329 Ga0453683_0182862
330 Ga0453684_0000027
331 Ga0453684_0007658
332 Ga0453684_0550948
333 Ga0453684_0587828
334 Ga0453684_1361741
335 Ga0451576_0151726
336 Ga0451576_0310691
337 Ga0451576_0514003
338 Ga0451576_0518719
339 Ga0451576_0574222
340 Ga0451576_1365255
341 Ga0451576_1553443
342 Ga0495592_0106696
343 Ga0495580_0513888
344 Ga0495608_0753507
345 Ga0495630_0043196
346 Ga0495630_0500064
347 Ga0495586_0010739
348 Ga0495621_0127869
349 Ga0495667_0040934
350 Ga0495680_0396629
351 Ga0495675_0414619
352 Ga0495684_0863942
353 Ga0501032_0000141
354 Ga0501033_0000001
355 Ga0501038_0000020
356 Ga0501047_0595964
357 Ga0501067_0121867
358 Ga0501080_0039571
359 Ga0501035_0113290
360 nmdc:mga09592_19687_c1
361 nmdc:mga06r32_101751_c1
362 nmdc:mga08y16_411576_c1
363 nmdc:mga08y16_631143_c1
364 nmdc:mga08y16_896670_c1
365 Ga0495601_0231927
366 Ga0495601_0585448
367 Ga0495619_0255344
368 Ga0500643_021356

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

136

185

0.99

PF04542

Sigma70_r2

Sigma-70 region 2

35

103

0.94

PF08281

Sigma70_r4_2

Sigma-70, region 4

130

183

0.93

PF07638

Sigma70_ECF

ECF sigma factor

32

188

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hug-assembly2.cif.gz_E crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.9673 101 164
6jhe-assembly1.cif.gz_A crystal structure of bacillus subtilis sigw domain 4 in complexed with -35 element dna 0.9501 113 162
3hug-assembly6.cif.gz_M crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.9487 101 164
2o8x-assembly1.cif.gz_A "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9439 102 157
3vfz-assembly3.cif.gz_A crystal structure of -35 promoter binding domain of sigd of mycobacterium tuberculosis 0.9423 105 159
ID Description Score Start End Superfamily
2o8xC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9879 105 157 1.10.10.10
3hugK00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9535 101 164 1.10.10.10
4nqwA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9528 102 161 1.10.10.10
3vdoA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.952 102 161 1.10.10.10
3hugO00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9509 101 164 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1V9G713-F1-model_v4 RNA polymerase subunit sigma-24 0.5377 1 163 GO:0003677
GO:0006352
GO:0016987
AF-A0A521CBJ8-F1-model_v4 RNA polymerase sigma-70 factor, ECF subfamily 0.5265 1 161 GO:0003677
GO:0006352
GO:0016987
AF-A0A4Q7N459-F1-model_v4 RNA polymerase sigma-70 factor (ECF subfamily) 0.5235 4 163 GO:0003677
GO:0006352
GO:0016987
AF-A0A1G9LX13-F1-model_v4 RNA polymerase sigma-70 factor, ECF subfamily 0.5234 1 161 GO:0003677
GO:0006352
GO:0016987
AF-A0A3B7MMT5-F1-model_v4 RNA polymerase sigma-70 factor 0.5226 4 163 GO:0003677
GO:0006352
GO:0016987

Map