F282683

General Info

Members Datasets Scaffolds Average Seq Length
184 143 368 641

Family's Representative Sequence

Representative Sequence 3300025925|Ga0207650_10022788|Ga0207650_100227884
Length 664
Sequence MSAPQKRARDEEKRPRVVEDDARLSRQAQERQRLELERTWANGRGFIAWLAETDHKVIGRRFIVTAFGYFTLGGILAALMRIQLAKPENTFLGPDLYNQIFTMHGTTMMFLFAVPVVLAMGVYLVPLMIGARGIAFPRMLAYGYWMFLFGGMFLYLMFFFNVGPDNGWFSYPPLAGPEYGYGKRADVWAQLITFTEVSGLVVATCLVVTIFKLRTPGMSLNRMPLFVWAMLIVSFMVIFAMPSIVISSTCLILDRLVSTHFFNQAEGGDPILWQHLFWFFGHPEVYIIFLPALGMMSEVIATFSRRSVFGYTEMILSMTATAFIGFGVWVHHMFATGLPQLGQSFFTAASIMIVIPTAIQIFNWIATIWTARRLQITVPFLYMASFFFVFIIGGLTGVMLASVPLDRQVHDTYFVVAHFHYVLIGGSTFPLLGGIYFWFPKMYGRMLDDRLGRISFWLLFAGFNLTFFPMHLLGLGGMPRRVYTYPAAMGWQGMNLLASVGAATIAVSLLVYLVNVVVSLRRGAVAGENPWGAATLEWATSSPPPSYNFSPQPTVASSEPLWHSELAPPPLVGLATDRREVLVTFLLDAEPDHRYEMPGPSLWPLLTAITTSIMFVWSIFNPWGVVWGSIPIFVTLTGWFWPTEKKERIKHGIHGRMRPSETLP

Samples

Sample ID Description Type Environment
1 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
102 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
106 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
109 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
110 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
111 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
112 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
113 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
114 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
115 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
116 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
117 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
118 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
119 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
120 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
123 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
131 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
142 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
143 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.91
Metatranscriptomes 0
Isolates 1.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.17
Nodule 0
Rhizoplane 4.35
Rhizosphere 93.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207650_10022788 3300025925 Bacteria 4437
2 Ga0065712_10071855 3300005290 Bacteria 5026
3 Ga0065715_10003118 3300005293 Bacteria 5759
4 Ga0070676_10013434 3300005328 Bacteria 4488
5 Ga0070683_100000382 3300005329 Bacteria 30781
6 Ga0070683_100049239 3300005329 Bacteria 3897
7 Ga0070683_100057012 3300005329 Bacteria 3628
8 Ga0070683_100080272 3300005329 Bacteria 3054
9 Ga0070670_100002709 3300005331 Bacteria 14638
10 Ga0068869_100026353 3300005334 Bacteria 4046
11 Ga0070666_10000335 3300005335 Bacteria 29629
12 Ga0070680_100010428 3300005336 Bacteria 7164
13 Ga0070680_100029968 3300005336 Bacteria 4369
14 Ga0068868_100083549 3300005338 Bacteria 2564
15 Ga0070689_100050886 3300005340 Bacteria 3201
16 Ga0070689_100053122 3300005340 Bacteria 3135
17 Ga0070675_100016127 3300005354 Bacteria 5923
18 Ga0070667_100001371 3300005367 Bacteria 21827
19 Ga0070667_100105767 3300005367 Bacteria 2435
20 Ga0070714_100021432 3300005435 Bacteria 5287
21 Ga0070713_100000053 3300005436 Bacteria 71704
22 Ga0070711_100011099 3300005439 Bacteria 5590
23 Ga0070700_100016745 3300005441 Bacteria 4179
24 Ga0070678_100034547 3300005456 Bacteria 3523
25 Ga0070681_10000622 3300005458 Bacteria 29049
26 Ga0070681_10004463 3300005458 Bacteria 13332
27 Ga0070681_10063173 3300005458 Bacteria 3675
28 Ga0068867_100012897 3300005459 Bacteria 5913
29 Ga0070679_100001896 3300005530 Bacteria 18763
30 Ga0070679_100017500 3300005530 Bacteria 6938
31 Ga0070684_100050424 3300005535 Bacteria 3615
32 Ga0070684_100083283 3300005535 Bacteria 2834
33 Ga0070684_100096395 3300005535 Bacteria 2637
34 Ga0070672_100002026 3300005543 Bacteria 12736
35 Ga0070672_100042042 3300005543 Bacteria 3517
36 Ga0070665_100069865 3300005548 Bacteria 3520
37 Ga0068854_100029557 3300005578 Bacteria 3794
38 Ga0068856_100001617 3300005614 Bacteria 23574
39 Ga0068856_100009201 3300005614 Bacteria 9606
40 Ga0070702_100006589 3300005615 Bacteria 5508
41 Ga0068859_100002647 3300005617 Bacteria 18214
42 Ga0068859_100012645 3300005617 Bacteria 8484
43 Ga0068858_100001543 3300005842 Bacteria 23652
44 Ga0068858_100078071 3300005842 Bacteria 3076
45 Ga0068860_100003840 3300005843 Bacteria 15442
46 Ga0068860_100042922 3300005843 Bacteria 4315
47 Ga0081539_10014470 3300005985 Bacteria 5832
48 Ga0070717_10000319 3300006028 Bacteria 31450
49 Ga0075366_10052350 3300006195 Bacteria 2426
50 Ga0075428_100022089 3300006844 Bacteria 7045
51 Ga0075428_100070740 3300006844 Bacteria 3814
52 Ga0075431_100007846 3300006847 Bacteria 10638
53 Ga0075433_10000617 3300006852 Bacteria 23739
54 Ga0075434_100005684 3300006871 Bacteria 11380
55 Ga0075429_100024870 3300006880 Bacteria 5197
56 Ga0097620_100002647 3300006931 Bacteria 18214
57 Ga0097620_100012645 3300006931 Bacteria 8484
58 Ga0105240_10003514 3300009093 Bacteria 24313
59 Ga0105240_10004066 3300009093 Bacteria 22506
60 Ga0105240_10119770 3300009093 Bacteria 3170
61 Ga0111539_10008486 3300009094 Bacteria 13059
62 Ga0105245_10072827 3300009098 Bacteria 3122
63 Ga0114129_10057469 3300009147 Bacteria 5443
64 Ga0105243_10022946 3300009148 Bacteria 4745
65 Ga0105241_10049349 3300009174 Bacteria 3205
66 Ga0105242_10077269 3300009176 Bacteria 2777
67 Ga0105248_10002228 3300009177 Bacteria 21426
68 Ga0105248_10055137 3300009177 Bacteria 4458
69 Ga0105238_10030059 3300009551 Bacteria 5529
70 Ga0105238_10065418 3300009551 Bacteria 3637
71 Ga0105249_10050957 3300009553 Bacteria 3775
72 Ga0157370_10000559 3300013104 Bacteria 46442
73 Ga0157370_10002128 3300013104 Bacteria 24181
74 Ga0157369_10003932 3300013105 Bacteria 17628
75 Ga0157378_10045763 3300013297 Bacteria 3889
76 Ga0157378_10103459 3300013297 Bacteria 2602
77 Ga0157372_10039881 3300013307 Bacteria 5185
78 Ga0157372_10106415 3300013307 Bacteria 3208
79 Ga0157375_10032148 3300013308 Bacteria 4973
80 Ga0157377_10012214 3300014745 Bacteria 4313
81 Ga0157379_10005010 3300014968 Bacteria 11365
82 Ga0209148_1000116 3300025254 Bacteria 190078
83 Ga0207697_10000740 3300025315 Bacteria 18473
84 Ga0207688_10006858 3300025901 Bacteria 6196
85 Ga0207680_10000770 3300025903 Bacteria 15128
86 Ga0207699_10011743 3300025906 Bacteria 4435
87 Ga0207645_10018210 3300025907 Bacteria 4626
88 Ga0207707_10003567 3300025912 Bacteria 13792
89 Ga0207707_10004471 3300025912 Bacteria 12309
90 Ga0207707_10051298 3300025912 Bacteria 3592
91 Ga0207695_10007314 3300025913 Bacteria 14096
92 Ga0207663_10020292 3300025916 Bacteria 3761
93 Ga0207662_10007488 3300025918 Bacteria 5942
94 Ga0207649_10034551 3300025920 Bacteria 3030
95 Ga0207652_10003978 3300025921 Bacteria 12071
96 Ga0207652_10012121 3300025921 Bacteria 6963
97 Ga0207694_10014766 3300025924 Bacteria 5889
98 Ga0207650_10024440 3300025925 Bacteria 4295
99 Ga0207687_10019384 3300025927 Bacteria 4508
100 Ga0207700_10001308 3300025928 Bacteria 14124
101 Ga0207706_10019112 3300025933 Bacteria 6163
102 Ga0207686_10042111 3300025934 Bacteria 2789
103 Ga0207670_10035276 3300025936 Bacteria 3242
104 Ga0207691_10012203 3300025940 Bacteria 8235
105 Ga0207691_10084966 3300025940 Bacteria 2840
106 Ga0207711_10001140 3300025941 Bacteria 25341
107 Ga0207711_10098786 3300025941 Bacteria 2579
108 Ga0207661_10012613 3300025944 Bacteria 6150
109 Ga0207679_10007745 3300025945 Bacteria 6825
110 Ga0207667_10088907 3300025949 Bacteria 3194
111 Ga0207651_10002454 3300025960 Bacteria 8862
112 Ga0207640_10041899 3300025981 Bacteria 2915
113 Ga0207658_10000994 3300025986 Bacteria 23252
114 Ga0207703_10016501 3300026035 Bacteria 5759
115 Ga0207678_10006145 3300026067 Bacteria 10683
116 Ga0207702_10005921 3300026078 Bacteria 10620
117 Ga0207702_10014622 3300026078 Bacteria 6514
118 Ga0207648_10003378 3300026089 Bacteria 16766
119 Ga0207676_10067072 3300026095 Bacteria 2865
120 Ga0207674_10086969 3300026116 Bacteria 3120
121 Ga0207683_10039960 3300026121 Bacteria 4092
122 Ga0207428_10001382 3300027907 Bacteria 25656
123 Ga0268266_10048547 3300028379 Bacteria 3639
124 Ga0268264_10001464 3300028381 Bacteria 22055
125 Ga0307408_100005697 3300031548 Bacteria 8302
126 Ga0307408_100008006 3300031548 Bacteria 6988
127 Ga0307405_10053850 3300031731 Bacteria 2509
128 Ga0307413_10009396 3300031824 Bacteria 4677
129 Ga0307407_10041414 3300031903 Bacteria 2576
130 Ga0307412_10007305 3300031911 Bacteria 6265
131 Ga0307409_100003390 3300031995 Bacteria 8646
132 Ga0307414_10072413 3300032004 Bacteria 2489
133 Ga0307411_10004500 3300032005 Bacteria 6688
134 Ga0373943_0003861 3300035170 Bacteria 6815
135 Ga0373946_0008710 3300035171 Bacteria 3724
136 Ga0373927_0002989 3300035695 Bacteria 12264
137 Ga0395900_0127063 3300037418 Bacteria 2615
138 Ga0451577_0006655 3300042876 Bacteria 11473
139 Ga0453683_0020441 3300044673 Bacteria 4231
140 Ga0451576_0000052 3300045051 Bacteria 310414
141 Ga0451576_0001552 3300045051 Bacteria 38712
142 Ga0495603_0000932 3300046455 Bacteria 16822
143 Ga0495629_0019470 3300046459 Bacteria 4848
144 Ga0495582_0002196 3300046473 Bacteria 10919
145 Ga0495639_0000705 3300046475 Bacteria 15293
146 Ga0495639_0002195 3300046475 Bacteria 8592
147 Ga0495630_0002227 3300046517 Bacteria 13504
148 Ga0495630_0003313 3300046517 Bacteria 11218
149 Ga0495665_0000567 3300046531 Bacteria 18803
150 Ga0495588_0000502 3300046674 Bacteria 19122
151 Ga0495588_0002022 3300046674 Bacteria 8672
152 Ga0495588_0007760 3300046674 Bacteria 4902
153 Ga0495658_0001577 3300046683 Bacteria 11895
154 Ga0495613_0011232 3300046689 Bacteria 6654
155 Ga0495581_0002171 3300047315 Bacteria 11079
156 Ga0495593_0001324 3300047673 Bacteria 14509
157 Ga0495614_0000677 3300048089 Bacteria 14328
158 Ga0496100_0007666 3300048903 Bacteria 5972
159 Ga0496102_0001480 3300048905 Bacteria 20735
160 Ga0496103_0007033 3300048906 Bacteria 6716
161 Ga0496104_0036914 3300048907 Bacteria 4569
162 Ga0496106_0000862 3300048909 Bacteria 22049
163 Ga0496107_0002070 3300048910 Bacteria 12826
164 Ga0496110_0108869 3300048913 Bacteria 2488
165 Ga0496112_0002401 3300048915 Bacteria 15069
166 Ga0501034_0015975 3300049571 Bacteria 7706
167 Ga0501047_0093492 3300049581 Bacteria 2886
168 Ga0501075_0104193 3300049591 Bacteria 2156
169 Ga0501249_004260 3300049679 Bacteria 2903
170 Ga0501044_0040727 3300049823 Bacteria 4840
171 nmdc:mga0k408_17172_c1 3300050493 Bacteria 4028
172 nmdc:mga05p37_25689_c1 3300050507 Bacteria 7164
173 nmdc:mga05p37_46001_c1 3300050507 Bacteria 5367
174 nmdc:mga09592_22969_c1 3300050508 Bacteria 5147
175 nmdc:mga06r32_31842_c1 3300050510 Bacteria 4956
176 nmdc:mga08y16_104004_c1 3300050511 Bacteria 2956
177 nmdc:mga08y16_30374_c1 3300050511 Bacteria 5688
178 nmdc:mga0n895_38773_c1 3300050512 Bacteria 4618
179 nmdc:mga0a205_1786_c1 3300050515 Bacteria 18596
180 nmdc:mga0a205_7278_c1 3300050515 Bacteria 10012
181 Ga0500641_0015240 3300053096 Bacteria 2849
182 Ga0501084_0120945 3300054114 Bacteria 2202
183 8056879345 8056875544 Bacteria 4355797
184 8057134090 8057132660 Bacteria 4061191
185 Ga0207650_10022788
186 Ga0065712_10071855
187 Ga0065715_10003118
188 Ga0070676_10013434
189 Ga0070683_100000382
190 Ga0070683_100049239
191 Ga0070683_100057012
192 Ga0070683_100080272
193 Ga0070670_100002709
194 Ga0068869_100026353
195 Ga0070666_10000335
196 Ga0070680_100010428
197 Ga0070680_100029968
198 Ga0068868_100083549
199 Ga0070689_100050886
200 Ga0070689_100053122
201 Ga0070675_100016127
202 Ga0070667_100001371
203 Ga0070667_100105767
204 Ga0070714_100021432
205 Ga0070713_100000053
206 Ga0070711_100011099
207 Ga0070700_100016745
208 Ga0070678_100034547
209 Ga0070681_10000622
210 Ga0070681_10004463
211 Ga0070681_10063173
212 Ga0068867_100012897
213 Ga0070679_100001896
214 Ga0070679_100017500
215 Ga0070684_100050424
216 Ga0070684_100083283
217 Ga0070684_100096395
218 Ga0070672_100002026
219 Ga0070672_100042042
220 Ga0070665_100069865
221 Ga0068854_100029557
222 Ga0068856_100001617
223 Ga0068856_100009201
224 Ga0070702_100006589
225 Ga0068859_100002647
226 Ga0068859_100012645
227 Ga0068858_100001543
228 Ga0068858_100078071
229 Ga0068860_100003840
230 Ga0068860_100042922
231 Ga0081539_10014470
232 Ga0070717_10000319
233 Ga0075366_10052350
234 Ga0075428_100022089
235 Ga0075428_100070740
236 Ga0075431_100007846
237 Ga0075433_10000617
238 Ga0075434_100005684
239 Ga0075429_100024870
240 Ga0097620_100002647
241 Ga0097620_100012645
242 Ga0105240_10003514
243 Ga0105240_10004066
244 Ga0105240_10119770
245 Ga0111539_10008486
246 Ga0105245_10072827
247 Ga0114129_10057469
248 Ga0105243_10022946
249 Ga0105241_10049349
250 Ga0105242_10077269
251 Ga0105248_10002228
252 Ga0105248_10055137
253 Ga0105238_10030059
254 Ga0105238_10065418
255 Ga0105249_10050957
256 Ga0157370_10000559
257 Ga0157370_10002128
258 Ga0157369_10003932
259 Ga0157378_10045763
260 Ga0157378_10103459
261 Ga0157372_10039881
262 Ga0157372_10106415
263 Ga0157375_10032148
264 Ga0157377_10012214
265 Ga0157379_10005010
266 Ga0209148_1000116
267 Ga0207697_10000740
268 Ga0207688_10006858
269 Ga0207680_10000770
270 Ga0207699_10011743
271 Ga0207645_10018210
272 Ga0207707_10003567
273 Ga0207707_10004471
274 Ga0207707_10051298
275 Ga0207695_10007314
276 Ga0207663_10020292
277 Ga0207662_10007488
278 Ga0207649_10034551
279 Ga0207652_10003978
280 Ga0207652_10012121
281 Ga0207694_10014766
282 Ga0207650_10024440
283 Ga0207687_10019384
284 Ga0207700_10001308
285 Ga0207706_10019112
286 Ga0207686_10042111
287 Ga0207670_10035276
288 Ga0207691_10012203
289 Ga0207691_10084966
290 Ga0207711_10001140
291 Ga0207711_10098786
292 Ga0207661_10012613
293 Ga0207679_10007745
294 Ga0207667_10088907
295 Ga0207651_10002454
296 Ga0207640_10041899
297 Ga0207658_10000994
298 Ga0207703_10016501
299 Ga0207678_10006145
300 Ga0207702_10005921
301 Ga0207702_10014622
302 Ga0207648_10003378
303 Ga0207676_10067072
304 Ga0207674_10086969
305 Ga0207683_10039960
306 Ga0207428_10001382
307 Ga0268266_10048547
308 Ga0268264_10001464
309 Ga0307408_100005697
310 Ga0307408_100008006
311 Ga0307405_10053850
312 Ga0307413_10009396
313 Ga0307407_10041414
314 Ga0307412_10007305
315 Ga0307409_100003390
316 Ga0307414_10072413
317 Ga0307411_10004500
318 Ga0373943_0003861
319 Ga0373946_0008710
320 Ga0373927_0002989
321 Ga0395900_0127063
322 Ga0451577_0006655
323 Ga0453683_0020441
324 Ga0451576_0000052
325 Ga0451576_0001552
326 Ga0495603_0000932
327 Ga0495629_0019470
328 Ga0495582_0002196
329 Ga0495639_0000705
330 Ga0495639_0002195
331 Ga0495630_0002227
332 Ga0495630_0003313
333 Ga0495665_0000567
334 Ga0495588_0000502
335 Ga0495588_0002022
336 Ga0495588_0007760
337 Ga0495658_0001577
338 Ga0495613_0011232
339 Ga0495581_0002171
340 Ga0495593_0001324
341 Ga0495614_0000677
342 Ga0496100_0007666
343 Ga0496102_0001480
344 Ga0496103_0007033
345 Ga0496104_0036914
346 Ga0496106_0000862
347 Ga0496107_0002070
348 Ga0496110_0108869
349 Ga0496112_0002401
350 Ga0501034_0015975
351 Ga0501047_0093492
352 Ga0501075_0104193
353 Ga0501249_004260
354 Ga0501044_0040727
355 nmdc:mga0k408_17172_c1
356 nmdc:mga05p37_25689_c1
357 nmdc:mga05p37_46001_c1
358 nmdc:mga09592_22969_c1
359 nmdc:mga06r32_31842_c1
360 nmdc:mga08y16_104004_c1
361 nmdc:mga08y16_30374_c1
362 nmdc:mga0n895_38773_c1
363 nmdc:mga0a205_1786_c1
364 nmdc:mga0a205_7278_c1
365 Ga0500641_0015240
366 Ga0501084_0120945
367 8056879345
368 8057134090

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00115

COX1

Cytochrome C and Quinol oxidase polypeptide I

57

504

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jrp-assembly1.cif.gz_a plant mitochondrial complex sc iii2+iv from vigna radiata 0.934 39 537
8d4t-assembly1.cif.gz_N mammalian civ with gdn bound 0.9322 41 528
3abk-assembly1.cif.gz_A bovine heart cytochrome c oxidase at the no-bound fully reduced state (50k) 0.932 41 528
1fft-assembly2.cif.gz_F the structure of ubiquinol oxidase from escherichia coli 0.9279 46 531
8c8q-assembly1.cif.gz_A cytochrome c oxidase from schizosaccharomyces pombe 0.9257 44 528
ID Description Score Start End Superfamily
af_Q2FZK0_30_556_1.20.210.10 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.9475 42 535 1.20.210.10
af_Q9ZZX1_1_342_1.20.210.10 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.9319 42 354 1.20.210.10
af_Q7HP04_41_512_1.20.210.10 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.9243 42 494 1.20.210.10
af_P9WP71_20_544_1.20.210.10 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.9216 33 544 1.20.210.10
2yevD01 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.9131 45 544 1.20.210.10
ID Description Score Start End GO Terms
AF-A0A6V8DB03-F1-model_v4 Cytochrome oxidase subunit I profile domain-containing protein 0.9749 398 527 GO:0004129
GO:0009060
GO:0015990
GO:0016020
GO:0020037
GO:0022904
AF-A0A2V7WMY2-F1-model_v4 Cytochrome c oxidase subunit 1 (EC 7.1.1.9) 0.9585 22 623 GO:0004129
GO:0005886
GO:0006119
GO:0015990
GO:0020037
GO:0022904
GO:0046872
AF-A0A536ALJ4-F1-model_v4 Cytochrome ubiquinol oxidase subunit I 0.9575 400 549 GO:0004129
GO:0009060
GO:0015990
GO:0016020
GO:0020037
GO:0022904
AF-A0A5A7N9Q5-F1-model_v4 Cytochrome oxidase subunit I profile domain-containing protein 0.955 392 531 GO:0004129
GO:0009060
GO:0015990
GO:0016020
GO:0020037
GO:0022904
AF-A0A3D2JBI1-F1-model_v4 Cytochrome c oxidase subunit 1 (EC 7.1.1.9) 0.9517 54 548 GO:0004129
GO:0005886
GO:0006119
GO:0015990
GO:0020037
GO:0022904
GO:0046872

Map