F282357

General Info

Members Datasets Scaffolds Average Seq Length
184 138 368 129

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_100015235|Ga0068871_1000152352
Length 142
Sequence MPQTTKLRLSKLELQILEALWAQGKASIREIQEAFPEPRPAYTTIQTTVYRLEGKKALRRVRKISNAHIFEPTVARDVTRHRLLDEILSFFGGQAQPMMAQLAEAGKLTRDDVRELEQMVRARDEEKKRRLRQGSGEPGRAK

Samples

Sample ID Description Type Environment
1 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
81 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
82 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
85 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
86 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
87 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
88 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
90 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
94 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
95 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
96 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
102 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
103 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
104 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
105 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
106 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
109 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
110 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
111 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
112 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
113 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
114 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
115 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
116 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
117 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
118 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
119 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
120 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
123 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
124 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
125 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
126 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
127 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
128 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
129 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
133 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
136 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
137 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
138 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.91
Metatranscriptomes 1.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 1.09
Rhizosphere 95.11
Stem 0
Stem Tuber 0
Unclassified 46.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068871_100015235 3300006358 Bacteria 5750
2 Ga0070658_10529736 3300005327 Bacteria 1019
3 Ga0070690_100308785 3300005330 Unclassified 1136
4 Ga0070690_101319098 3300005330 Unclassified 579
5 Ga0070670_100532693 3300005331 Bacteria 1047
6 Ga0068869_100488489 3300005334 Unclassified 1026
7 Ga0070666_10478090 3300005335 Unclassified 902
8 Ga0070680_100136699 3300005336 Archaea 2053
9 Ga0070689_100073796 3300005340 Bacteria 2669
10 Ga0070688_101280249 3300005365 Unclassified 591
11 Ga0070714_101056004 3300005435 Unclassified 791
12 Ga0070711_100642724 3300005439 Unclassified 889
13 Ga0070694_101284166 3300005444 Bacteria 615
14 Ga0070708_100196557 3300005445 Bacteria 1887
15 Ga0070708_100463722 3300005445 Bacteria 1195
16 Ga0070678_100708024 3300005456 Unclassified 908
17 Ga0070681_10017311 3300005458 Bacteria 7202
18 Ga0068867_100215540 3300005459 Unclassified 1544
19 Ga0070706_100479625 3300005467 Bacteria 1157
20 Ga0070706_101358813 3300005467 Unclassified 651
21 Ga0070698_100620259 3300005471 Bacteria 1022
22 Ga0070699_101909656 3300005518 Unclassified 543
23 Ga0070679_100110048 3300005530 Unclassified 2741
24 Ga0070672_100188269 3300005543 Bacteria 1722
25 Ga0070665_100079889 3300005548 Bacteria 3276
26 Ga0070665_102096797 3300005548 Unclassified 570
27 Ga0068855_100016367 3300005563 Bacteria 8916
28 Ga0068855_101397044 3300005563 Bacteria 722
29 Ga0068856_100034648 3300005614 Bacteria 4944
30 Ga0068856_100326110 3300005614 Bacteria 1553
31 Ga0068859_100485233 3300005617 Bacteria 1331
32 Ga0068864_101741627 3300005618 Unclassified 628
33 Ga0068858_100065971 3300005842 Bacteria 3350
34 Ga0068858_100207142 3300005842 Unclassified 1855
35 Ga0068860_100599695 3300005843 Unclassified 1107
36 Ga0068860_100640694 3300005843 Bacteria 1070
37 Ga0070717_10174356 3300006028 Bacteria 1872
38 Ga0097621_100535951 3300006237 Bacteria 1064
39 Ga0097621_102433452 3300006237 Unclassified 501
40 Ga0068871_100707491 3300006358 Unclassified 923
41 Ga0075430_100077878 3300006846 Unclassified 2779
42 Ga0075430_100901508 3300006846 Unclassified 728
43 Ga0075431_100017282 3300006847 Bacteria 7331
44 Ga0075431_100038723 3300006847 Unclassified 4911
45 Ga0075433_10283284 3300006852 Bacteria 1468
46 Ga0075434_102152109 3300006871 Unclassified 562
47 Ga0075429_100110901 3300006880 Unclassified 2398
48 Ga0068865_100828604 3300006881 Bacteria 800
49 Ga0075436_100004546 3300006914 Bacteria 9505
50 Ga0097620_100485230 3300006931 Bacteria 1331
51 Ga0075435_101219140 3300007076 Unclassified 658
52 Ga0105240_10297132 3300009093 Bacteria 1849
53 Ga0105240_10641789 3300009093 Unclassified 1165
54 Ga0105245_11486076 3300009098 Unclassified 728
55 Ga0105245_12681667 3300009098 Unclassified 551
56 Ga0114129_10157252 3300009147 Unclassified 3107
57 Ga0105241_10870599 3300009174 Unclassified 834
58 Ga0105242_10180402 3300009176 Bacteria 1863
59 Ga0105242_10817747 3300009176 Bacteria 924
60 Ga0105242_11328298 3300009176 Unclassified 744
61 Ga0105248_10394805 3300009177 Unclassified 1558
62 Ga0105248_11255408 3300009177 Bacteria 838
63 Ga0105248_12322719 3300009177 Unclassified 611
64 Ga0105238_10118162 3300009551 Unclassified 2632
65 Ga0105239_10244068 3300010375 Bacteria 2016
66 Ga0105246_10645673 3300011119 Unclassified 921
67 Ga0157370_10022831 3300013104 Bacteria 6221
68 Ga0157370_10068840 3300013104 Unclassified 3344
69 Ga0157369_11189151 3300013105 Unclassified 778
70 Ga0157378_11864363 3300013297 Bacteria 650
71 Ga0163162_10000852 3300013306 Bacteria 28388
72 Ga0163162_12729973 3300013306 Unclassified 568
73 Ga0157372_12222510 3300013307 Bacteria 630
74 Ga0157375_10006680 3300013308 Bacteria 10044
75 Ga0157375_10035113 3300013308 Unclassified 4783
76 Ga0157375_10565542 3300013308 Unclassified 1298
77 Ga0157376_10396438 3300014969 Unclassified 1333
78 Ga0157376_10751959 3300014969 Bacteria 984
79 Ga0157376_10896542 3300014969 Bacteria 905
80 Ga0157376_11052729 3300014969 Unclassified 838
81 Ga0157376_12605608 3300014969 Unclassified 545
82 Ga0157376_13058290 3300014969 Unclassified 506
83 Ga0207699_10805259 3300025906 Unclassified 691
84 Ga0207705_10107710 3300025909 Unclassified 2056
85 Ga0207684_10370245 3300025910 Bacteria 1233
86 Ga0207707_10031205 3300025912 Unclassified 4662
87 Ga0207695_10084880 3300025913 Bacteria 3196
88 Ga0207660_11290286 3300025917 Unclassified 593
89 Ga0207649_11460239 3300025920 Bacteria 541
90 Ga0207652_10150058 3300025921 Unclassified 2087
91 Ga0207694_10396775 3300025924 Bacteria 1147
92 Ga0207687_11123226 3300025927 Bacteria 675
93 Ga0207664_11256501 3300025929 Unclassified 659
94 Ga0207686_10182329 3300025934 Bacteria 1490
95 Ga0207686_10562485 3300025934 Unclassified 893
96 Ga0207686_11100196 3300025934 Unclassified 648
97 Ga0207711_10034168 3300025941 Bacteria 4307
98 Ga0207667_10083955 3300025949 Unclassified 3298
99 Ga0207667_10096191 3300025949 Bacteria 3056
100 Ga0207703_10011260 3300026035 Bacteria 6959
101 Ga0207703_10169547 3300026035 Unclassified 1919
102 Ga0207703_10797542 3300026035 Bacteria 901
103 Ga0207703_12403886 3300026035 Unclassified 502
104 Ga0207639_10967840 3300026041 Unclassified 797
105 Ga0207678_11114486 3300026067 Bacteria 699
106 Ga0207708_11649920 3300026075 Unclassified 563
107 Ga0207702_10026005 3300026078 Bacteria 4860
108 Ga0207702_10047413 3300026078 Bacteria 3621
109 Ga0207648_10258553 3300026089 Bacteria 1553
110 Ga0268264_10092031 3300028381 Unclassified 2617
111 Ga0268264_10749838 3300028381 Unclassified 973
112 Ga0265338_10148574 3300028800 Bacteria 1824
113 Ga0265762_1011576 3300030760 Bacteria 1577
114 Ga0265760_10171078 3300031090 Bacteria 721
115 Ga0265332_10031026 3300031238 Bacteria 2332
116 Ga0265331_10027032 3300031250 Bacteria 2880
117 Ga0307516_10846733 3300031730 Unclassified 578
118 Ga0307409_101993421 3300031995 Unclassified 610
119 Ga0373938_0051509 3300034957 Unclassified 942
120 Ga0373928_0105536 3300035084 Unclassified 740
121 Ga0373939_0076521 3300035114 Unclassified 1102
122 Ga0373931_0012427 3300035691 Bacteria 4125
123 Ga0373935_0544770 3300035692 Unclassified 845
124 Ga0373927_0025870 3300035695 Bacteria 3836
125 Ga0373933_0510225 3300035724 Unclassified 788
126 Ga0373933_0767890 3300035724 Unclassified 634
127 Ga0373937_0744673 3300036401 Unclassified 927
128 Ga0373925_1079864 3300037068 Unclassified 660
129 Ga0373925_1473402 3300037068 Unclassified 557
130 Ga0373925_1578615 3300037068 Bacteria 536
131 Ga0436364_0149847 3300037853 Bacteria 17992
132 Ga0436364_0185143 3300037853 Bacteria 6745
133 Ga0436364_0345195 3300037853 Unclassified 561
134 Ga0436364_0892485 3300037853 Bacteria 838
135 Ga0451807_2012999 3300041486 Unclassified 586
136 Ga0451853_3309580 3300041512 Bacteria 517
137 Ga0451577_0359518 3300042876 Bacteria 1321
138 Ga0466963_0235420 3300044694 Unclassified 1284
139 Ga0453684_0961546 3300044712 Bacteria 911
140 Ga0466957_1274860 3300044842 Unclassified 533
141 Ga0466967_0878662 3300045976 Unclassified 891
142 Ga0495592_0017510 3300046454 Bacteria 5444
143 Ga0495651_0150171 3300046462 Bacteria 1680
144 Ga0495580_0092070 3300046472 Bacteria 2110
145 Ga0495664_0001260 3300046477 Bacteria 13266
146 Ga0495608_0372880 3300046511 Unclassified 876
147 Ga0495618_0240199 3300046514 Bacteria 1139
148 Ga0495628_0005685 3300046516 Bacteria 10922
149 Ga0495630_0153332 3300046517 Bacteria 1753
150 Ga0495652_0047818 3300046529 Bacteria 3668
151 Ga0495640_0280625 3300046533 Bacteria 1037
152 Ga0495586_0155338 3300046535 Bacteria 1289
153 Ga0495587_0089451 3300046536 Bacteria 1779
154 Ga0495645_0006637 3300046543 Bacteria 8038
155 Ga0495667_0036960 3300046559 Bacteria 3256
156 Ga0495634_0058027 3300046642 Bacteria 2581
157 Ga0495635_0681396 3300046663 Unclassified 667
158 Ga0495657_0117686 3300046675 Bacteria 1677
159 Ga0495599_0024239 3300046678 Unclassified 3794
160 Ga0495623_0130036 3300046679 Bacteria 1508
161 Ga0495646_0053244 3300046680 Bacteria 2441
162 Ga0495613_0281716 3300046689 Bacteria 1154
163 Ga0495613_0576799 3300046689 Bacteria 750
164 Ga0495600_0147854 3300046809 Bacteria 1522
165 Ga0495604_0071454 3300047317 Bacteria 2625
166 Ga0495674_0272951 3300047319 Bacteria 1387
167 Ga0495674_0304387 3300047319 Bacteria 1301
168 Ga0495680_0014137 3300047322 Bacteria 6933
169 Ga0495675_0043553 3300047444 Unclassified 2860
170 Ga0495593_0264286 3300047673 Unclassified 861
171 Ga0495602_0373816 3300048088 Bacteria 1023
172 Ga0496115_0823008 3300048918 Unclassified 721
173 Ga0501046_0849693 3300049580 Bacteria 638
174 nmdc:mga05p37_195106_c1 3300050507 Unclassified 2455
175 nmdc:mga09592_192357_c1 3300050508 Unclassified 1766
176 nmdc:mga0qj67_70816_c1 3300050509 Unclassified 2782
177 nmdc:mga0qj67_730853_c1 3300050509 Unclassified 786
178 nmdc:mga06r32_123056_c1 3300050510 Bacteria 2560
179 nmdc:mga06r32_7863_c1 3300050510 Bacteria 9582
180 nmdc:mga08x19_13188_c1 3300050514 Bacteria 4992
181 nmdc:mga08x19_705073_c1 3300050514 Unclassified 716
182 nmdc:mga0a205_270885_c1 3300050515 Unclassified 1575
183 Ga0500568_0000631 3300053139 Bacteria 25343
184 Ga0501082_0001000 3300060353 Bacteria 24972
185 Ga0068871_100015235
186 Ga0070658_10529736
187 Ga0070690_100308785
188 Ga0070690_101319098
189 Ga0070670_100532693
190 Ga0068869_100488489
191 Ga0070666_10478090
192 Ga0070680_100136699
193 Ga0070689_100073796
194 Ga0070688_101280249
195 Ga0070714_101056004
196 Ga0070711_100642724
197 Ga0070694_101284166
198 Ga0070708_100196557
199 Ga0070708_100463722
200 Ga0070678_100708024
201 Ga0070681_10017311
202 Ga0068867_100215540
203 Ga0070706_100479625
204 Ga0070706_101358813
205 Ga0070698_100620259
206 Ga0070699_101909656
207 Ga0070679_100110048
208 Ga0070672_100188269
209 Ga0070665_100079889
210 Ga0070665_102096797
211 Ga0068855_100016367
212 Ga0068855_101397044
213 Ga0068856_100034648
214 Ga0068856_100326110
215 Ga0068859_100485233
216 Ga0068864_101741627
217 Ga0068858_100065971
218 Ga0068858_100207142
219 Ga0068860_100599695
220 Ga0068860_100640694
221 Ga0070717_10174356
222 Ga0097621_100535951
223 Ga0097621_102433452
224 Ga0068871_100707491
225 Ga0075430_100077878
226 Ga0075430_100901508
227 Ga0075431_100017282
228 Ga0075431_100038723
229 Ga0075433_10283284
230 Ga0075434_102152109
231 Ga0075429_100110901
232 Ga0068865_100828604
233 Ga0075436_100004546
234 Ga0097620_100485230
235 Ga0075435_101219140
236 Ga0105240_10297132
237 Ga0105240_10641789
238 Ga0105245_11486076
239 Ga0105245_12681667
240 Ga0114129_10157252
241 Ga0105241_10870599
242 Ga0105242_10180402
243 Ga0105242_10817747
244 Ga0105242_11328298
245 Ga0105248_10394805
246 Ga0105248_11255408
247 Ga0105248_12322719
248 Ga0105238_10118162
249 Ga0105239_10244068
250 Ga0105246_10645673
251 Ga0157370_10022831
252 Ga0157370_10068840
253 Ga0157369_11189151
254 Ga0157378_11864363
255 Ga0163162_10000852
256 Ga0163162_12729973
257 Ga0157372_12222510
258 Ga0157375_10006680
259 Ga0157375_10035113
260 Ga0157375_10565542
261 Ga0157376_10396438
262 Ga0157376_10751959
263 Ga0157376_10896542
264 Ga0157376_11052729
265 Ga0157376_12605608
266 Ga0157376_13058290
267 Ga0207699_10805259
268 Ga0207705_10107710
269 Ga0207684_10370245
270 Ga0207707_10031205
271 Ga0207695_10084880
272 Ga0207660_11290286
273 Ga0207649_11460239
274 Ga0207652_10150058
275 Ga0207694_10396775
276 Ga0207687_11123226
277 Ga0207664_11256501
278 Ga0207686_10182329
279 Ga0207686_10562485
280 Ga0207686_11100196
281 Ga0207711_10034168
282 Ga0207667_10083955
283 Ga0207667_10096191
284 Ga0207703_10011260
285 Ga0207703_10169547
286 Ga0207703_10797542
287 Ga0207703_12403886
288 Ga0207639_10967840
289 Ga0207678_11114486
290 Ga0207708_11649920
291 Ga0207702_10026005
292 Ga0207702_10047413
293 Ga0207648_10258553
294 Ga0268264_10092031
295 Ga0268264_10749838
296 Ga0265338_10148574
297 Ga0265762_1011576
298 Ga0265760_10171078
299 Ga0265332_10031026
300 Ga0265331_10027032
301 Ga0307516_10846733
302 Ga0307409_101993421
303 Ga0373938_0051509
304 Ga0373928_0105536
305 Ga0373939_0076521
306 Ga0373931_0012427
307 Ga0373935_0544770
308 Ga0373927_0025870
309 Ga0373933_0510225
310 Ga0373933_0767890
311 Ga0373937_0744673
312 Ga0373925_1079864
313 Ga0373925_1473402
314 Ga0373925_1578615
315 Ga0436364_0149847
316 Ga0436364_0185143
317 Ga0436364_0345195
318 Ga0436364_0892485
319 Ga0451807_2012999
320 Ga0451853_3309580
321 Ga0451577_0359518
322 Ga0466963_0235420
323 Ga0453684_0961546
324 Ga0466957_1274860
325 Ga0466967_0878662
326 Ga0495592_0017510
327 Ga0495651_0150171
328 Ga0495580_0092070
329 Ga0495664_0001260
330 Ga0495608_0372880
331 Ga0495618_0240199
332 Ga0495628_0005685
333 Ga0495630_0153332
334 Ga0495652_0047818
335 Ga0495640_0280625
336 Ga0495586_0155338
337 Ga0495587_0089451
338 Ga0495645_0006637
339 Ga0495667_0036960
340 Ga0495634_0058027
341 Ga0495635_0681396
342 Ga0495657_0117686
343 Ga0495599_0024239
344 Ga0495623_0130036
345 Ga0495646_0053244
346 Ga0495613_0281716
347 Ga0495613_0576799
348 Ga0495600_0147854
349 Ga0495604_0071454
350 Ga0495674_0272951
351 Ga0495674_0304387
352 Ga0495680_0014137
353 Ga0495675_0043553
354 Ga0495593_0264286
355 Ga0495602_0373816
356 Ga0496115_0823008
357 Ga0501046_0849693
358 nmdc:mga05p37_195106_c1
359 nmdc:mga09592_192357_c1
360 nmdc:mga0qj67_70816_c1
361 nmdc:mga0qj67_730853_c1
362 nmdc:mga06r32_123056_c1
363 nmdc:mga06r32_7863_c1
364 nmdc:mga08x19_13188_c1
365 nmdc:mga08x19_705073_c1
366 nmdc:mga0a205_270885_c1
367 Ga0500568_0000631
368 Ga0501082_0001000

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03965

Penicillinase_R

Penicillinase repressor

9

122

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.8914 9 71
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.88 9 71
4ija-assembly1.cif.gz_A structure of s. aureus methicillin resistance factor mecr2 0.879 9 69
7ne9-assembly1.cif.gz_DDD a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.8772 4 72
5sva-assembly1.cif.gz_h mediator-rna polymerase ii pre-initiation complex 0.8735 9 69
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8945 6 68 1.10.10.10
4lb5B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8914 9 71 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8819 7 69 1.10.10.10
5j6xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.88 9 71 1.10.10.10
4ijaA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.879 9 69 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2N9MV04-F1-model_v4 Transcriptional repressor, CopY family 0.9472 1 79 GO:0003677
GO:0045892
AF-A0A2N2VVW2-F1-model_v4 Transcriptional regulator 0.9219 4 76 GO:0003677
GO:0005737
GO:0045892
AF-A0A7J7AZU7-F1-model_v4 deleted 0.9204 4 82
AF-H1DIA1-F1-model_v4 Penicillinase repressor 0.917 1 77 GO:0003677
GO:0005737
GO:0045892
AF-A0A3A6BQ02-F1-model_v4 deleted 0.9081 4 82

Map