F282054

General Info

Members Datasets Scaffolds Average Seq Length
184 125 184 361

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100011019|Ga0070667_1000110195
Length 421
Sequence LFLSNKAFKTGLWFSGKKNVVCLQFNVVCLFSFYSETITTGNCLNCGKQASSVNTIKTNEFIFSPKHKVLRHVSFWLLWLFGWASFLSVIGSTFTDNLIRIGLWIPAFTIFSYPVSYIAIPKLLLKGKYLVFLGSLIFWLVVGWYLSVYFLRYVSAPVLDLMDMPHGDAYAWQCFLCVLTTAACFSSLSLGKQWLLKQTEFLQVQQEKITAELQLLKAQVHPHFLFNTLNNIYSFSLDGSPKTPELILKLSSLLSYMLYDCKAEEVRLEKEVEIMKNYIDLEKERYGDKIEISWNVEGDVRDNFISPLLMLPFLENAFKHGASEQIEKPWMGVDISVANDILKFKIANSKNEYISHSNNDNGIGISNVKKRLELLHPGKYELKINDEGDFFAVSLMIKLSGSISAYTMLHLSPAAAQTITT

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
111 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
112 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
113 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
114 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
115 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
116 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
117 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
118 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
119 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
120 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
121 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
122 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
123 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
124 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.17
Nodule 0
Rhizoplane 0
Rhizosphere 96.2
Stem 0
Stem Tuber 0
Unclassified 1.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000297 3300002459 Bacteria 18753
2 Ga0065712_10107760 3300005290 Unclassified 1879
3 Ga0065712_10122383 3300005290 Bacteria 1652
4 Ga0065712_10165449 3300005290 Bacteria 1275
5 Ga0070658_10136928 3300005327 Unclassified 2044
6 Ga0070658_10158009 3300005327 Bacteria 1901
7 Ga0070683_100006160 3300005329 Bacteria 10058
8 Ga0070683_100131742 3300005329 Unclassified 2366
9 Ga0070670_100031080 3300005331 Bacteria 4598
10 Ga0070670_100113440 3300005331 Unclassified 2336
11 Ga0070670_100187933 3300005331 Bacteria 1794
12 Ga0070666_10000062 3300005335 Bacteria 82128
13 Ga0070680_100053462 3300005336 Bacteria 3297
14 Ga0068868_100008548 3300005338 Bacteria 7332
15 Ga0070660_100231701 3300005339 Bacteria 1503
16 Ga0070668_100209832 3300005347 Unclassified 1602
17 Ga0070669_100186838 3300005353 Bacteria 1624
18 Ga0070675_100013348 3300005354 Bacteria 6455
19 Ga0070671_100025713 3300005355 Bacteria 4832
20 Ga0070673_100040270 3300005364 Bacteria 3583
21 Ga0070673_100301441 3300005364 Bacteria 1411
22 Ga0070688_100077679 3300005365 Bacteria 2140
23 Ga0070688_100077813 3300005365 Bacteria 2138
24 Ga0070659_100197792 3300005366 Unclassified 1654
25 Ga0070667_100011019 3300005367 Bacteria 7478
26 Ga0070663_100009705 3300005455 Bacteria 5972
27 Ga0070678_100376827 3300005456 Bacteria 1227
28 Ga0070681_10036122 3300005458 Bacteria 4963
29 Ga0070685_10209039 3300005466 Bacteria 1273
30 Ga0070699_100035304 3300005518 Bacteria 4322
31 Ga0070679_100011937 3300005530 Bacteria 8293
32 Ga0070684_100005030 3300005535 Bacteria 10095
33 Ga0070684_100019509 3300005535 Bacteria 5610
34 Ga0068853_100034640 3300005539 Bacteria 4286
35 Ga0068853_100049465 3300005539 Bacteria 3613
36 Ga0068853_100154652 3300005539 Bacteria 2066
37 Ga0070672_100253058 3300005543 Bacteria 1484
38 Ga0070704_100287258 3300005549 Bacteria 1365
39 Ga0068855_100049106 3300005563 Bacteria 4978
40 Ga0070664_100008218 3300005564 Bacteria 8439
41 Ga0068857_100139225 3300005577 Bacteria 2193
42 Ga0068854_100062051 3300005578 Bacteria 2708
43 Ga0068856_100167585 3300005614 Bacteria 2208
44 Ga0068852_100033766 3300005616 Bacteria 4252
45 Ga0068859_100000013 3300005617 Bacteria 291126
46 Ga0068859_100019545 3300005617 Bacteria 6806
47 Ga0068859_100192904 3300005617 Bacteria 2121
48 Ga0068864_100017067 3300005618 Bacteria 6050
49 Ga0068864_100090441 3300005618 Bacteria 2698
50 Ga0068870_10046706 3300005840 Bacteria 2272
51 Ga0068870_10113376 3300005840 Bacteria 1551
52 Ga0068863_100063775 3300005841 Bacteria 3484
53 Ga0068858_100004158 3300005842 Bacteria 14241
54 Ga0068860_100000052 3300005843 Bacteria 207351
55 Ga0068860_100009239 3300005843 Bacteria 9800
56 Ga0068862_100028120 3300005844 Bacteria 4734
57 Ga0068862_100031626 3300005844 Bacteria 4469
58 Ga0075428_100045655 3300006844 Bacteria 4813
59 Ga0097620_100000013 3300006931 Bacteria 291126
60 Ga0097620_100019544 3300006931 Bacteria 6806
61 Ga0097620_100192888 3300006931 Bacteria 2121
62 Ga0105240_10037670 3300009093 Bacteria 6213
63 Ga0111539_10112175 3300009094 Bacteria 3199
64 Ga0111539_10258858 3300009094 Bacteria 2026
65 Ga0105247_10011909 3300009101 Bacteria 5228
66 Ga0114129_10100644 3300009147 Bacteria 3999
67 Ga0105241_10001650 3300009174 Bacteria 16992
68 Ga0105241_10012369 3300009174 Bacteria 6256
69 Ga0105241_10108619 3300009174 Bacteria 2218
70 Ga0105242_10042638 3300009176 Unclassified 3666
71 Ga0105242_10081589 3300009176 Bacteria 2705
72 Ga0105242_10160152 3300009176 Bacteria 1969
73 Ga0105249_10001056 3300009553 Bacteria 24413
74 Ga0105249_10066039 3300009553 Bacteria 3330
75 Ga0105239_10000084 3300010375 Bacteria 130978
76 Ga0105239_10012928 3300010375 Bacteria 9287
77 Ga0105239_10037305 3300010375 Bacteria 5329
78 Ga0105246_10008436 3300011119 Bacteria 6332
79 Ga0105246_10047376 3300011119 Bacteria 2935
80 Ga0157373_10008417 3300013100 Bacteria 7660
81 Ga0157373_10009091 3300013100 Bacteria 7351
82 Ga0157373_10016042 3300013100 Bacteria 5468
83 Ga0157371_10012164 3300013102 Bacteria 6592
84 Ga0157371_10021334 3300013102 Bacteria 4756
85 Ga0157371_10038858 3300013102 Bacteria 3404
86 Ga0157371_10065710 3300013102 Unclassified 2569
87 Ga0157370_10003673 3300013104 Bacteria 17921
88 Ga0157369_10035576 3300013105 Bacteria 5460
89 Ga0157369_10052268 3300013105 Bacteria 4421
90 Ga0157378_10051657 3300013297 Bacteria 3658
91 Ga0157378_10109037 3300013297 Bacteria 2536
92 Ga0163162_10000300 3300013306 Bacteria 45491
93 Ga0163162_10208652 3300013306 Unclassified 2083
94 Ga0157372_10016701 3300013307 Bacteria 7879
95 Ga0157372_10041858 3300013307 Bacteria 5065
96 Ga0157372_10049166 3300013307 Bacteria 4689
97 Ga0157372_10426193 3300013307 Unclassified 1546
98 Ga0163163_10049367 3300014325 Bacteria 4141
99 Ga0163163_10204282 3300014325 Bacteria 2024
100 Ga0163163_10252780 3300014325 Bacteria 1813
101 Ga0163163_10255611 3300014325 Unclassified 1803
102 Ga0157380_10003057 3300014326 Bacteria 11410
103 Ga0157380_10339528 3300014326 Unclassified 1400
104 Ga0157377_10019478 3300014745 Bacteria 3546
105 Ga0157379_10029875 3300014968 Bacteria 4847
106 Ga0157376_10002784 3300014969 Bacteria 11942
107 Ga0207656_10018344 3300025321 Bacteria 2754
108 Ga0207682_10016258 3300025893 Bacteria 2901
109 Ga0207710_10014850 3300025900 Bacteria 3289
110 Ga0207680_10000039 3300025903 Bacteria 71337
111 Ga0207643_10043699 3300025908 Bacteria 2529
112 Ga0207705_10148985 3300025909 Bacteria 1752
113 Ga0207654_10000849 3300025911 Bacteria 16865
114 Ga0207654_10115689 3300025911 Bacteria 1676
115 Ga0207707_10124522 3300025912 Bacteria 2254
116 Ga0207695_10012676 3300025913 Bacteria 10098
117 Ga0207695_10058141 3300025913 Bacteria 4015
118 Ga0207695_10061817 3300025913 Unclassified 3869
119 Ga0207671_10007836 3300025914 Bacteria 9180
120 Ga0207660_10015857 3300025917 Bacteria 4980
121 Ga0207657_10248731 3300025919 Bacteria 1418
122 Ga0207652_10008396 3300025921 Bacteria 8310
123 Ga0207681_10021215 3300025923 Bacteria 4126
124 Ga0207681_10173530 3300025923 Bacteria 1636
125 Ga0207650_10037027 3300025925 Unclassified 3553
126 Ga0207650_10115460 3300025925 Bacteria 2084
127 Ga0207659_10150101 3300025926 Bacteria 1819
128 Ga0207690_10145931 3300025932 Unclassified 1749
129 Ga0207686_10055666 3300025934 Bacteria 2483
130 Ga0207691_10154481 3300025940 Bacteria 2016
131 Ga0207691_10302695 3300025940 Bacteria 1373
132 Ga0207689_10013916 3300025942 Bacteria 6853
133 Ga0207661_10180112 3300025944 Unclassified 1845
134 Ga0207679_10006200 3300025945 Bacteria 7548
135 Ga0207679_10021372 3300025945 Unclassified 4387
136 Ga0207667_10061968 3300025949 Unclassified 3912
137 Ga0207651_10274128 3300025960 Bacteria 1391
138 Ga0207712_10001599 3300025961 Bacteria 15251
139 Ga0207712_10214749 3300025961 Bacteria 1534
140 Ga0207712_10233567 3300025961 Bacteria 1478
141 Ga0207677_10009131 3300026023 Bacteria 5568
142 Ga0207703_10002817 3300026035 Bacteria 14830
143 Ga0207639_10083375 3300026041 Bacteria 2537
144 Ga0207678_10198379 3300026067 Bacteria 1715
145 Ga0207708_10199612 3300026075 Bacteria 1595
146 Ga0207702_10183828 3300026078 Unclassified 1927
147 Ga0207641_10000144 3300026088 Bacteria 101119
148 Ga0207641_10068393 3300026088 Bacteria 3045
149 Ga0207648_10292785 3300026089 Bacteria 1458
150 Ga0207676_10094211 3300026095 Bacteria 2467
151 Ga0207674_10051171 3300026116 Bacteria 4216
152 Ga0207674_10357696 3300026116 Bacteria 1411
153 Ga0207675_100014790 3300026118 Bacteria 7281
154 Ga0207675_100158315 3300026118 Bacteria 2159
155 Ga0207698_10015616 3300026142 Bacteria 5091
156 Ga0207698_10077124 3300026142 Bacteria 2671
157 Ga0268265_10027980 3300028380 Bacteria 4032
158 Ga0268264_10000143 3300028381 Bacteria 170031
159 Ga0268264_10002270 3300028381 Bacteria 17023
160 Ga0268264_10020103 3300028381 Bacteria 5455
161 Ga0307517_10000305 3300028786 Bacteria 84961
162 Ga0307515_10000157 3300028794 Bacteria 165733
163 Ga0265327_10059090 3300031251 Bacteria 1965
164 Ga0307414_10175985 3300032004 Bacteria 1716
165 Ga0307414_10278088 3300032004 Bacteria 1405
166 Ga0307510_10000292 3300033180 Bacteria 46223
167 Ga0395898_0218418 3300037466 Unclassified 1818
168 Ga0395901_0305545 3300038443 Unclassified 1648
169 Ga0495606_0012740 3300046507 Bacteria 6704
170 Ga0495648_0002970 3300046524 Bacteria 15217
171 Ga0495598_0042896 3300046537 Bacteria 1330
172 Ga0495611_0000047 3300046648 Bacteria 85473
173 Ga0495687_000006 3300047443 Bacteria 571936
174 Ga0495686_0067819 3300047472 Bacteria 2202
175 Ga0501217_009341 3300049661 Bacteria 2131
176 Ga0501235_018473 3300049669 Bacteria 1546
177 nmdc:mga05p37_80007_c1 3300050507 Bacteria 4024
178 nmdc:mga08y16_287516_c1 3300050511 Bacteria 1695
179 Ga0500583_0001853 3300053092 Bacteria 6176
180 Ga0500618_002968 3300053125 Bacteria 6055
181 Ga0500628_010336 3300053129 Unclassified 1669
182 Ga0500622_0003494 3300053156 Bacteria 10431
183 Ga0501084_0005850 3300054114 Bacteria 10121
184 Ga0501082_0123057 3300060353 Bacteria 2249

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014326 Ga0157380_10339528 Ga0157380_103395281 273
2 3300038443 Ga0395901_0305545 Ga0395901_0305545_89_1159 282
3 3300014325 Ga0163163_10255611 Ga0163163_102556111 289
4 3300046537 Ga0495598_0042896 Ga0495598_0042896_311_1234 289
5 3300005840 Ga0068870_10046706 Ga0068870_100467061 290
6 3300009176 Ga0105242_10081589 Ga0105242_100815893 290
7 3300014745 Ga0157377_10019478 Ga0157377_100194782 290
8 3300014325 Ga0163163_10204282 Ga0163163_102042822 303
9 3300014326 Ga0157380_10003057 Ga0157380_100030577 303
10 3300049669 Ga0501235_018473 Ga0501235_018473_479_1441 303
11 3300005578 Ga0068854_100062051 Ga0068854_1000620511 305
12 3300009553 Ga0105249_10001056 Ga0105249_1000105618 305
13 3300013102 Ga0157371_10012164 Ga0157371_100121643 306
14 3300025919 Ga0207657_10248731 Ga0207657_102487311 307
15 3300013105 Ga0157369_10035576 Ga0157369_100355763 308
16 3300037466 Ga0395898_0218418 Ga0395898_0218418_175_1329 308
17 3300025940 Ga0207691_10154481 Ga0207691_101544811 309
18 3300013100 Ga0157373_10016042 Ga0157373_100160422 310
19 3300013307 Ga0157372_10049166 Ga0157372_100491663 310
20 3300005336 Ga0070680_100053462 Ga0070680_1000534624 312
21 3300005458 Ga0070681_10036122 Ga0070681_100361222 312
22 3300005530 Ga0070679_100011937 Ga0070679_1000119372 312
23 3300009553 Ga0105249_10066039 Ga0105249_100660393 312
24 3300025912 Ga0207707_10124522 Ga0207707_101245222 312
25 3300025917 Ga0207660_10015857 Ga0207660_100158576 312
26 3300025921 Ga0207652_10008396 Ga0207652_100083962 312
27 3300009147 Ga0114129_10100644 Ga0114129_101006442 316
28 3300050507 nmdc:mga05p37_80007_c1 nmdc:mga05p37_80007_c1_1422_2447 316
29 3300005518 Ga0070699_100035304 Ga0070699_1000353042 317
30 3300009094 Ga0111539_10258858 Ga0111539_102588582 318
31 3300025909 Ga0207705_10148985 Ga0207705_101489852 318
32 3300050511 nmdc:mga08y16_287516_c1 nmdc:mga08y16_287516_c1_109_1206 318
33 3300005844 Ga0068862_100031626 Ga0068862_1000316264 319
34 3300025923 Ga0207681_10021215 Ga0207681_100212153 319
35 3300005617 Ga0068859_100000013 Ga0068859_100000013227 323
36 3300006931 Ga0097620_100000013 Ga0097620_100000013227 323
37 3300025900 Ga0207710_10014850 Ga0207710_100148502 323
38 3300025911 Ga0207654_10000849 Ga0207654_1000084911 323
39 3300006844 Ga0075428_100045655 Ga0075428_1000456553 324
40 3300028794 Ga0307515_10000157 Ga0307515_1000015746 324
41 3300005366 Ga0070659_100197792 Ga0070659_1001977922 325
42 3300013307 Ga0157372_10426193 Ga0157372_104261932 325
43 3300025932 Ga0207690_10145931 Ga0207690_101459312 325
44 3300009174 Ga0105241_10012369 Ga0105241_100123692 326
45 3300025911 Ga0207654_10115689 Ga0207654_101156891 326
46 3300025913 Ga0207695_10012676 Ga0207695_100126762 326
47 3300005455 Ga0070663_100009705 Ga0070663_1000097053 327
48 3300005539 Ga0068853_100049465 Ga0068853_1000494653 327
49 3300010375 Ga0105239_10012928 Ga0105239_100129285 327
50 3300013100 Ga0157373_10009091 Ga0157373_100090913 327
51 3300013102 Ga0157371_10021334 Ga0157371_100213342 327
52 3300013105 Ga0157369_10052268 Ga0157369_100522682 327
53 3300026067 Ga0207678_10198379 Ga0207678_101983791 327
54 3300054114 Ga0501084_0005850 Ga0501084_0005850_7016_8107 327
55 3300060353 Ga0501082_0123057 Ga0501082_0123057_635_1726 327
56 3300005543 Ga0070672_100253058 Ga0070672_1002530581 329
57 3300013102 Ga0157371_10065710 Ga0157371_100657101 329
58 3300013307 Ga0157372_10016701 Ga0157372_100167015 329
59 3300026118 Ga0207675_100158315 Ga0207675_1001583152 329
60 3300005614 Ga0068856_100167585 Ga0068856_1001675852 330
61 3300026078 Ga0207702_10183828 Ga0207702_101838281 330
62 3300026118 Ga0207675_100014790 Ga0207675_1000147904 330
63 3300005840 Ga0068870_10113376 Ga0068870_101133761 333
64 3300025893 Ga0207682_10016258 Ga0207682_100162582 333
65 3300005843 Ga0068860_100000052 Ga0068860_100000052172 335
66 3300013306 Ga0163162_10000300 Ga0163162_1000030011 335
67 3300028381 Ga0268264_10000143 Ga0268264_100001436 335
68 3300047443 Ga0495687_000006 Ga0495687_000006_566356_567453 335
69 3300013104 Ga0157370_10003673 Ga0157370_100036734 336
70 3300013307 Ga0157372_10041858 Ga0157372_100418585 336
71 3300031251 Ga0265327_10059090 Ga0265327_100590901 336
72 3300005290 Ga0065712_10107760 Ga0065712_101077601 337
73 3300005327 Ga0070658_10136928 Ga0070658_101369282 337
74 3300005329 Ga0070683_100131742 Ga0070683_1001317422 337
75 3300005339 Ga0070660_100231701 Ga0070660_1002317011 337
76 3300005535 Ga0070684_100019509 Ga0070684_1000195096 337
77 3300005539 Ga0068853_100034640 Ga0068853_1000346402 337
78 3300005539 Ga0068853_100154652 Ga0068853_1001546523 337
79 3300005563 Ga0068855_100049106 Ga0068855_1000491065 337
80 3300009093 Ga0105240_10037670 Ga0105240_100376703 337
81 3300009174 Ga0105241_10108619 Ga0105241_101086192 337
82 3300010375 Ga0105239_10000084 Ga0105239_100000848 337
83 3300010375 Ga0105239_10037305 Ga0105239_100373053 337
84 3300013102 Ga0157371_10038858 Ga0157371_100388582 337
85 3300013297 Ga0157378_10051657 Ga0157378_100516573 337
86 3300014325 Ga0163163_10049367 Ga0163163_100493671 337
87 3300014325 Ga0163163_10252780 Ga0163163_102527801 337
88 3300025913 Ga0207695_10058141 Ga0207695_100581412 337
89 3300025913 Ga0207695_10061817 Ga0207695_100618173 337
90 3300025944 Ga0207661_10180112 Ga0207661_101801122 337
91 3300025945 Ga0207679_10021372 Ga0207679_100213725 337
92 3300025949 Ga0207667_10061968 Ga0207667_100619684 337
93 3300026041 Ga0207639_10083375 Ga0207639_100833752 337
94 3300026142 Ga0207698_10077124 Ga0207698_100771243 337
95 3300028786 Ga0307517_10000305 Ga0307517_1000030548 337
96 3300033180 Ga0307510_10000292 Ga0307510_100002929 337
97 3300046507 Ga0495606_0012740 Ga0495606_0012740_2836_3933 337
98 3300046648 Ga0495611_0000047 Ga0495611_0000047_84054_85151 337
99 3300009176 Ga0105242_10160152 Ga0105242_101601522 338
100 3300011119 Ga0105246_10047376 Ga0105246_100473763 338
101 3300005329 Ga0070683_100006160 Ga0070683_1000061603 339
102 3300005331 Ga0070670_100113440 Ga0070670_1001134403 339
103 3300005535 Ga0070684_100005030 Ga0070684_1000050306 339
104 3300005564 Ga0070664_100008218 Ga0070664_1000082183 339
105 3300005617 Ga0068859_100019545 Ga0068859_1000195453 339
106 3300005618 Ga0068864_100017067 Ga0068864_1000170675 339
107 3300005842 Ga0068858_100004158 Ga0068858_1000041585 339
108 3300005844 Ga0068862_100028120 Ga0068862_1000281203 339
109 3300006931 Ga0097620_100019544 Ga0097620_1000195442 339
110 3300009101 Ga0105247_10011909 Ga0105247_100119093 339
111 3300009174 Ga0105241_10001650 Ga0105241_100016504 339
112 3300014968 Ga0157379_10029875 Ga0157379_100298751 339
113 3300025925 Ga0207650_10037027 Ga0207650_100370273 339
114 3300025945 Ga0207679_10006200 Ga0207679_100062003 339
115 3300026035 Ga0207703_10002817 Ga0207703_100028173 339
116 3300026075 Ga0207708_10199612 Ga0207708_101996122 339
117 3300028380 Ga0268265_10027980 Ga0268265_100279803 339
118 3300013100 Ga0157373_10008417 Ga0157373_100084173 340
119 3300032004 Ga0307414_10278088 Ga0307414_102780881 340
120 3300005290 Ga0065712_10165449 Ga0065712_101654491 341
121 3300005347 Ga0070668_100209832 Ga0070668_1002098322 341
122 3300005353 Ga0070669_100186838 Ga0070669_1001868381 341
123 3300005364 Ga0070673_100301441 Ga0070673_1003014411 341
124 3300005365 Ga0070688_100077679 Ga0070688_1000776792 341
125 3300005456 Ga0070678_100376827 Ga0070678_1003768271 341
126 3300005466 Ga0070685_10209039 Ga0070685_102090392 341
127 3300005617 Ga0068859_100192904 Ga0068859_1001929041 341
128 3300005618 Ga0068864_100090441 Ga0068864_1000904413 341
129 3300006931 Ga0097620_100192888 Ga0097620_1001928881 341
130 3300009176 Ga0105242_10042638 Ga0105242_100426383 341
131 3300013306 Ga0163162_10208652 Ga0163162_102086522 341
132 3300025908 Ga0207643_10043699 Ga0207643_100436991 341
133 3300025923 Ga0207681_10173530 Ga0207681_101735302 341
134 3300025926 Ga0207659_10150101 Ga0207659_101501012 341
135 3300025934 Ga0207686_10055666 Ga0207686_100556663 341
136 3300025940 Ga0207691_10302695 Ga0207691_103026952 341
137 3300025960 Ga0207651_10274128 Ga0207651_102741282 341
138 3300025961 Ga0207712_10233567 Ga0207712_102335671 341
139 3300026095 Ga0207676_10094211 Ga0207676_100942113 341
140 3300026116 Ga0207674_10357696 Ga0207674_103576962 341
141 3300005290 Ga0065712_10122383 Ga0065712_101223832 342
142 3300005354 Ga0070675_100013348 Ga0070675_1000133484 342
143 3300005365 Ga0070688_100077813 Ga0070688_1000778132 342
144 3300005549 Ga0070704_100287258 Ga0070704_1002872581 342
145 3300009094 Ga0111539_10112175 Ga0111539_101121753 342
146 3300014969 Ga0157376_10002784 Ga0157376_100027849 342
147 3300026089 Ga0207648_10292785 Ga0207648_102927852 342
148 3300049661 Ga0501217_009341 Ga0501217_009341_97_1209 342
149 3300005327 Ga0070658_10158009 Ga0070658_101580092 344
150 3300005331 Ga0070670_100031080 Ga0070670_1000310804 344
151 3300005335 Ga0070666_10000062 Ga0070666_1000006214 344
152 3300005338 Ga0068868_100008548 Ga0068868_1000085484 344
153 3300005355 Ga0070671_100025713 Ga0070671_1000257133 344
154 3300005364 Ga0070673_100040270 Ga0070673_1000402701 344
155 3300005367 Ga0070667_100011019 Ga0070667_1000110195 344
156 3300005616 Ga0068852_100033766 Ga0068852_1000337662 344
157 3300005841 Ga0068863_100063775 Ga0068863_1000637752 344
158 3300005843 Ga0068860_100009239 Ga0068860_1000092392 344
159 3300011119 Ga0105246_10008436 Ga0105246_100084368 344
160 3300013297 Ga0157378_10109037 Ga0157378_101090372 344
161 3300025321 Ga0207656_10018344 Ga0207656_100183442 344
162 3300025903 Ga0207680_10000039 Ga0207680_100000399 344
163 3300025914 Ga0207671_10007836 Ga0207671_100078363 344
164 3300026023 Ga0207677_10009131 Ga0207677_100091314 344
165 3300026088 Ga0207641_10000144 Ga0207641_1000014437 344
166 3300026088 Ga0207641_10068393 Ga0207641_100683932 344
167 3300026142 Ga0207698_10015616 Ga0207698_100156166 344
168 3300028381 Ga0268264_10002270 Ga0268264_100022708 344
169 3300028381 Ga0268264_10020103 Ga0268264_100201032 344
170 3300046524 Ga0495648_0002970 Ga0495648_0002970_8546_9727 344
171 3300053092 Ga0500583_0001853 Ga0500583_0001853_4485_5666 344
172 3300053125 Ga0500618_002968 Ga0500618_002968_3856_5031 344
173 3300053156 Ga0500622_0003494 Ga0500622_0003494_2952_4133 344
174 3300025961 Ga0207712_10214749 Ga0207712_102147491 346
175 3300053129 Ga0500628_010336 Ga0500628_010336_389_1513 346
176 3300025942 Ga0207689_10013916 Ga0207689_100139163 347
177 3300047472 Ga0495686_0067819 Ga0495686_0067819_507_1664 347
178 3300032004 Ga0307414_10175985 Ga0307414_101759852 348
179 3300005331 Ga0070670_100187933 Ga0070670_1001879331 350
180 3300005577 Ga0068857_100139225 Ga0068857_1001392252 350
181 3300025925 Ga0207650_10115460 Ga0207650_101154602 350
182 3300002459 JGI24751J29686_10000297 JGI24751J29686_100002979 355
183 3300025961 Ga0207712_10001599 Ga0207712_100015998 355
184 3300026116 Ga0207674_10051171 Ga0207674_100511713 355

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06580

His_kinase

Histidine kinase

211

290

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8sbm-assembly1.cif.gz_A crystal structure of the wild-type catalytic atp-binding domain of mtb doss 0.7322 210 334
8sbm-assembly1.cif.gz_A crystal structure of the wild-type catalytic atp-binding domain of mtb doss 0.7125 210 334
6swj-assembly1.cif.gz_A-2 the kinase domain of gans, a histidine kinase from geobacillus stearothermophilus (with pt) 0.7095 153 336
6swk-assembly1.cif.gz_A-2 the kinase domain of gans, a histidine kinase from geobacillus stearothermophilus 0.7017 153 335
4bxi-assembly1.cif.gz_A-2 crystal structure of atp binding domain of agrc from staphylococcus aureus 0.6999 206 331
ID Description Score Start End Superfamily
af_P0AD14_423_557_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8283 201 331 3.30.565.10
af_P0AA93_414_560_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8019 203 331 3.30.565.10
af_P0AD14_423_557_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8009 201 331 3.30.565.10
af_Q2G1E0_342_515_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7945 178 336 3.30.565.10
af_Q53705_433_584_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7757 201 331 3.30.565.10
ID Description Score Start End GO Terms
AF-A0A520H3S3-F1-model_v4 Histidine kinase 0.9053 149 331 GO:0000155
GO:0016020
AF-A0A519N499-F1-model_v4 deleted 0.8986 181 331
AF-A0A519N499-F1-model_v4 deleted 0.882 181 331
AF-A0A5F0ARL4-F1-model_v4 deleted 0.8701 220 335
AF-A0A5P2G1J6-F1-model_v4 Signal transduction histidine kinase internal region domain-containing protein 0.866 181 331 GO:0000155
GO:0016020

Feature Viewer

pLDDT pTM Quality
75.18 0.52 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map