F281645
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 183 | 113 | 366 | 108 |
Family's Representative Sequence
| Representative Sequence | 3300060346|Ga0587111_0002564|Ga0587111_0002564_1044_1412 |
| Length | 122 |
| Sequence | MEVKKVAATKHKVQPDKIHVKKGDFVMVISGKDAGKKGKVIDVILKKGRVVVEKANIIKRHTKPSQSMPQGGIVQKEAPIASSNVMLYCQECNSVTRVSMKVTENGKLRVCKKCGASLPDKH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 3 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 4 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 5 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 8 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 9 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 11 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 12 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 13 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 14 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 15 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 16 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 17 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 18 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 19 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 20 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 21 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 22 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 23 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 24 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 25 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 26 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 28 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 29 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 30 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 31 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 32 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 33 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 34 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 35 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 36 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 37 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 38 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 39 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 40 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 41 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 42 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 43 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 44 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 45 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 46 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 47 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 48 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 49 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 50 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 51 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 52 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 53 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 54 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 55 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 56 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 57 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 58 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 59 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 60 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 61 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 62 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 63 | 3300049133 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 64 | 3300049134 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 65 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 66 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 67 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 68 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 69 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 70 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 71 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 72 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 73 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 74 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 75 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 76 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 77 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 78 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 79 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 80 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 81 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 82 | 3300049543 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 83 | 3300049544 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 84 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 85 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 86 | 3300049547 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 87 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 88 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 89 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 90 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 91 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 92 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 93 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 94 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 95 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 96 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 97 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 98 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 99 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 100 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 101 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 102 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 103 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 104 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 105 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 106 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 107 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 108 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 109 | 2554235469 | Sporolactobacillus laevolacticus DSM 442 | Isolate | Rhizosphere |
| 110 | 2775507177 | Bacillus sp. AFS055030 | Isolate | Unclassified |
| 111 | 2775507192 | Bacillus sp. AFS041924 | Isolate | Unclassified |
| 112 | 2929297113 | Heliophilum fasciatum MTM | Isolate | Rhizosphere |
| 113 | 8054280661 | Metabacillus kandeliae GX 13764 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 65.57 |
| Metatranscriptomes | 31.69 |
| Isolates | 2.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.92 |
| Nodule | 0 |
| Rhizoplane | 0.55 |
| Rhizosphere | 90.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0587111_0002564 | 3300060346 | Bacteria | 2447 |
| 2 | JGI25151J46595_10009794 | 3300003187 | Bacteria | 4511 |
| 3 | Ga0055532_1000266 | 3300003758 | Bacteria | 34080 |
| 4 | Ga0055536_1062075 | 3300003781 | Bacteria | 770 |
| 5 | Ga0070681_10386358 | 3300005458 | Bacteria | 1310 |
| 6 | Ga0070679_100280773 | 3300005530 | Bacteria | 1618 |
| 7 | Ga0068857_102557189 | 3300005577 | Bacteria | 501 |
| 8 | Ga0068856_101788235 | 3300005614 | Bacteria | 626 |
| 9 | Ga0070712_101420248 | 3300006175 | Bacteria | 606 |
| 10 | Ga0075428_100230466 | 3300006844 | Bacteria | 1999 |
| 11 | Ga0075431_101067156 | 3300006847 | Bacteria | 773 |
| 12 | Ga0075431_101232993 | 3300006847 | Bacteria | 710 |
| 13 | Ga0075431_101491092 | 3300006847 | Bacteria | 635 |
| 14 | Ga0075429_101502436 | 3300006880 | Bacteria | 586 |
| 15 | Ga0075435_101530664 | 3300007076 | Bacteria | 585 |
| 16 | Ga0099794_10000179 | 3300007265 | Bacteria | 23076 |
| 17 | Ga0206356_11638250 | 3300020070 | Bacteria | 510 |
| 18 | Ga0206350_10100086 | 3300020080 | Unclassified | 676 |
| 19 | Ga0206354_11081534 | 3300020081 | Bacteria | 562 |
| 20 | Ga0209147_100198 | 3300025229 | Bacteria | 67714 |
| 21 | Ga0209130_1008089 | 3300025284 | Bacteria | 3149 |
| 22 | Ga0209675_1009517 | 3300025291 | Bacteria | 3425 |
| 23 | Ga0209676_1000745 | 3300025292 | Bacteria | 44098 |
| 24 | Ga0209025_1022151 | 3300025294 | Bacteria | 3384 |
| 25 | Ga0209025_1039046 | 3300025294 | Bacteria | 2077 |
| 26 | Ga0207707_10758088 | 3300025912 | Bacteria | 811 |
| 27 | Ga0207667_11255429 | 3300025949 | Bacteria | 719 |
| 28 | Ga0207702_11679681 | 3300026078 | Bacteria | 628 |
| 29 | Ga0207674_11132183 | 3300026116 | Bacteria | 752 |
| 30 | Ga0209588_1020292 | 3300027671 | Bacteria | 2081 |
| 31 | Ga0265337_1018765 | 3300028556 | Bacteria | 2191 |
| 32 | Ga0265334_10001472 | 3300028573 | Bacteria | 11345 |
| 33 | Ga0265322_10000054 | 3300028654 | Bacteria | 58196 |
| 34 | Ga0265338_10020486 | 3300028800 | Bacteria | 6953 |
| 35 | Ga0265338_10438887 | 3300028800 | Bacteria | 926 |
| 36 | Ga0265332_10051288 | 3300031238 | Unclassified | 1772 |
| 37 | Ga0265332_10304637 | 3300031238 | Bacteria | 658 |
| 38 | Ga0265316_10155785 | 3300031344 | Bacteria | 1710 |
| 39 | Ga0316575_10227685 | 3300031665 | Bacteria | 779 |
| 40 | Ga0265342_10528653 | 3300031712 | Unclassified | 600 |
| 41 | Ga0316576_10197734 | 3300031727 | Bacteria | 1515 |
| 42 | Ga0316578_10115170 | 3300031728 | Bacteria | 1615 |
| 43 | Ga0316577_10232515 | 3300031733 | Bacteria | 1042 |
| 44 | Ga0316580_10093910 | 3300032139 | Bacteria | 918 |
| 45 | Ga0316593_10005797 | 3300032168 | Bacteria | 3291 |
| 46 | Ga0316593_10009809 | 3300032168 | Bacteria | 2720 |
| 47 | Ga0316593_10057328 | 3300032168 | Bacteria | 1326 |
| 48 | Ga0316593_10078772 | 3300032168 | Bacteria | 1148 |
| 49 | Ga0316593_10125862 | 3300032168 | Bacteria | 922 |
| 50 | Ga0316592_1015599 | 3300033524 | Bacteria | 1583 |
| 51 | Ga0316596_1020271 | 3300033541 | Bacteria | 1690 |
| 52 | Ga0316596_1037755 | 3300033541 | Unclassified | 1264 |
| 53 | Ga0316574_0027172 | 3300035398 | Bacteria | 3446 |
| 54 | Ga0316574_0454218 | 3300035398 | Bacteria | 802 |
| 55 | Ga0316574_0497529 | 3300035398 | Bacteria | 760 |
| 56 | Ga0373931_0290737 | 3300035691 | Bacteria | 1006 |
| 57 | Ga0395900_0415429 | 3300037418 | Bacteria | 1307 |
| 58 | Ga0395898_0221709 | 3300037466 | Bacteria | 1804 |
| 59 | Ga0436364_1024637 | 3300037853 | Bacteria | 612 |
| 60 | Ga0436364_1386838 | 3300037853 | Bacteria | 889 |
| 61 | Ga0400489_41312 | 3300039093 | Bacteria | 1170 |
| 62 | Ga0436365_1818463 | 3300039437 | Unclassified | 541 |
| 63 | Ga0436360_0254495 | 3300039438 | Bacteria | 582 |
| 64 | Ga0436363_0843502 | 3300039450 | Unclassified | 575 |
| 65 | Ga0436363_1592189 | 3300039450 | Unclassified | 634 |
| 66 | Ga0439460_0046209 | 3300042461 | Bacteria | 1293 |
| 67 | Ga0451577_0000018 | 3300042876 | Bacteria | 516495 |
| 68 | Ga0451577_0000092 | 3300042876 | Bacteria | 198898 |
| 69 | Ga0451577_0000155 | 3300042876 | Bacteria | 152745 |
| 70 | Ga0451577_0000255 | 3300042876 | Bacteria | 105353 |
| 71 | Ga0451577_0000461 | 3300042876 | Bacteria | 70795 |
| 72 | Ga0451577_0005144 | 3300042876 | Bacteria | 13458 |
| 73 | Ga0451577_0018419 | 3300042876 | Bacteria | 6433 |
| 74 | Ga0451577_0090080 | 3300042876 | Bacteria | 2737 |
| 75 | Ga0451577_0175874 | 3300042876 | Bacteria | 1929 |
| 76 | Ga0451577_0368574 | 3300042876 | Bacteria | 1303 |
| 77 | Ga0451577_0433601 | 3300042876 | Bacteria | 1193 |
| 78 | Ga0451577_0827693 | 3300042876 | Bacteria | 835 |
| 79 | Ga0453683_0000935 | 3300044673 | Bacteria | 27791 |
| 80 | Ga0453683_0007526 | 3300044673 | Bacteria | 7375 |
| 81 | Ga0453683_0014786 | 3300044673 | Bacteria | 5065 |
| 82 | Ga0453683_0046011 | 3300044673 | Bacteria | 2736 |
| 83 | Ga0453683_0046241 | 3300044673 | Bacteria | 2729 |
| 84 | Ga0453683_0056210 | 3300044673 | Bacteria | 2462 |
| 85 | Ga0453683_0251269 | 3300044673 | Bacteria | 1127 |
| 86 | Ga0453683_0279301 | 3300044673 | Bacteria | 1066 |
| 87 | Ga0453684_0000024 | 3300044712 | Bacteria | 819351 |
| 88 | Ga0453684_0000166 | 3300044712 | Bacteria | 294291 |
| 89 | Ga0453684_0000516 | 3300044712 | Bacteria | 147788 |
| 90 | Ga0453684_0001382 | 3300044712 | Bacteria | 70292 |
| 91 | Ga0453684_0001549 | 3300044712 | Bacteria | 64220 |
| 92 | Ga0453684_0001648 | 3300044712 | Bacteria | 60626 |
| 93 | Ga0453684_0008030 | 3300044712 | Bacteria | 19098 |
| 94 | Ga0453684_0012068 | 3300044712 | Bacteria | 14349 |
| 95 | Ga0453684_0016252 | 3300044712 | Bacteria | 11656 |
| 96 | Ga0453684_0017321 | 3300044712 | Bacteria | 11171 |
| 97 | Ga0453684_0032953 | 3300044712 | Bacteria | 7234 |
| 98 | Ga0453684_0060757 | 3300044712 | Bacteria | 4857 |
| 99 | Ga0453684_0133883 | 3300044712 | Bacteria | 2970 |
| 100 | Ga0453684_0348295 | 3300044712 | Bacteria | 1671 |
| 101 | Ga0453684_0411955 | 3300044712 | Bacteria | 1511 |
| 102 | Ga0453684_0490513 | 3300044712 | Bacteria | 1362 |
| 103 | Ga0453684_0949818 | 3300044712 | Bacteria | 917 |
| 104 | Ga0453684_1243870 | 3300044712 | Bacteria | 779 |
| 105 | Ga0451576_0000113 | 3300045051 | Bacteria | 208644 |
| 106 | Ga0451576_0001406 | 3300045051 | Bacteria | 41324 |
| 107 | Ga0451576_0005920 | 3300045051 | Bacteria | 15147 |
| 108 | Ga0451576_0032358 | 3300045051 | Bacteria | 5570 |
| 109 | Ga0451576_0040924 | 3300045051 | Bacteria | 4900 |
| 110 | Ga0451576_0054946 | 3300045051 | Bacteria | 4167 |
| 111 | Ga0451576_0097653 | 3300045051 | Bacteria | 3055 |
| 112 | Ga0451576_0195911 | 3300045051 | Bacteria | 2110 |
| 113 | Ga0451576_0294905 | 3300045051 | Bacteria | 1695 |
| 114 | Ga0451576_0649393 | 3300045051 | Bacteria | 1108 |
| 115 | Ga0496102_0011196 | 3300048905 | Bacteria | 7725 |
| 116 | Ga0501306_000937 | 3300049127 | Bacteria | 2526 |
| 117 | Ga0501308_078440 | 3300049128 | Bacteria | 523 |
| 118 | Ga0501310_001343 | 3300049130 | Bacteria | 2218 |
| 119 | Ga0501341_03064 | 3300049131 | Bacteria | 931 |
| 120 | Ga0501343_000251 | 3300049132 | Bacteria | 2881 |
| 121 | Ga0501344_02464 | 3300049133 | Bacteria | 954 |
| 122 | Ga0501345_02414 | 3300049134 | Bacteria | 771 |
| 123 | Ga0501305_008511 | 3300049161 | Bacteria | 1329 |
| 124 | Ga0501307_004147 | 3300049162 | Bacteria | 1463 |
| 125 | Ga0501311_000717 | 3300049527 | Bacteria | 2511 |
| 126 | Ga0501312_000743 | 3300049528 | Bacteria | 2828 |
| 127 | Ga0501313_002913 | 3300049529 | Bacteria | 1657 |
| 128 | Ga0501314_011067 | 3300049530 | Bacteria | 848 |
| 129 | Ga0501315_002098 | 3300049531 | Bacteria | 1829 |
| 130 | Ga0501315_034815 | 3300049531 | Bacteria | 741 |
| 131 | Ga0501316_000883 | 3300049532 | Bacteria | 2329 |
| 132 | Ga0501316_015717 | 3300049532 | Bacteria | 914 |
| 133 | Ga0501317_000843 | 3300049533 | Bacteria | 2398 |
| 134 | Ga0501319_007214 | 3300049535 | Bacteria | 837 |
| 135 | Ga0501320_000386 | 3300049536 | Bacteria | 2493 |
| 136 | Ga0501321_000506 | 3300049537 | Bacteria | 2527 |
| 137 | Ga0501322_021514 | 3300049538 | Bacteria | 569 |
| 138 | Ga0501323_000243 | 3300049539 | Bacteria | 3646 |
| 139 | Ga0501324_000369 | 3300049540 | Bacteria | 2353 |
| 140 | Ga0501325_013974 | 3300049541 | Bacteria | 775 |
| 141 | Ga0501326_02967 | 3300049542 | Bacteria | 855 |
| 142 | Ga0501327_00097 | 3300049543 | Bacteria | 2660 |
| 143 | Ga0501328_06450 | 3300049544 | Bacteria | 609 |
| 144 | Ga0501329_02211 | 3300049545 | Bacteria | 919 |
| 145 | Ga0501330_001401 | 3300049546 | Bacteria | 1243 |
| 146 | Ga0501331_01144 | 3300049547 | Bacteria | 1247 |
| 147 | Ga0501332_01204 | 3300049548 | Bacteria | 1322 |
| 148 | Ga0501333_000252 | 3300049549 | Bacteria | 2265 |
| 149 | Ga0501333_008160 | 3300049549 | Bacteria | 719 |
| 150 | Ga0501334_08534 | 3300049550 | Bacteria | 719 |
| 151 | Ga0501334_15487 | 3300049550 | Bacteria | 583 |
| 152 | Ga0501335_002008 | 3300049551 | Bacteria | 1619 |
| 153 | Ga0501335_002209 | 3300049551 | Bacteria | 1564 |
| 154 | Ga0501335_019592 | 3300049551 | Bacteria | 715 |
| 155 | Ga0501336_008233 | 3300049552 | Bacteria | 804 |
| 156 | Ga0501337_004175 | 3300049553 | Bacteria | 936 |
| 157 | Ga0501338_00284 | 3300049554 | Bacteria | 2162 |
| 158 | Ga0501340_000816 | 3300049556 | Bacteria | 1521 |
| 159 | Ga0501039_0542353 | 3300049575 | Bacteria | 913 |
| 160 | Ga0501040_1301693 | 3300049576 | Bacteria | 527 |
| 161 | Ga0501068_0937581 | 3300049584 | Bacteria | 570 |
| 162 | Ga0501073_0203689 | 3300049589 | Bacteria | 1368 |
| 163 | Ga0501073_1058502 | 3300049589 | Bacteria | 558 |
| 164 | Ga0501075_0320498 | 3300049591 | Bacteria | 1181 |
| 165 | Ga0501075_0348609 | 3300049591 | Bacteria | 1128 |
| 166 | Ga0501075_0754313 | 3300049591 | Bacteria | 741 |
| 167 | Ga0501076_0203564 | 3300049592 | Bacteria | 1617 |
| 168 | Ga0501076_1309203 | 3300049592 | Bacteria | 596 |
| 169 | Ga0501079_0291734 | 3300049741 | Bacteria | 1276 |
| 170 | Ga0501080_1607513 | 3300049742 | Bacteria | 550 |
| 171 | nmdc:mga06r32_797268_c1 | 3300050510 | Bacteria | 905 |
| 172 | Ga0501084_0233722 | 3300054114 | Bacteria | 1552 |
| 173 | Ga0501084_1444963 | 3300054114 | Bacteria | 576 |
| 174 | Ga0587084_037618 | 3300059477 | Bacteria | 808 |
| 175 | Ga0587073_0311729 | 3300059492 | Bacteria | 516 |
| 176 | Ga0587117_008824 | 3300059627 | Bacteria | 1192 |
| 177 | Ga0501082_0358687 | 3300060353 | Bacteria | 1271 |
| 178 | Ga0501082_0688487 | 3300060353 | Bacteria | 895 |
| 179 | 2556065787 | 2554235469 | Bacteria | 3590176 |
| 180 | 2777764202 | 2775507177 | Bacteria | 4384303 |
| 181 | 2777837277 | 2775507192 | Bacteria | 4622234 |
| 182 | 2929298364 | 2929297113 | Bacteria | 3141306 |
| 183 | 8054282872 | 8054280661 | Bacteria | 4232245 |
| 184 | Ga0587111_0002564 | |||
| 185 | JGI25151J46595_10009794 | |||
| 186 | Ga0055532_1000266 | |||
| 187 | Ga0055536_1062075 | |||
| 188 | Ga0070681_10386358 | |||
| 189 | Ga0070679_100280773 | |||
| 190 | Ga0068857_102557189 | |||
| 191 | Ga0068856_101788235 | |||
| 192 | Ga0070712_101420248 | |||
| 193 | Ga0075428_100230466 | |||
| 194 | Ga0075431_101067156 | |||
| 195 | Ga0075431_101232993 | |||
| 196 | Ga0075431_101491092 | |||
| 197 | Ga0075429_101502436 | |||
| 198 | Ga0075435_101530664 | |||
| 199 | Ga0099794_10000179 | |||
| 200 | Ga0206356_11638250 | |||
| 201 | Ga0206350_10100086 | |||
| 202 | Ga0206354_11081534 | |||
| 203 | Ga0209147_100198 | |||
| 204 | Ga0209130_1008089 | |||
| 205 | Ga0209675_1009517 | |||
| 206 | Ga0209676_1000745 | |||
| 207 | Ga0209025_1022151 | |||
| 208 | Ga0209025_1039046 | |||
| 209 | Ga0207707_10758088 | |||
| 210 | Ga0207667_11255429 | |||
| 211 | Ga0207702_11679681 | |||
| 212 | Ga0207674_11132183 | |||
| 213 | Ga0209588_1020292 | |||
| 214 | Ga0265337_1018765 | |||
| 215 | Ga0265334_10001472 | |||
| 216 | Ga0265322_10000054 | |||
| 217 | Ga0265338_10020486 | |||
| 218 | Ga0265338_10438887 | |||
| 219 | Ga0265332_10051288 | |||
| 220 | Ga0265332_10304637 | |||
| 221 | Ga0265316_10155785 | |||
| 222 | Ga0316575_10227685 | |||
| 223 | Ga0265342_10528653 | |||
| 224 | Ga0316576_10197734 | |||
| 225 | Ga0316578_10115170 | |||
| 226 | Ga0316577_10232515 | |||
| 227 | Ga0316580_10093910 | |||
| 228 | Ga0316593_10005797 | |||
| 229 | Ga0316593_10009809 | |||
| 230 | Ga0316593_10057328 | |||
| 231 | Ga0316593_10078772 | |||
| 232 | Ga0316593_10125862 | |||
| 233 | Ga0316592_1015599 | |||
| 234 | Ga0316596_1020271 | |||
| 235 | Ga0316596_1037755 | |||
| 236 | Ga0316574_0027172 | |||
| 237 | Ga0316574_0454218 | |||
| 238 | Ga0316574_0497529 | |||
| 239 | Ga0373931_0290737 | |||
| 240 | Ga0395900_0415429 | |||
| 241 | Ga0395898_0221709 | |||
| 242 | Ga0436364_1024637 | |||
| 243 | Ga0436364_1386838 | |||
| 244 | Ga0400489_41312 | |||
| 245 | Ga0436365_1818463 | |||
| 246 | Ga0436360_0254495 | |||
| 247 | Ga0436363_0843502 | |||
| 248 | Ga0436363_1592189 | |||
| 249 | Ga0439460_0046209 | |||
| 250 | Ga0451577_0000018 | |||
| 251 | Ga0451577_0000092 | |||
| 252 | Ga0451577_0000155 | |||
| 253 | Ga0451577_0000255 | |||
| 254 | Ga0451577_0000461 | |||
| 255 | Ga0451577_0005144 | |||
| 256 | Ga0451577_0018419 | |||
| 257 | Ga0451577_0090080 | |||
| 258 | Ga0451577_0175874 | |||
| 259 | Ga0451577_0368574 | |||
| 260 | Ga0451577_0433601 | |||
| 261 | Ga0451577_0827693 | |||
| 262 | Ga0453683_0000935 | |||
| 263 | Ga0453683_0007526 | |||
| 264 | Ga0453683_0014786 | |||
| 265 | Ga0453683_0046011 | |||
| 266 | Ga0453683_0046241 | |||
| 267 | Ga0453683_0056210 | |||
| 268 | Ga0453683_0251269 | |||
| 269 | Ga0453683_0279301 | |||
| 270 | Ga0453684_0000024 | |||
| 271 | Ga0453684_0000166 | |||
| 272 | Ga0453684_0000516 | |||
| 273 | Ga0453684_0001382 | |||
| 274 | Ga0453684_0001549 | |||
| 275 | Ga0453684_0001648 | |||
| 276 | Ga0453684_0008030 | |||
| 277 | Ga0453684_0012068 | |||
| 278 | Ga0453684_0016252 | |||
| 279 | Ga0453684_0017321 | |||
| 280 | Ga0453684_0032953 | |||
| 281 | Ga0453684_0060757 | |||
| 282 | Ga0453684_0133883 | |||
| 283 | Ga0453684_0348295 | |||
| 284 | Ga0453684_0411955 | |||
| 285 | Ga0453684_0490513 | |||
| 286 | Ga0453684_0949818 | |||
| 287 | Ga0453684_1243870 | |||
| 288 | Ga0451576_0000113 | |||
| 289 | Ga0451576_0001406 | |||
| 290 | Ga0451576_0005920 | |||
| 291 | Ga0451576_0032358 | |||
| 292 | Ga0451576_0040924 | |||
| 293 | Ga0451576_0054946 | |||
| 294 | Ga0451576_0097653 | |||
| 295 | Ga0451576_0195911 | |||
| 296 | Ga0451576_0294905 | |||
| 297 | Ga0451576_0649393 | |||
| 298 | Ga0496102_0011196 | |||
| 299 | Ga0501306_000937 | |||
| 300 | Ga0501308_078440 | |||
| 301 | Ga0501310_001343 | |||
| 302 | Ga0501341_03064 | |||
| 303 | Ga0501343_000251 | |||
| 304 | Ga0501344_02464 | |||
| 305 | Ga0501345_02414 | |||
| 306 | Ga0501305_008511 | |||
| 307 | Ga0501307_004147 | |||
| 308 | Ga0501311_000717 | |||
| 309 | Ga0501312_000743 | |||
| 310 | Ga0501313_002913 | |||
| 311 | Ga0501314_011067 | |||
| 312 | Ga0501315_002098 | |||
| 313 | Ga0501315_034815 | |||
| 314 | Ga0501316_000883 | |||
| 315 | Ga0501316_015717 | |||
| 316 | Ga0501317_000843 | |||
| 317 | Ga0501319_007214 | |||
| 318 | Ga0501320_000386 | |||
| 319 | Ga0501321_000506 | |||
| 320 | Ga0501322_021514 | |||
| 321 | Ga0501323_000243 | |||
| 322 | Ga0501324_000369 | |||
| 323 | Ga0501325_013974 | |||
| 324 | Ga0501326_02967 | |||
| 325 | Ga0501327_00097 | |||
| 326 | Ga0501328_06450 | |||
| 327 | Ga0501329_02211 | |||
| 328 | Ga0501330_001401 | |||
| 329 | Ga0501331_01144 | |||
| 330 | Ga0501332_01204 | |||
| 331 | Ga0501333_000252 | |||
| 332 | Ga0501333_008160 | |||
| 333 | Ga0501334_08534 | |||
| 334 | Ga0501334_15487 | |||
| 335 | Ga0501335_002008 | |||
| 336 | Ga0501335_002209 | |||
| 337 | Ga0501335_019592 | |||
| 338 | Ga0501336_008233 | |||
| 339 | Ga0501337_004175 | |||
| 340 | Ga0501338_00284 | |||
| 341 | Ga0501340_000816 | |||
| 342 | Ga0501039_0542353 | |||
| 343 | Ga0501040_1301693 | |||
| 344 | Ga0501068_0937581 | |||
| 345 | Ga0501073_0203689 | |||
| 346 | Ga0501073_1058502 | |||
| 347 | Ga0501075_0320498 | |||
| 348 | Ga0501075_0348609 | |||
| 349 | Ga0501075_0754313 | |||
| 350 | Ga0501076_0203564 | |||
| 351 | Ga0501076_1309203 | |||
| 352 | Ga0501079_0291734 | |||
| 353 | Ga0501080_1607513 | |||
| 354 | nmdc:mga06r32_797268_c1 | |||
| 355 | Ga0501084_0233722 | |||
| 356 | Ga0501084_1444963 | |||
| 357 | Ga0587084_037618 | |||
| 358 | Ga0587073_0311729 | |||
| 359 | Ga0587117_008824 | |||
| 360 | Ga0501082_0358687 | |||
| 361 | Ga0501082_0688487 | |||
| 362 | 2556065787 | |||
| 363 | 2777764202 | |||
| 364 | 2777837277 | |||
| 365 | 2929298364 | |||
| 366 | 8054282872 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6wru-assembly1.cif.gz_G | structure of the 50s subunit of the ribosome from methicillin resistant staphylococcus aureus in complex with an isomer of the tedizolid | 0.9502 | 2 | 100 |
| 6gsk-assembly2.cif.gz_C5 | structure of t. thermophilus 70s ribosome complex with mrna, trnafmet and near-cognate trnathr in the a-site | 0.9481 | 1 | 71 |
| 7zq6-assembly1.cif.gz_u | 70s e. coli ribosome with truncated ul23 and ul24 loops and a stalled filamin domain 5 nascent chain | 0.9347 | 2 | 100 |
| 6ddg-assembly1.cif.gz_G | structure of the 50s ribosomal subunit from methicillin resistant staphylococcus aureus in complex with the oxazolidinone antibiotic lzd-6 | 0.9307 | 2 | 99 |
| 6wru-assembly1.cif.gz_G | structure of the 50s subunit of the ribosome from methicillin resistant staphylococcus aureus in complex with an isomer of the tedizolid | 0.93 | 2 | 100 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FW17_1_100_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.936 | 1 | 99 | 2.30.30.30 |
| af_Q653V9_69_173_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9315 | 1 | 99 | 2.30.30.30 |
| af_Q2FW17_1_100_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9182 | 1 | 99 | 2.30.30.30 |
| af_Q55DJ4_14_116_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9176 | 3 | 99 | 2.30.30.30 |
| af_Q8I5H8_47_152_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9034 | 3 | 98 | 2.30.30.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-B9L6M2-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9597 | 1 | 72 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A2H0VBG5-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9544 | 1 | 100 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-Q11QC3-F1-model_v4 | Large ribosomal subunit protein uL24 (50S ribosomal protein L24) | 0.9536 | 1 | 102 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A6DEY5-F1-model_v4 | deleted | 0.9517 | 1 | 72 |
|
| AF-A0A812J439-F1-model_v4 | Large ribosomal subunit protein uL24c | 0.9515 | 1 | 102 |
GO:0003723
GO:0003735 GO:0005840 GO:0006412 GO:1990904 |