F281645

General Info

Members Datasets Scaffolds Average Seq Length
183 113 366 108

Family's Representative Sequence

Representative Sequence 3300060346|Ga0587111_0002564|Ga0587111_0002564_1044_1412
Length 122
Sequence MEVKKVAATKHKVQPDKIHVKKGDFVMVISGKDAGKKGKVIDVILKKGRVVVEKANIIKRHTKPSQSMPQGGIVQKEAPIASSNVMLYCQECNSVTRVSMKVTENGKLRVCKKCGASLPDKH

Samples

Sample ID Description Type Environment
1 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
6 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
7 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
8 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
9 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
10 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
11 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
12 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
13 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
14 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
15 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
16 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
17 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
18 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
19 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
20 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
21 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
22 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
23 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
29 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
30 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
31 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
32 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
33 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
34 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
35 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
36 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
37 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
38 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
39 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
40 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
41 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
42 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
43 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
44 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
45 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
46 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
47 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
48 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
49 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
50 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
51 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
52 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
53 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
54 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
55 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
56 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
57 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
58 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
59 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
60 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
98 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
99 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
100 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
101 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
102 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
103 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
104 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
105 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
109 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
110 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
111 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
112 2929297113 Heliophilum fasciatum MTM Isolate Rhizosphere
113 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 65.57
Metatranscriptomes 31.69
Isolates 2.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.92
Nodule 0
Rhizoplane 0.55
Rhizosphere 90.16
Stem 0
Stem Tuber 0
Unclassified 3.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0587111_0002564 3300060346 Bacteria 2447
2 JGI25151J46595_10009794 3300003187 Bacteria 4511
3 Ga0055532_1000266 3300003758 Bacteria 34080
4 Ga0055536_1062075 3300003781 Bacteria 770
5 Ga0070681_10386358 3300005458 Bacteria 1310
6 Ga0070679_100280773 3300005530 Bacteria 1618
7 Ga0068857_102557189 3300005577 Bacteria 501
8 Ga0068856_101788235 3300005614 Bacteria 626
9 Ga0070712_101420248 3300006175 Bacteria 606
10 Ga0075428_100230466 3300006844 Bacteria 1999
11 Ga0075431_101067156 3300006847 Bacteria 773
12 Ga0075431_101232993 3300006847 Bacteria 710
13 Ga0075431_101491092 3300006847 Bacteria 635
14 Ga0075429_101502436 3300006880 Bacteria 586
15 Ga0075435_101530664 3300007076 Bacteria 585
16 Ga0099794_10000179 3300007265 Bacteria 23076
17 Ga0206356_11638250 3300020070 Bacteria 510
18 Ga0206350_10100086 3300020080 Unclassified 676
19 Ga0206354_11081534 3300020081 Bacteria 562
20 Ga0209147_100198 3300025229 Bacteria 67714
21 Ga0209130_1008089 3300025284 Bacteria 3149
22 Ga0209675_1009517 3300025291 Bacteria 3425
23 Ga0209676_1000745 3300025292 Bacteria 44098
24 Ga0209025_1022151 3300025294 Bacteria 3384
25 Ga0209025_1039046 3300025294 Bacteria 2077
26 Ga0207707_10758088 3300025912 Bacteria 811
27 Ga0207667_11255429 3300025949 Bacteria 719
28 Ga0207702_11679681 3300026078 Bacteria 628
29 Ga0207674_11132183 3300026116 Bacteria 752
30 Ga0209588_1020292 3300027671 Bacteria 2081
31 Ga0265337_1018765 3300028556 Bacteria 2191
32 Ga0265334_10001472 3300028573 Bacteria 11345
33 Ga0265322_10000054 3300028654 Bacteria 58196
34 Ga0265338_10020486 3300028800 Bacteria 6953
35 Ga0265338_10438887 3300028800 Bacteria 926
36 Ga0265332_10051288 3300031238 Unclassified 1772
37 Ga0265332_10304637 3300031238 Bacteria 658
38 Ga0265316_10155785 3300031344 Bacteria 1710
39 Ga0316575_10227685 3300031665 Bacteria 779
40 Ga0265342_10528653 3300031712 Unclassified 600
41 Ga0316576_10197734 3300031727 Bacteria 1515
42 Ga0316578_10115170 3300031728 Bacteria 1615
43 Ga0316577_10232515 3300031733 Bacteria 1042
44 Ga0316580_10093910 3300032139 Bacteria 918
45 Ga0316593_10005797 3300032168 Bacteria 3291
46 Ga0316593_10009809 3300032168 Bacteria 2720
47 Ga0316593_10057328 3300032168 Bacteria 1326
48 Ga0316593_10078772 3300032168 Bacteria 1148
49 Ga0316593_10125862 3300032168 Bacteria 922
50 Ga0316592_1015599 3300033524 Bacteria 1583
51 Ga0316596_1020271 3300033541 Bacteria 1690
52 Ga0316596_1037755 3300033541 Unclassified 1264
53 Ga0316574_0027172 3300035398 Bacteria 3446
54 Ga0316574_0454218 3300035398 Bacteria 802
55 Ga0316574_0497529 3300035398 Bacteria 760
56 Ga0373931_0290737 3300035691 Bacteria 1006
57 Ga0395900_0415429 3300037418 Bacteria 1307
58 Ga0395898_0221709 3300037466 Bacteria 1804
59 Ga0436364_1024637 3300037853 Bacteria 612
60 Ga0436364_1386838 3300037853 Bacteria 889
61 Ga0400489_41312 3300039093 Bacteria 1170
62 Ga0436365_1818463 3300039437 Unclassified 541
63 Ga0436360_0254495 3300039438 Bacteria 582
64 Ga0436363_0843502 3300039450 Unclassified 575
65 Ga0436363_1592189 3300039450 Unclassified 634
66 Ga0439460_0046209 3300042461 Bacteria 1293
67 Ga0451577_0000018 3300042876 Bacteria 516495
68 Ga0451577_0000092 3300042876 Bacteria 198898
69 Ga0451577_0000155 3300042876 Bacteria 152745
70 Ga0451577_0000255 3300042876 Bacteria 105353
71 Ga0451577_0000461 3300042876 Bacteria 70795
72 Ga0451577_0005144 3300042876 Bacteria 13458
73 Ga0451577_0018419 3300042876 Bacteria 6433
74 Ga0451577_0090080 3300042876 Bacteria 2737
75 Ga0451577_0175874 3300042876 Bacteria 1929
76 Ga0451577_0368574 3300042876 Bacteria 1303
77 Ga0451577_0433601 3300042876 Bacteria 1193
78 Ga0451577_0827693 3300042876 Bacteria 835
79 Ga0453683_0000935 3300044673 Bacteria 27791
80 Ga0453683_0007526 3300044673 Bacteria 7375
81 Ga0453683_0014786 3300044673 Bacteria 5065
82 Ga0453683_0046011 3300044673 Bacteria 2736
83 Ga0453683_0046241 3300044673 Bacteria 2729
84 Ga0453683_0056210 3300044673 Bacteria 2462
85 Ga0453683_0251269 3300044673 Bacteria 1127
86 Ga0453683_0279301 3300044673 Bacteria 1066
87 Ga0453684_0000024 3300044712 Bacteria 819351
88 Ga0453684_0000166 3300044712 Bacteria 294291
89 Ga0453684_0000516 3300044712 Bacteria 147788
90 Ga0453684_0001382 3300044712 Bacteria 70292
91 Ga0453684_0001549 3300044712 Bacteria 64220
92 Ga0453684_0001648 3300044712 Bacteria 60626
93 Ga0453684_0008030 3300044712 Bacteria 19098
94 Ga0453684_0012068 3300044712 Bacteria 14349
95 Ga0453684_0016252 3300044712 Bacteria 11656
96 Ga0453684_0017321 3300044712 Bacteria 11171
97 Ga0453684_0032953 3300044712 Bacteria 7234
98 Ga0453684_0060757 3300044712 Bacteria 4857
99 Ga0453684_0133883 3300044712 Bacteria 2970
100 Ga0453684_0348295 3300044712 Bacteria 1671
101 Ga0453684_0411955 3300044712 Bacteria 1511
102 Ga0453684_0490513 3300044712 Bacteria 1362
103 Ga0453684_0949818 3300044712 Bacteria 917
104 Ga0453684_1243870 3300044712 Bacteria 779
105 Ga0451576_0000113 3300045051 Bacteria 208644
106 Ga0451576_0001406 3300045051 Bacteria 41324
107 Ga0451576_0005920 3300045051 Bacteria 15147
108 Ga0451576_0032358 3300045051 Bacteria 5570
109 Ga0451576_0040924 3300045051 Bacteria 4900
110 Ga0451576_0054946 3300045051 Bacteria 4167
111 Ga0451576_0097653 3300045051 Bacteria 3055
112 Ga0451576_0195911 3300045051 Bacteria 2110
113 Ga0451576_0294905 3300045051 Bacteria 1695
114 Ga0451576_0649393 3300045051 Bacteria 1108
115 Ga0496102_0011196 3300048905 Bacteria 7725
116 Ga0501306_000937 3300049127 Bacteria 2526
117 Ga0501308_078440 3300049128 Bacteria 523
118 Ga0501310_001343 3300049130 Bacteria 2218
119 Ga0501341_03064 3300049131 Bacteria 931
120 Ga0501343_000251 3300049132 Bacteria 2881
121 Ga0501344_02464 3300049133 Bacteria 954
122 Ga0501345_02414 3300049134 Bacteria 771
123 Ga0501305_008511 3300049161 Bacteria 1329
124 Ga0501307_004147 3300049162 Bacteria 1463
125 Ga0501311_000717 3300049527 Bacteria 2511
126 Ga0501312_000743 3300049528 Bacteria 2828
127 Ga0501313_002913 3300049529 Bacteria 1657
128 Ga0501314_011067 3300049530 Bacteria 848
129 Ga0501315_002098 3300049531 Bacteria 1829
130 Ga0501315_034815 3300049531 Bacteria 741
131 Ga0501316_000883 3300049532 Bacteria 2329
132 Ga0501316_015717 3300049532 Bacteria 914
133 Ga0501317_000843 3300049533 Bacteria 2398
134 Ga0501319_007214 3300049535 Bacteria 837
135 Ga0501320_000386 3300049536 Bacteria 2493
136 Ga0501321_000506 3300049537 Bacteria 2527
137 Ga0501322_021514 3300049538 Bacteria 569
138 Ga0501323_000243 3300049539 Bacteria 3646
139 Ga0501324_000369 3300049540 Bacteria 2353
140 Ga0501325_013974 3300049541 Bacteria 775
141 Ga0501326_02967 3300049542 Bacteria 855
142 Ga0501327_00097 3300049543 Bacteria 2660
143 Ga0501328_06450 3300049544 Bacteria 609
144 Ga0501329_02211 3300049545 Bacteria 919
145 Ga0501330_001401 3300049546 Bacteria 1243
146 Ga0501331_01144 3300049547 Bacteria 1247
147 Ga0501332_01204 3300049548 Bacteria 1322
148 Ga0501333_000252 3300049549 Bacteria 2265
149 Ga0501333_008160 3300049549 Bacteria 719
150 Ga0501334_08534 3300049550 Bacteria 719
151 Ga0501334_15487 3300049550 Bacteria 583
152 Ga0501335_002008 3300049551 Bacteria 1619
153 Ga0501335_002209 3300049551 Bacteria 1564
154 Ga0501335_019592 3300049551 Bacteria 715
155 Ga0501336_008233 3300049552 Bacteria 804
156 Ga0501337_004175 3300049553 Bacteria 936
157 Ga0501338_00284 3300049554 Bacteria 2162
158 Ga0501340_000816 3300049556 Bacteria 1521
159 Ga0501039_0542353 3300049575 Bacteria 913
160 Ga0501040_1301693 3300049576 Bacteria 527
161 Ga0501068_0937581 3300049584 Bacteria 570
162 Ga0501073_0203689 3300049589 Bacteria 1368
163 Ga0501073_1058502 3300049589 Bacteria 558
164 Ga0501075_0320498 3300049591 Bacteria 1181
165 Ga0501075_0348609 3300049591 Bacteria 1128
166 Ga0501075_0754313 3300049591 Bacteria 741
167 Ga0501076_0203564 3300049592 Bacteria 1617
168 Ga0501076_1309203 3300049592 Bacteria 596
169 Ga0501079_0291734 3300049741 Bacteria 1276
170 Ga0501080_1607513 3300049742 Bacteria 550
171 nmdc:mga06r32_797268_c1 3300050510 Bacteria 905
172 Ga0501084_0233722 3300054114 Bacteria 1552
173 Ga0501084_1444963 3300054114 Bacteria 576
174 Ga0587084_037618 3300059477 Bacteria 808
175 Ga0587073_0311729 3300059492 Bacteria 516
176 Ga0587117_008824 3300059627 Bacteria 1192
177 Ga0501082_0358687 3300060353 Bacteria 1271
178 Ga0501082_0688487 3300060353 Bacteria 895
179 2556065787 2554235469 Bacteria 3590176
180 2777764202 2775507177 Bacteria 4384303
181 2777837277 2775507192 Bacteria 4622234
182 2929298364 2929297113 Bacteria 3141306
183 8054282872 8054280661 Bacteria 4232245
184 Ga0587111_0002564
185 JGI25151J46595_10009794
186 Ga0055532_1000266
187 Ga0055536_1062075
188 Ga0070681_10386358
189 Ga0070679_100280773
190 Ga0068857_102557189
191 Ga0068856_101788235
192 Ga0070712_101420248
193 Ga0075428_100230466
194 Ga0075431_101067156
195 Ga0075431_101232993
196 Ga0075431_101491092
197 Ga0075429_101502436
198 Ga0075435_101530664
199 Ga0099794_10000179
200 Ga0206356_11638250
201 Ga0206350_10100086
202 Ga0206354_11081534
203 Ga0209147_100198
204 Ga0209130_1008089
205 Ga0209675_1009517
206 Ga0209676_1000745
207 Ga0209025_1022151
208 Ga0209025_1039046
209 Ga0207707_10758088
210 Ga0207667_11255429
211 Ga0207702_11679681
212 Ga0207674_11132183
213 Ga0209588_1020292
214 Ga0265337_1018765
215 Ga0265334_10001472
216 Ga0265322_10000054
217 Ga0265338_10020486
218 Ga0265338_10438887
219 Ga0265332_10051288
220 Ga0265332_10304637
221 Ga0265316_10155785
222 Ga0316575_10227685
223 Ga0265342_10528653
224 Ga0316576_10197734
225 Ga0316578_10115170
226 Ga0316577_10232515
227 Ga0316580_10093910
228 Ga0316593_10005797
229 Ga0316593_10009809
230 Ga0316593_10057328
231 Ga0316593_10078772
232 Ga0316593_10125862
233 Ga0316592_1015599
234 Ga0316596_1020271
235 Ga0316596_1037755
236 Ga0316574_0027172
237 Ga0316574_0454218
238 Ga0316574_0497529
239 Ga0373931_0290737
240 Ga0395900_0415429
241 Ga0395898_0221709
242 Ga0436364_1024637
243 Ga0436364_1386838
244 Ga0400489_41312
245 Ga0436365_1818463
246 Ga0436360_0254495
247 Ga0436363_0843502
248 Ga0436363_1592189
249 Ga0439460_0046209
250 Ga0451577_0000018
251 Ga0451577_0000092
252 Ga0451577_0000155
253 Ga0451577_0000255
254 Ga0451577_0000461
255 Ga0451577_0005144
256 Ga0451577_0018419
257 Ga0451577_0090080
258 Ga0451577_0175874
259 Ga0451577_0368574
260 Ga0451577_0433601
261 Ga0451577_0827693
262 Ga0453683_0000935
263 Ga0453683_0007526
264 Ga0453683_0014786
265 Ga0453683_0046011
266 Ga0453683_0046241
267 Ga0453683_0056210
268 Ga0453683_0251269
269 Ga0453683_0279301
270 Ga0453684_0000024
271 Ga0453684_0000166
272 Ga0453684_0000516
273 Ga0453684_0001382
274 Ga0453684_0001549
275 Ga0453684_0001648
276 Ga0453684_0008030
277 Ga0453684_0012068
278 Ga0453684_0016252
279 Ga0453684_0017321
280 Ga0453684_0032953
281 Ga0453684_0060757
282 Ga0453684_0133883
283 Ga0453684_0348295
284 Ga0453684_0411955
285 Ga0453684_0490513
286 Ga0453684_0949818
287 Ga0453684_1243870
288 Ga0451576_0000113
289 Ga0451576_0001406
290 Ga0451576_0005920
291 Ga0451576_0032358
292 Ga0451576_0040924
293 Ga0451576_0054946
294 Ga0451576_0097653
295 Ga0451576_0195911
296 Ga0451576_0294905
297 Ga0451576_0649393
298 Ga0496102_0011196
299 Ga0501306_000937
300 Ga0501308_078440
301 Ga0501310_001343
302 Ga0501341_03064
303 Ga0501343_000251
304 Ga0501344_02464
305 Ga0501345_02414
306 Ga0501305_008511
307 Ga0501307_004147
308 Ga0501311_000717
309 Ga0501312_000743
310 Ga0501313_002913
311 Ga0501314_011067
312 Ga0501315_002098
313 Ga0501315_034815
314 Ga0501316_000883
315 Ga0501316_015717
316 Ga0501317_000843
317 Ga0501319_007214
318 Ga0501320_000386
319 Ga0501321_000506
320 Ga0501322_021514
321 Ga0501323_000243
322 Ga0501324_000369
323 Ga0501325_013974
324 Ga0501326_02967
325 Ga0501327_00097
326 Ga0501328_06450
327 Ga0501329_02211
328 Ga0501330_001401
329 Ga0501331_01144
330 Ga0501332_01204
331 Ga0501333_000252
332 Ga0501333_008160
333 Ga0501334_08534
334 Ga0501334_15487
335 Ga0501335_002008
336 Ga0501335_002209
337 Ga0501335_019592
338 Ga0501336_008233
339 Ga0501337_004175
340 Ga0501338_00284
341 Ga0501340_000816
342 Ga0501039_0542353
343 Ga0501040_1301693
344 Ga0501068_0937581
345 Ga0501073_0203689
346 Ga0501073_1058502
347 Ga0501075_0320498
348 Ga0501075_0348609
349 Ga0501075_0754313
350 Ga0501076_0203564
351 Ga0501076_1309203
352 Ga0501079_0291734
353 Ga0501080_1607513
354 nmdc:mga06r32_797268_c1
355 Ga0501084_0233722
356 Ga0501084_1444963
357 Ga0587084_037618
358 Ga0587073_0311729
359 Ga0587117_008824
360 Ga0501082_0358687
361 Ga0501082_0688487
362 2556065787
363 2777764202
364 2777837277
365 2929298364
366 8054282872

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00467

KOW

KOW motif

22

53

0.98

PF17136

ribosomal_L24

Ribosomal proteins 50S L24/mitochondrial 39S L24

55

118

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wru-assembly1.cif.gz_G structure of the 50s subunit of the ribosome from methicillin resistant staphylococcus aureus in complex with an isomer of the tedizolid 0.9502 2 100
6gsk-assembly2.cif.gz_C5 structure of t. thermophilus 70s ribosome complex with mrna, trnafmet and near-cognate trnathr in the a-site 0.9481 1 71
7zq6-assembly1.cif.gz_u 70s e. coli ribosome with truncated ul23 and ul24 loops and a stalled filamin domain 5 nascent chain 0.9347 2 100
6ddg-assembly1.cif.gz_G structure of the 50s ribosomal subunit from methicillin resistant staphylococcus aureus in complex with the oxazolidinone antibiotic lzd-6 0.9307 2 99
6wru-assembly1.cif.gz_G structure of the 50s subunit of the ribosome from methicillin resistant staphylococcus aureus in complex with an isomer of the tedizolid 0.93 2 100
ID Description Score Start End Superfamily
af_Q2FW17_1_100_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.936 1 99 2.30.30.30
af_Q653V9_69_173_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9315 1 99 2.30.30.30
af_Q2FW17_1_100_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9182 1 99 2.30.30.30
af_Q55DJ4_14_116_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9176 3 99 2.30.30.30
af_Q8I5H8_47_152_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9034 3 98 2.30.30.30
ID Description Score Start End GO Terms
AF-B9L6M2-F1-model_v4 Large ribosomal subunit protein uL24 0.9597 1 72 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2H0VBG5-F1-model_v4 Large ribosomal subunit protein uL24 0.9544 1 100 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-Q11QC3-F1-model_v4 Large ribosomal subunit protein uL24 (50S ribosomal protein L24) 0.9536 1 102 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A6DEY5-F1-model_v4 deleted 0.9517 1 72
AF-A0A812J439-F1-model_v4 Large ribosomal subunit protein uL24c 0.9515 1 102 GO:0003723
GO:0003735
GO:0005840
GO:0006412
GO:1990904

Map