F281558

General Info

Members Datasets Scaffolds Average Seq Length
183 108 366 293

Family's Representative Sequence

Representative Sequence 3300049822|Ga0501035_0014771|Ga0501035_0014771_2159_3247
Length 362
Sequence MNPDWKRFSEIPTESPVRAPGRMGSNRLSSRFVSGSICVYPWLNCLVPAESSQNAISSVPRFWLNQGCNMQDLINKAATLLEALPYIQKFSGATFIVKYGGSFMDSPDPNVRNSVARDIVFLEAVEINPVVVHGGGKAITRAMEKAGLKANFIQGQRVTDEATVKIVDDVLSREINPEVVKTINALGGQARGFAGPDIFTCRKLWLDDKETPGKKIDIGYVGEVIGINAAPLLECIANGITPVISPTARGEDGRIYNCNADVAAAMTAIGLKARRLVFMSDVPGLMRDPRDVATVIAHLQTGEVPALKAAGIVDKGMIPKVDSAVTAIKSGVEKVSFVDGRVPHAVMLEIFTDKGVGTEVVL

Samples

Sample ID Description Type Environment
1 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
29 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
30 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
46 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
47 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
48 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
49 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
50 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
51 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
52 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
53 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
54 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
55 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
56 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
57 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
58 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
59 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
60 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
61 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
62 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
63 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
64 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
65 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
66 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
67 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
68 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
69 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
70 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
71 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
72 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
73 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
74 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
75 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
76 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
77 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
78 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
79 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
83 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
84 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
85 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
86 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
87 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
88 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
89 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
90 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
91 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
92 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
93 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
94 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
95 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
96 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
97 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
98 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
99 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
100 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
108 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.55
Rhizosphere 98.91
Stem 0
Stem Tuber 0
Unclassified 12.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501035_0014771 3300049822 Bacteria 7211
2 rootH2_10174968 3300003320 Bacteria 1584
3 Ga0070683_100365907 3300005329 Bacteria 1373
4 Ga0070690_100127265 3300005330 Unclassified 1716
5 Ga0068869_100196872 3300005334 Bacteria 1587
6 Ga0070666_10138865 3300005335 Unclassified 1692
7 Ga0070674_100520954 3300005356 Bacteria 993
8 Ga0070674_100556412 3300005356 Bacteria 963
9 Ga0070688_100056235 3300005365 Bacteria 2470
10 Ga0070714_100011261 3300005435 Bacteria 7091
11 Ga0070708_100089550 3300005445 Bacteria 2800
12 Ga0070708_100107992 3300005445 Bacteria 2555
13 Ga0070685_10351903 3300005466 Bacteria 1007
14 Ga0070706_100000011 3300005467 Bacteria 198585
15 Ga0070707_100149242 3300005468 Bacteria 2276
16 Ga0070697_100114278 3300005536 Bacteria 2253
17 Ga0068853_100442704 3300005539 Bacteria 1221
18 Ga0068855_100065718 3300005563 Unclassified 4229
19 Ga0068855_100214641 3300005563 Bacteria 2160
20 Ga0068856_100002814 3300005614 Bacteria 17814
21 Ga0068856_100039802 3300005614 Bacteria 4615
22 Ga0068859_100434824 3300005617 Bacteria 1408
23 Ga0068864_100224818 3300005618 Bacteria 1733
24 Ga0068863_100268178 3300005841 Bacteria 1652
25 Ga0070717_10447276 3300006028 Unclassified 1164
26 Ga0097621_100088909 3300006237 Bacteria 2582
27 Ga0097620_100434805 3300006931 Bacteria 1408
28 Ga0105240_10004246 3300009093 Bacteria 21907
29 Ga0105240_10077109 3300009093 Bacteria 4107
30 Ga0105240_10091179 3300009093 Bacteria 3724
31 Ga0105241_10029763 3300009174 Bacteria 4076
32 Ga0105238_10016945 3300009551 Bacteria 7394
33 Ga0105238_10029174 3300009551 Bacteria 5621
34 Ga0105238_10171847 3300009551 Bacteria 2143
35 Ga0105238_10374107 3300009551 Bacteria 1415
36 Ga0157370_10141918 3300013104 Bacteria 2238
37 Ga0157374_10263965 3300013296 Bacteria 1696
38 Ga0157378_10107810 3300013297 Unclassified 2549
39 Ga0157378_10113827 3300013297 Bacteria 2484
40 Ga0157375_10000083 3300013308 Bacteria 94512
41 Ga0157375_10825915 3300013308 Bacteria 1075
42 Ga0163163_10000345 3300014325 Bacteria 44677
43 Ga0207680_10149177 3300025903 Unclassified 1558
44 Ga0207684_10000052 3300025910 Bacteria 228510
45 Ga0207654_10102918 3300025911 Bacteria 1762
46 Ga0207695_10086037 3300025913 Bacteria 3171
47 Ga0207695_10161576 3300025913 Bacteria 2171
48 Ga0207663_10023249 3300025916 Bacteria 3554
49 Ga0207652_10070081 3300025921 Bacteria 3045
50 Ga0207694_10016275 3300025924 Bacteria 5612
51 Ga0207694_10026512 3300025924 Bacteria 4409
52 Ga0207694_10078541 3300025924 Unclassified 2587
53 Ga0207694_10387021 3300025924 Bacteria 1161
54 Ga0207664_10014033 3300025929 Bacteria 5775
55 Ga0207661_10747098 3300025944 Bacteria 900
56 Ga0207667_10149882 3300025949 Unclassified 2401
57 Ga0207667_10509775 3300025949 Bacteria 1219
58 Ga0207702_10005380 3300026078 Bacteria 11215
59 Ga0207702_10009437 3300026078 Bacteria 8197
60 Ga0207702_10088970 3300026078 Bacteria 2699
61 Ga0207641_10101783 3300026088 Unclassified 2532
62 Ga0207674_10106584 3300026116 Bacteria 2780
63 Ga0265337_1000656 3300028556 Bacteria 18221
64 Ga0265337_1001387 3300028556 Bacteria 11893
65 Ga0265326_10013497 3300028558 Bacteria 2389
66 Ga0265319_1000004 3300028563 Bacteria 305085
67 Ga0265319_1015843 3300028563 Bacteria 2906
68 Ga0265319_1081938 3300028563 Bacteria 1024
69 Ga0265334_10015999 3300028573 Bacteria 3108
70 Ga0265334_10034992 3300028573 Bacteria 1990
71 Ga0265323_10002299 3300028653 Bacteria 8850
72 Ga0265323_10032411 3300028653 Bacteria 1938
73 Ga0265323_10046088 3300028653 Bacteria 1564
74 Ga0265323_10094470 3300028653 Bacteria 995
75 Ga0265336_10001514 3300028666 Bacteria 10491
76 Ga0265336_10026051 3300028666 Unclassified 1838
77 Ga0265336_10031535 3300028666 Bacteria 1646
78 Ga0265338_10000208 3300028800 Bacteria 109817
79 Ga0265338_10000670 3300028800 Bacteria 59227
80 Ga0265338_10000959 3300028800 Bacteria 48640
81 Ga0265338_10001912 3300028800 Bacteria 32527
82 Ga0265338_10002459 3300028800 Bacteria 27681
83 Ga0265338_10003105 3300028800 Bacteria 23776
84 Ga0265338_10005416 3300028800 Bacteria 16664
85 Ga0265338_10008884 3300028800 Bacteria 12104
86 Ga0265338_10013375 3300028800 Bacteria 9271
87 Ga0265338_10013438 3300028800 Bacteria 9249
88 Ga0265338_10032062 3300028800 Bacteria 5136
89 Ga0265338_10047462 3300028800 Bacteria 3921
90 Ga0265338_10057988 3300028800 Bacteria 3421
91 Ga0265338_10072906 3300028800 Bacteria 2929
92 Ga0265324_10009507 3300029957 Bacteria 3792
93 Ga0265332_10017832 3300031238 Bacteria 3131
94 Ga0265320_10000197 3300031240 Bacteria 49509
95 Ga0265320_10007382 3300031240 Bacteria 6827
96 Ga0265320_10011803 3300031240 Bacteria 5121
97 Ga0265325_10015605 3300031241 Bacteria 4267
98 Ga0265329_10004298 3300031242 Bacteria 5963
99 Ga0265340_10045337 3300031247 Unclassified 2148
100 Ga0265339_10012585 3300031249 Bacteria 5159
101 Ga0265339_10061413 3300031249 Bacteria 2023
102 Ga0265327_10002265 3300031251 Bacteria 20725
103 Ga0265327_10003795 3300031251 Bacteria 13994
104 Ga0265327_10012797 3300031251 Bacteria 5630
105 Ga0265316_10003464 3300031344 Bacteria 15947
106 Ga0265316_10013445 3300031344 Bacteria 7271
107 Ga0265316_10025128 3300031344 Bacteria 4974
108 Ga0265316_10025506 3300031344 Bacteria 4932
109 Ga0265316_10113404 3300031344 Bacteria 2051
110 Ga0265316_10186064 3300031344 Bacteria 1545
111 Ga0265316_10234586 3300031344 Bacteria 1350
112 Ga0265313_10006771 3300031595 Bacteria 8016
113 Ga0265313_10014757 3300031595 Bacteria 4596
114 Ga0265314_10000031 3300031711 Bacteria 265924
115 Ga0265342_10018883 3300031712 Bacteria 4457
116 Ga0265342_10047665 3300031712 Bacteria 2571
117 Ga0373930_0010933 3300034816 Bacteria 1630
118 Ga0373928_0001932 3300035084 Bacteria 4037
119 Ga0373929_0009997 3300035085 Bacteria 1766
120 Ga0373944_0000187 3300035089 Bacteria 13000
121 Ga0373949_0001444 3300035090 Bacteria 6797
122 Ga0373951_0001437 3300035091 Bacteria 6245
123 Ga0373932_0000001 3300035112 Bacteria 1459067
124 Ga0373939_0045522 3300035114 Bacteria 1340
125 Ga0373945_0015938 3300035116 Bacteria 2532
126 Ga0373943_0046348 3300035170 Unclassified 2122
127 Ga0373943_0256016 3300035170 Bacteria 984
128 Ga0373943_0286917 3300035170 Bacteria 932
129 Ga0373946_0008040 3300035171 Bacteria 3873
130 Ga0373962_0000265 3300035242 Bacteria 11207
131 Ga0373931_0000008 3300035691 Bacteria 362269
132 Ga0373935_0003022 3300035692 Bacteria 9701
133 Ga0373947_0004215 3300035725 Bacteria 8434
134 Ga0373947_0028680 3300035725 Bacteria 3265
135 Ga0316582_0341294 3300036647 Bacteria 1030
136 Ga0373925_0002695 3300037068 Bacteria 14084
137 Ga0373925_0038767 3300037068 Unclassified 3524
138 Ga0395905_0184552 3300037471 Unclassified 1958
139 Ga0451577_0009096 3300042876 Bacteria 9586
140 Ga0451577_0060628 3300042876 Bacteria 3373
141 Ga0451577_0065970 3300042876 Bacteria 3228
142 Ga0451577_0479085 3300042876 Bacteria 1130
143 Ga0451577_0535134 3300042876 Unclassified 1064
144 Ga0453684_0021422 3300044712 Bacteria 9657
145 Ga0453684_0222416 3300044712 Bacteria 2186
146 Ga0453684_0254561 3300044712 Bacteria 2015
147 Ga0451576_0024742 3300045051 Bacteria 6481
148 Ga0451576_0073519 3300045051 Bacteria 3557
149 Ga0451576_0473824 3300045051 Bacteria 1315
150 Ga0451576_0517854 3300045051 Bacteria 1253
151 Ga0495594_0048849 3300046499 Unclassified 2325
152 Ga0495628_0230706 3300046516 Unclassified 1388
153 Ga0495630_0003924 3300046517 Bacteria 10395
154 Ga0495630_0050308 3300046517 Bacteria 3119
155 Ga0495666_0008511 3300046526 Bacteria 5144
156 Ga0495652_0517844 3300046529 Unclassified 825
157 Ga0495586_0001633 3300046535 Bacteria 12304
158 Ga0495622_0008604 3300046557 Bacteria 4732
159 Ga0495634_0024105 3300046642 Bacteria 4272
160 Ga0495635_0039848 3300046663 Bacteria 3249
161 Ga0495635_0088031 3300046663 Bacteria 2125
162 Ga0495657_0067345 3300046675 Bacteria 2351
163 Ga0495599_0172296 3300046678 Bacteria 1335
164 Ga0495613_0011496 3300046689 Bacteria 6584
165 Ga0495613_0172996 3300046689 Viruses 1532
166 Ga0495676_0227996 3300047321 Unclassified 1280
167 Ga0495675_0083256 3300047444 Bacteria 2014
168 Ga0496115_0234889 3300048918 Bacteria 1511
169 Ga0501031_0000717 3300049568 Bacteria 19839
170 Ga0501031_0306891 3300049568 Unclassified 1028
171 Ga0501032_0007317 3300049569 Bacteria 8074
172 Ga0501033_0001159 3300049570 Bacteria 23842
173 Ga0501033_0165152 3300049570 Bacteria 1592
174 Ga0501037_0034369 3300049573 Bacteria 3741
175 Ga0501037_0043061 3300049573 Unclassified 3318
176 Ga0501043_0025907 3300049579 Unclassified 4601
177 Ga0501043_0071264 3300049579 Bacteria 2730
178 Ga0501043_0137588 3300049579 Bacteria 1913
179 Ga0501046_0326206 3300049580 Bacteria 1118
180 Ga0501047_0154484 3300049581 Bacteria 2169
181 Ga0501080_0021928 3300049742 Bacteria 5916
182 Ga0501044_0000014 3300049823 Bacteria 244619
183 Ga0501044_0019470 3300049823 Bacteria 7259
184 Ga0501035_0014771
185 rootH2_10174968
186 Ga0070683_100365907
187 Ga0070690_100127265
188 Ga0068869_100196872
189 Ga0070666_10138865
190 Ga0070674_100520954
191 Ga0070674_100556412
192 Ga0070688_100056235
193 Ga0070714_100011261
194 Ga0070708_100089550
195 Ga0070708_100107992
196 Ga0070685_10351903
197 Ga0070706_100000011
198 Ga0070707_100149242
199 Ga0070697_100114278
200 Ga0068853_100442704
201 Ga0068855_100065718
202 Ga0068855_100214641
203 Ga0068856_100002814
204 Ga0068856_100039802
205 Ga0068859_100434824
206 Ga0068864_100224818
207 Ga0068863_100268178
208 Ga0070717_10447276
209 Ga0097621_100088909
210 Ga0097620_100434805
211 Ga0105240_10004246
212 Ga0105240_10077109
213 Ga0105240_10091179
214 Ga0105241_10029763
215 Ga0105238_10016945
216 Ga0105238_10029174
217 Ga0105238_10171847
218 Ga0105238_10374107
219 Ga0157370_10141918
220 Ga0157374_10263965
221 Ga0157378_10107810
222 Ga0157378_10113827
223 Ga0157375_10000083
224 Ga0157375_10825915
225 Ga0163163_10000345
226 Ga0207680_10149177
227 Ga0207684_10000052
228 Ga0207654_10102918
229 Ga0207695_10086037
230 Ga0207695_10161576
231 Ga0207663_10023249
232 Ga0207652_10070081
233 Ga0207694_10016275
234 Ga0207694_10026512
235 Ga0207694_10078541
236 Ga0207694_10387021
237 Ga0207664_10014033
238 Ga0207661_10747098
239 Ga0207667_10149882
240 Ga0207667_10509775
241 Ga0207702_10005380
242 Ga0207702_10009437
243 Ga0207702_10088970
244 Ga0207641_10101783
245 Ga0207674_10106584
246 Ga0265337_1000656
247 Ga0265337_1001387
248 Ga0265326_10013497
249 Ga0265319_1000004
250 Ga0265319_1015843
251 Ga0265319_1081938
252 Ga0265334_10015999
253 Ga0265334_10034992
254 Ga0265323_10002299
255 Ga0265323_10032411
256 Ga0265323_10046088
257 Ga0265323_10094470
258 Ga0265336_10001514
259 Ga0265336_10026051
260 Ga0265336_10031535
261 Ga0265338_10000208
262 Ga0265338_10000670
263 Ga0265338_10000959
264 Ga0265338_10001912
265 Ga0265338_10002459
266 Ga0265338_10003105
267 Ga0265338_10005416
268 Ga0265338_10008884
269 Ga0265338_10013375
270 Ga0265338_10013438
271 Ga0265338_10032062
272 Ga0265338_10047462
273 Ga0265338_10057988
274 Ga0265338_10072906
275 Ga0265324_10009507
276 Ga0265332_10017832
277 Ga0265320_10000197
278 Ga0265320_10007382
279 Ga0265320_10011803
280 Ga0265325_10015605
281 Ga0265329_10004298
282 Ga0265340_10045337
283 Ga0265339_10012585
284 Ga0265339_10061413
285 Ga0265327_10002265
286 Ga0265327_10003795
287 Ga0265327_10012797
288 Ga0265316_10003464
289 Ga0265316_10013445
290 Ga0265316_10025128
291 Ga0265316_10025506
292 Ga0265316_10113404
293 Ga0265316_10186064
294 Ga0265316_10234586
295 Ga0265313_10006771
296 Ga0265313_10014757
297 Ga0265314_10000031
298 Ga0265342_10018883
299 Ga0265342_10047665
300 Ga0373930_0010933
301 Ga0373928_0001932
302 Ga0373929_0009997
303 Ga0373944_0000187
304 Ga0373949_0001444
305 Ga0373951_0001437
306 Ga0373932_0000001
307 Ga0373939_0045522
308 Ga0373945_0015938
309 Ga0373943_0046348
310 Ga0373943_0256016
311 Ga0373943_0286917
312 Ga0373946_0008040
313 Ga0373962_0000265
314 Ga0373931_0000008
315 Ga0373935_0003022
316 Ga0373947_0004215
317 Ga0373947_0028680
318 Ga0316582_0341294
319 Ga0373925_0002695
320 Ga0373925_0038767
321 Ga0395905_0184552
322 Ga0451577_0009096
323 Ga0451577_0060628
324 Ga0451577_0065970
325 Ga0451577_0479085
326 Ga0451577_0535134
327 Ga0453684_0021422
328 Ga0453684_0222416
329 Ga0453684_0254561
330 Ga0451576_0024742
331 Ga0451576_0073519
332 Ga0451576_0473824
333 Ga0451576_0517854
334 Ga0495594_0048849
335 Ga0495628_0230706
336 Ga0495630_0003924
337 Ga0495630_0050308
338 Ga0495666_0008511
339 Ga0495652_0517844
340 Ga0495586_0001633
341 Ga0495622_0008604
342 Ga0495634_0024105
343 Ga0495635_0039848
344 Ga0495635_0088031
345 Ga0495657_0067345
346 Ga0495599_0172296
347 Ga0495613_0011496
348 Ga0495613_0172996
349 Ga0495676_0227996
350 Ga0495675_0083256
351 Ga0496115_0234889
352 Ga0501031_0000717
353 Ga0501031_0306891
354 Ga0501032_0007317
355 Ga0501033_0001159
356 Ga0501033_0165152
357 Ga0501037_0034369
358 Ga0501037_0043061
359 Ga0501043_0025907
360 Ga0501043_0071264
361 Ga0501043_0137588
362 Ga0501046_0326206
363 Ga0501047_0154484
364 Ga0501080_0021928
365 Ga0501044_0000014
366 Ga0501044_0019470

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00696

AA_kinase

Amino acid kinase family

93

339

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2buf-assembly2.cif.gz_I arginine feed-back inhibitable acetylglutamate kinase 0.9346 1 293
2buf-assembly1.cif.gz_D arginine feed-back inhibitable acetylglutamate kinase 0.9339 1 291
2buf-assembly1.cif.gz_B arginine feed-back inhibitable acetylglutamate kinase 0.9313 1 291
2buf-assembly2.cif.gz_L arginine feed-back inhibitable acetylglutamate kinase 0.9279 1 293
2rd5-assembly1.cif.gz_B structural basis for the regulation of n-acetylglutamate kinase by pii in arabidopsis thaliana 0.9276 6 293
ID Description Score Start End Superfamily
af_P9WQ01_4_294_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.937 6 292 3.40.1160.10
2v5hF00 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9196 9 292 3.40.1160.10
af_Q2G1H6_1_252_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9106 24 292 3.40.1160.10
af_P9WQ01_4_294_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.906 6 292 3.40.1160.10
af_Q2G1H6_1_252_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9038 24 292 3.40.1160.10
ID Description Score Start End GO Terms
AF-A0A2V5VT16-F1-model_v4 acetylglutamate kinase (EC 2.7.2.8) 0.9751 198 293 GO:0003991
GO:0006526
AF-A0A4Y8P7V4-F1-model_v4 Acetylglutamate kinase (EC 2.7.2.8) (N-acetyl-L-glutamate 5-phosphotransferase) (NAG kinase) (NAGK) 0.9574 7 293 GO:0003991
GO:0005524
GO:0005737
GO:0006526
GO:0042450
AF-A0A2V6EZK6-F1-model_v4 acetylglutamate kinase (EC 2.7.2.8) 0.957 1 267 GO:0003991
GO:0005524
GO:0005737
GO:0006526
AF-A0A2V5LP44-F1-model_v4 acetylglutamate kinase (EC 2.7.2.8) 0.9558 192 293 GO:0003991
GO:0006526
AF-A0A2V6EZK6-F1-model_v4 acetylglutamate kinase (EC 2.7.2.8) 0.9535 1 267 GO:0003991
GO:0005524
GO:0005737
GO:0006526

Map