F281549

General Info

Members Datasets Scaffolds Average Seq Length
183 133 366 244

Family's Representative Sequence

Representative Sequence 3300049703|Ga0501219_000453|Ga0501219_000453_422_1270
Length 282
Sequence MYVPDLKPPVAFSYLSKTKNMDMAKAAKKASAKTTSATPASLTIFTAKAFIRELNKLQSDEELHKIQRYFKSGKGQYGEGDQFLGVKMGSLFNLAKSFIDMPPDQLEILMESPIHEYRAGAMSIMDKQGRSNKTSPQRRKELYDLYLRRHDRINNWDLVDLAAQYVVGRYLDDQPIDMLYKLARSKNIWERRTAIVASAHFLRKKQPEHTFKIAEMLIADKEDLIHKAAGGWIREAGKQDPERLIAFLDKYAATLPRTYLRYAIEKLPAKQKEHYMKLEKAT

Samples

Sample ID Description Type Environment
1 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
96 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
101 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
102 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
103 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
104 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
105 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
106 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
107 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
108 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
109 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
110 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
111 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
112 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
113 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
114 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
115 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
116 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
117 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
118 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
119 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
120 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
121 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
122 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
125 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
126 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
127 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
128 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
129 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
130 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
131 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
132 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
133 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.81
Metatranscriptomes 0
Isolates 2.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.46
Nodule 0
Rhizoplane 0.55
Rhizosphere 88.52
Stem 0
Stem Tuber 0
Unclassified 21.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501219_000453 3300049703 Bacteria 6556
2 SwRhRL2b_contig_116274 2162886007 Bacteria 23863
3 rootL2_10176054 3300003322 Unclassified 1300
4 Ga0065714_10003647 3300005288 Bacteria 10326
5 Ga0065704_10000193 3300005289 Bacteria 203271
6 Ga0065715_10179260 3300005293 Unclassified 1488
7 Ga0070683_100962577 3300005329 Bacteria 819
8 Ga0070690_100022133 3300005330 Bacteria 3886
9 Ga0070670_100540121 3300005331 Bacteria 1039
10 Ga0070677_10175625 3300005333 Bacteria 1016
11 Ga0070666_10126848 3300005335 Bacteria 1771
12 Ga0070689_100194640 3300005340 Bacteria 1652
13 Ga0070671_100065995 3300005355 Bacteria 3015
14 Ga0070659_100014242 3300005366 Bacteria 5937
15 Ga0070701_10353246 3300005438 Unclassified 919
16 Ga0070694_100003697 3300005444 Bacteria 9129
17 Ga0070678_100329651 3300005456 Unclassified 1306
18 Ga0068867_100660470 3300005459 Unclassified 918
19 Ga0070685_10124155 3300005466 Bacteria 1606
20 Ga0070707_100086354 3300005468 Bacteria 3034
21 Ga0070707_100091434 3300005468 Bacteria 2946
22 Ga0070698_100016999 3300005471 Bacteria 7669
23 Ga0070698_100025018 3300005471 Bacteria 6223
24 Ga0070699_100028463 3300005518 Bacteria 4819
25 Ga0070679_100032256 3300005530 Bacteria 5180
26 Ga0070695_100001405 3300005545 Bacteria 13335
27 Ga0070696_100009836 3300005546 Bacteria 6394
28 Ga0070704_100015169 3300005549 Bacteria 4834
29 Ga0070704_100179052 3300005549 Bacteria 1694
30 Ga0070704_100466647 3300005549 Bacteria 1090
31 Ga0068857_100447601 3300005577 Bacteria 1207
32 Ga0068857_100512980 3300005577 Unclassified 1126
33 Ga0068854_100430384 3300005578 Bacteria 1098
34 Ga0068852_100127481 3300005616 Bacteria 2339
35 Ga0068859_100000023 3300005617 Bacteria 221914
36 Ga0068859_100413919 3300005617 Unclassified 1444
37 Ga0068864_100103956 3300005618 Bacteria 2522
38 Ga0068858_100076428 3300005842 Bacteria 3109
39 Ga0068860_100287399 3300005843 Bacteria 1608
40 Ga0081540_1115267 3300005983 Bacteria 1126
41 Ga0075367_10012390 3300006178 Bacteria 4544
42 Ga0075369_10107398 3300006186 Bacteria 1256
43 Ga0075366_10014573 3300006195 Bacteria 4491
44 Ga0097621_100021418 3300006237 Bacteria 5000
45 Ga0075370_10033633 3300006353 Bacteria 2871
46 Ga0068871_100003813 3300006358 Bacteria 10392
47 Ga0075428_100004062 3300006844 Bacteria 16086
48 Ga0075428_100905878 3300006844 Bacteria 935
49 Ga0075430_100381964 3300006846 Bacteria 1162
50 Ga0075431_100208375 3300006847 Unclassified 1998
51 Ga0075433_10027729 3300006852 Bacteria 4807
52 Ga0075433_10131803 3300006852 Bacteria 2221
53 Ga0075433_10738107 3300006852 Unclassified 861
54 Ga0075434_100162357 3300006871 Unclassified 2254
55 Ga0075434_100515147 3300006871 Unclassified 1217
56 Ga0075429_100566273 3300006880 Unclassified 996
57 Ga0097620_100000023 3300006931 Bacteria 221914
58 Ga0097620_100413962 3300006931 Unclassified 1444
59 Ga0105240_10553172 3300009093 Bacteria 1273
60 Ga0111539_10015937 3300009094 Bacteria 9338
61 Ga0111539_10064610 3300009094 Bacteria 4328
62 Ga0111539_10345720 3300009094 Bacteria 1731
63 Ga0105247_10006085 3300009101 Bacteria 7499
64 Ga0114129_10014731 3300009147 Bacteria 11140
65 Ga0114129_10017305 3300009147 Bacteria 10263
66 Ga0114129_10093734 3300009147 Unclassified 4159
67 Ga0114129_10808317 3300009147 Unclassified 1195
68 Ga0105243_10098462 3300009148 Unclassified 2422
69 Ga0105248_10001487 3300009177 Bacteria 26103
70 Ga0105248_10038731 3300009177 Bacteria 5336
71 Ga0105249_10032829 3300009553 Unclassified 4697
72 Ga0105249_10113174 3300009553 Bacteria 2567
73 Ga0105249_10180604 3300009553 Bacteria 2053
74 Ga0105239_10447448 3300010375 Bacteria 1465
75 Ga0157373_10000136 3300013100 Bacteria 57912
76 Ga0157371_10006695 3300013102 Bacteria 9424
77 Ga0157370_10035491 3300013104 Bacteria 4846
78 Ga0157374_10018348 3300013296 Bacteria 6173
79 Ga0157378_10006386 3300013297 Bacteria 10306
80 Ga0157378_10533862 3300013297 Unclassified 1176
81 Ga0163162_10011624 3300013306 Bacteria 8584
82 Ga0163162_10039995 3300013306 Bacteria 4687
83 Ga0163162_10155819 3300013306 Bacteria 2404
84 Ga0157375_10009527 3300013308 Bacteria 8528
85 Ga0157375_10116281 3300013308 Bacteria 2778
86 Ga0163163_10049381 3300014325 Bacteria 4141
87 Ga0163163_10330943 3300014325 Unclassified 1578
88 Ga0157380_10000131 3300014326 Bacteria 41714
89 Ga0157380_10027573 3300014326 Bacteria 4320
90 Ga0157380_10072443 3300014326 Unclassified 2791
91 Ga0157380_10216040 3300014326 Bacteria 1712
92 Ga0157380_10412702 3300014326 Bacteria 1285
93 Ga0157379_10283887 3300014968 Bacteria 1507
94 Ga0157376_10136987 3300014969 Unclassified 2192
95 Ga0157376_11072597 3300014969 Bacteria 830
96 Ga0182006_1003997 3300015261 Bacteria 7367
97 Ga0207645_10054401 3300025907 Bacteria 2556
98 Ga0207643_10063891 3300025908 Bacteria 2106
99 Ga0207654_10002801 3300025911 Bacteria 8860
100 Ga0207671_10005226 3300025914 Bacteria 12067
101 Ga0207681_10000064 3300025923 Bacteria 99054
102 Ga0207681_10073662 3300025923 Bacteria 2390
103 Ga0207659_10123328 3300025926 Bacteria 1988
104 Ga0207644_10509617 3300025931 Bacteria 993
105 Ga0207690_10002073 3300025932 Bacteria 12290
106 Ga0207670_10040134 3300025936 Bacteria 3070
107 Ga0207670_10532315 3300025936 Bacteria 958
108 Ga0207691_10143171 3300025940 Bacteria 2105
109 Ga0207711_10012095 3300025941 Bacteria 7173
110 Ga0207689_10012450 3300025942 Bacteria 7268
111 Ga0207661_10846756 3300025944 Bacteria 842
112 Ga0207651_10075938 3300025960 Unclassified 2400
113 Ga0207712_10184412 3300025961 Bacteria 1642
114 Ga0207668_10242922 3300025972 Unclassified 1458
115 Ga0207703_10001008 3300026035 Bacteria 27037
116 Ga0207703_10171355 3300026035 Bacteria 1909
117 Ga0207641_11004686 3300026088 Unclassified 831
118 Ga0207648_10397906 3300026089 Unclassified 1248
119 Ga0207648_10970728 3300026089 Unclassified 795
120 Ga0207675_100423905 3300026118 Bacteria 1314
121 Ga0207683_10321120 3300026121 Unclassified 1418
122 Ga0207698_10079347 3300026142 Bacteria 2640
123 Ga0207698_10717025 3300026142 Bacteria 996
124 Ga0207428_10046184 3300027907 Unclassified 3503
125 Ga0207428_10073194 3300027907 Bacteria 2688
126 Ga0268264_10244179 3300028381 Bacteria 1665
127 Ga0307515_10005791 3300028794 Bacteria 24945
128 Ga0307515_10342557 3300028794 Bacteria 1146
129 Ga0307515_10348365 3300028794 Bacteria 1129
130 Ga0307509_10077983 3300031507 Unclassified 3435
131 Ga0307408_100183467 3300031548 Bacteria 1680
132 Ga0307508_10000354 3300031616 Bacteria 55733
133 Ga0307514_10074641 3300031649 Unclassified 2531
134 Ga0307412_10000067 3300031911 Bacteria 115549
135 Ga0307412_10452971 3300031911 Bacteria 1058
136 Ga0307416_100186295 3300032002 Bacteria 1951
137 Ga0307414_10013123 3300032004 Unclassified 4924
138 Ga0439431_0002891 3300041997 Bacteria 3780
139 Ga0439445_0086973 3300042004 Unclassified 878
140 Ga0453684_0002565 3300044712 Bacteria 43640
141 Ga0451576_0008138 3300045051 Bacteria 12352
142 Ga0451576_0225967 3300045051 Unclassified 1955
143 Ga0495625_0137140 3300046660 Bacteria 1653
144 Ga0495672_0008071 3300047320 Bacteria 7822
145 Ga0495672_0016930 3300047320 Bacteria 4886
146 Ga0495672_0255661 3300047320 Unclassified 848
147 Ga0495686_0002303 3300047472 Bacteria 18261
148 Ga0496115_0053131 3300048918 Bacteria 3251
149 Ga0496125_0000031 3300048928 Bacteria 365156
150 Ga0496126_0029379 3300048929 Bacteria 5223
151 Ga0501292_005828 3300049515 Bacteria 1731
152 Ga0501296_000295 3300049519 Bacteria 5134
153 Ga0501298_004621 3300049521 Bacteria 2177
154 Ga0501299_017066 3300049522 Bacteria 1291
155 Ga0501072_0524957 3300049588 Bacteria 936
156 Ga0501216_006708 3300049660 Bacteria 1774
157 Ga0501234_008870 3300049707 Bacteria 1567
158 Ga0501241_003633 3300049758 Bacteria 2909
159 Ga0501241_012857 3300049758 Unclassified 1521
160 Ga0501284_00034 3300050005 Bacteria 62269
161 nmdc:mga00v17_106397_c1 3300050491 Bacteria 1776
162 nmdc:mga05p37_102439_c1 3300050507 Unclassified 3525
163 nmdc:mga05p37_38090_c1 3300050507 Bacteria 5897
164 nmdc:mga05p37_391122_c1 3300050507 Bacteria 1626
165 nmdc:mga0qj67_359791_c1 3300050509 Bacteria 1176
166 nmdc:mga06r32_298385_c1 3300050510 Unclassified 1597
167 nmdc:mga06r32_44823_c1 3300050510 Bacteria 4213
168 nmdc:mga08y16_416514_c1 3300050511 Bacteria 1373
169 nmdc:mga08y16_559560_c1 3300050511 Bacteria 1157
170 nmdc:mga08y16_97669_c1 3300050511 Unclassified 3059
171 nmdc:mga0n895_357868_c1 3300050512 Unclassified 1478
172 nmdc:mga0a205_17575_c1 3300050515 Bacteria 6709
173 nmdc:mga0a205_50728_c1 3300050515 Bacteria 4006
174 nmdc:mga0a205_52122_c1 3300050515 Unclassified 3950
175 Ga0500651_0001853 3300053093 Bacteria 10869
176 Ga0500641_0001847 3300053096 Bacteria 7513
177 Ga0500616_0000047 3300053153 Bacteria 322354
178 Ga0500616_0011412 3300053153 Bacteria 5248
179 Ga0500645_033782 3300053730 Bacteria 1529
180 2857734194 2857733635 Bacteria 3532004
181 2896111998 2896109856 Bacteria 7140722
182 2919693130 2919692658 Bacteria 5943958
183 2965323558 2965320100 Bacteria 3975600
184 Ga0501219_000453
185 SwRhRL2b_contig_116274
186 rootL2_10176054
187 Ga0065714_10003647
188 Ga0065704_10000193
189 Ga0065715_10179260
190 Ga0070683_100962577
191 Ga0070690_100022133
192 Ga0070670_100540121
193 Ga0070677_10175625
194 Ga0070666_10126848
195 Ga0070689_100194640
196 Ga0070671_100065995
197 Ga0070659_100014242
198 Ga0070701_10353246
199 Ga0070694_100003697
200 Ga0070678_100329651
201 Ga0068867_100660470
202 Ga0070685_10124155
203 Ga0070707_100086354
204 Ga0070707_100091434
205 Ga0070698_100016999
206 Ga0070698_100025018
207 Ga0070699_100028463
208 Ga0070679_100032256
209 Ga0070695_100001405
210 Ga0070696_100009836
211 Ga0070704_100015169
212 Ga0070704_100179052
213 Ga0070704_100466647
214 Ga0068857_100447601
215 Ga0068857_100512980
216 Ga0068854_100430384
217 Ga0068852_100127481
218 Ga0068859_100000023
219 Ga0068859_100413919
220 Ga0068864_100103956
221 Ga0068858_100076428
222 Ga0068860_100287399
223 Ga0081540_1115267
224 Ga0075367_10012390
225 Ga0075369_10107398
226 Ga0075366_10014573
227 Ga0097621_100021418
228 Ga0075370_10033633
229 Ga0068871_100003813
230 Ga0075428_100004062
231 Ga0075428_100905878
232 Ga0075430_100381964
233 Ga0075431_100208375
234 Ga0075433_10027729
235 Ga0075433_10131803
236 Ga0075433_10738107
237 Ga0075434_100162357
238 Ga0075434_100515147
239 Ga0075429_100566273
240 Ga0097620_100000023
241 Ga0097620_100413962
242 Ga0105240_10553172
243 Ga0111539_10015937
244 Ga0111539_10064610
245 Ga0111539_10345720
246 Ga0105247_10006085
247 Ga0114129_10014731
248 Ga0114129_10017305
249 Ga0114129_10093734
250 Ga0114129_10808317
251 Ga0105243_10098462
252 Ga0105248_10001487
253 Ga0105248_10038731
254 Ga0105249_10032829
255 Ga0105249_10113174
256 Ga0105249_10180604
257 Ga0105239_10447448
258 Ga0157373_10000136
259 Ga0157371_10006695
260 Ga0157370_10035491
261 Ga0157374_10018348
262 Ga0157378_10006386
263 Ga0157378_10533862
264 Ga0163162_10011624
265 Ga0163162_10039995
266 Ga0163162_10155819
267 Ga0157375_10009527
268 Ga0157375_10116281
269 Ga0163163_10049381
270 Ga0163163_10330943
271 Ga0157380_10000131
272 Ga0157380_10027573
273 Ga0157380_10072443
274 Ga0157380_10216040
275 Ga0157380_10412702
276 Ga0157379_10283887
277 Ga0157376_10136987
278 Ga0157376_11072597
279 Ga0182006_1003997
280 Ga0207645_10054401
281 Ga0207643_10063891
282 Ga0207654_10002801
283 Ga0207671_10005226
284 Ga0207681_10000064
285 Ga0207681_10073662
286 Ga0207659_10123328
287 Ga0207644_10509617
288 Ga0207690_10002073
289 Ga0207670_10040134
290 Ga0207670_10532315
291 Ga0207691_10143171
292 Ga0207711_10012095
293 Ga0207689_10012450
294 Ga0207661_10846756
295 Ga0207651_10075938
296 Ga0207712_10184412
297 Ga0207668_10242922
298 Ga0207703_10001008
299 Ga0207703_10171355
300 Ga0207641_11004686
301 Ga0207648_10397906
302 Ga0207648_10970728
303 Ga0207675_100423905
304 Ga0207683_10321120
305 Ga0207698_10079347
306 Ga0207698_10717025
307 Ga0207428_10046184
308 Ga0207428_10073194
309 Ga0268264_10244179
310 Ga0307515_10005791
311 Ga0307515_10342557
312 Ga0307515_10348365
313 Ga0307509_10077983
314 Ga0307408_100183467
315 Ga0307508_10000354
316 Ga0307514_10074641
317 Ga0307412_10000067
318 Ga0307412_10452971
319 Ga0307416_100186295
320 Ga0307414_10013123
321 Ga0439431_0002891
322 Ga0439445_0086973
323 Ga0453684_0002565
324 Ga0451576_0008138
325 Ga0451576_0225967
326 Ga0495625_0137140
327 Ga0495672_0008071
328 Ga0495672_0016930
329 Ga0495672_0255661
330 Ga0495686_0002303
331 Ga0496115_0053131
332 Ga0496125_0000031
333 Ga0496126_0029379
334 Ga0501292_005828
335 Ga0501296_000295
336 Ga0501298_004621
337 Ga0501299_017066
338 Ga0501072_0524957
339 Ga0501216_006708
340 Ga0501234_008870
341 Ga0501241_003633
342 Ga0501241_012857
343 Ga0501284_00034
344 nmdc:mga00v17_106397_c1
345 nmdc:mga05p37_102439_c1
346 nmdc:mga05p37_38090_c1
347 nmdc:mga05p37_391122_c1
348 nmdc:mga0qj67_359791_c1
349 nmdc:mga06r32_298385_c1
350 nmdc:mga06r32_44823_c1
351 nmdc:mga08y16_416514_c1
352 nmdc:mga08y16_559560_c1
353 nmdc:mga08y16_97669_c1
354 nmdc:mga0n895_357868_c1
355 nmdc:mga0a205_17575_c1
356 nmdc:mga0a205_50728_c1
357 nmdc:mga0a205_52122_c1
358 Ga0500651_0001853
359 Ga0500641_0001847
360 Ga0500616_0000047
361 Ga0500616_0011412
362 Ga0500645_033782
363 2857734194
364 2896111998
365 2919693130
366 2965323558

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08713

DNA_alkylation

DNA alkylation repair enzyme

50

267

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b6c-assembly1.cif.gz_A predicted dna alkylation repair enzyme from enterococcus faecalis. 0.8147 17 224
5clc-assembly1.cif.gz_A alkylpurine dna glycosylase alkd bound to dna containing a 3-methyladenine analog (9-mer b) 0.8021 6 223
2b6c-assembly1.cif.gz_A predicted dna alkylation repair enzyme from enterococcus faecalis. 0.7903 17 224
5cl3-assembly1.cif.gz_A alkylpurine dna glycosylase alkd bound to dna containing a 3-methyladenine analog (100% substrate at 4 hours) 0.7783 6 226
5clc-assembly1.cif.gz_A alkylpurine dna glycosylase alkd bound to dna containing a 3-methyladenine analog (9-mer b) 0.7693 6 223
ID Description Score Start End Superfamily
5clcA00 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant; 0.8021 6 223 1.25.10.90
5clcA00 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant; 0.7693 6 223 1.25.10.90
af_A0A1D6HPB1_249_353_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.76 131 223 1.25.10.10
af_Q9XIE4_194_291_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.6772 44 105 1.25.10.10
af_A0A1D6HPB1_249_353_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.6771 131 223 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A3N5UVM0-F1-model_v4 DNA alkylation repair protein 0.9989 77 236
AF-H8K5P9-F1-model_v4 DNA alkylation repair enzyme family protein 0.9954 140 232
AF-A0A7C3K5I7-F1-model_v4 DNA alkylation repair protein 0.9936 134 233
AF-A0A3C1T9J7-F1-model_v4 DNA alkylation repair protein 0.9935 56 233
AF-A0A428X6P2-F1-model_v4 DNA alkylation repair protein 0.9935 43 177

Map