F281370

General Info

Members Datasets Scaffolds Average Seq Length
183 148 366 199

Family's Representative Sequence

Representative Sequence 3300046529|Ga0495652_0123532|Ga0495652_0123532_289_975
Length 228
Sequence MSAGLNDSRKCTAVENRWLRELLGRHPYDMEEPQRGIRAVHSESGSTITVYQAYPPDIGLPAAREGRFPAVWKRDRMTWIKPSFLWMMYRCGWGTKAGQETVLAVEISRAGFEWALRHACLSSYVSGVHPDRATWQRELKRASARVQWDPERDLRLRPLPYRALQLGLSGEAVRRYADEWTVAIRDVTPLAHEIHALVSDGDLGSAAQLLPQERPYPLEDELLAHLQG

Samples

Sample ID Description Type Environment
1 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
35 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
36 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
37 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
38 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
39 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
40 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
41 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
54 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
55 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
56 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
57 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
58 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
59 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
60 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
61 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
62 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
63 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
64 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
65 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
66 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
67 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
68 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
69 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
70 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
71 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
72 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
73 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
74 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
75 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
76 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
77 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
78 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
79 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
80 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
81 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
82 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
83 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
84 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
85 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
86 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
87 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
88 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
89 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
90 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
91 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
92 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
93 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
94 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
95 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
96 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
97 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
98 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
99 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
100 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
101 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
102 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
103 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
104 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
105 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
106 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
112 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
113 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
114 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
115 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
116 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
117 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
118 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
119 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
120 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
121 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
122 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
123 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
124 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
125 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
126 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
127 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
128 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
129 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
130 2808606448 Streptomyces sp. 193411 Isolate Unclassified
131 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
132 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
133 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
134 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
135 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
136 2867428634 Streptomyces sp. RP5T Isolate Unclassified
137 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
138 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
139 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
140 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
141 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
142 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
143 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
144 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
145 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
146 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
147 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
148 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.25
Metatranscriptomes 0
Isolates 14.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.48
Nodule 0
Rhizoplane 4.92
Rhizosphere 62.3
Stem 0
Stem Tuber 0
Unclassified 1.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495652_0123532 3300046529 Bacteria 2060
2 SwRhRL2b_contig_706486 2162886007 Unclassified 1632
3 JGI24751J29686_10010770 3300002459 Bacteria 1884
4 rootH2_10069984 3300003320 Bacteria 4991
5 rootL2_10005038 3300003322 Bacteria 6356
6 rootH1_10038088 3300003323 Bacteria 23752
7 rootH1_10187143 3300003323 Bacteria 3044
8 Ga0065704_10086533 3300005289 Bacteria 3108
9 Ga0070683_100571969 3300005329 Bacteria 1081
10 Ga0070670_100460090 3300005331 Bacteria 1128
11 Ga0068869_100662646 3300005334 Bacteria 887
12 Ga0070666_10315167 3300005335 Bacteria 1115
13 Ga0070668_100032455 3300005347 Bacteria 3974
14 Ga0070671_100113152 3300005355 Bacteria 2280
15 Ga0070667_100033695 3300005367 Bacteria 4284
16 Ga0068853_100343529 3300005539 Bacteria 1387
17 Ga0070686_100050799 3300005544 Bacteria 2637
18 Ga0070665_100001107 3300005548 Bacteria 33269
19 Ga0070665_100071382 3300005548 Bacteria 3479
20 Ga0068864_100376754 3300005618 Bacteria 1344
21 Ga0068863_100008395 3300005841 Bacteria 10087
22 Ga0068858_100031494 3300005842 Bacteria 4926
23 Ga0068860_100090277 3300005843 Bacteria 2918
24 Ga0068862_100096552 3300005844 Bacteria 2580
25 Ga0068862_100102357 3300005844 Bacteria 2507
26 Ga0081455_10025659 3300005937 Bacteria 5435
27 Ga0075367_10029644 3300006178 Bacteria 3132
28 Ga0075369_10013837 3300006186 Bacteria 3211
29 Ga0075369_10033488 3300006186 Bacteria 2178
30 Ga0075369_10089397 3300006186 Bacteria 1373
31 Ga0075370_10060542 3300006353 Bacteria 2157
32 Ga0075370_10145099 3300006353 Unclassified 1389
33 Ga0075370_10221515 3300006353 Bacteria 1118
34 Ga0075431_100100267 3300006847 Bacteria 2988
35 Ga0105240_10999108 3300009093 Bacteria 895
36 Ga0105247_10392425 3300009101 Bacteria 987
37 Ga0114129_10811490 3300009147 Bacteria 1193
38 Ga0157369_10274788 3300013105 Bacteria 1755
39 Ga0157375_10970297 3300013308 Bacteria 991
40 Ga0163163_10018210 3300014325 Bacteria 6569
41 Ga0182008_10000276 3300014497 Bacteria 40270
42 Ga0182006_1000129 3300015261 Bacteria 81237
43 Ga0182007_10062317 3300015262 Bacteria 1222
44 Ga0182005_1000001 3300015265 Bacteria 1014869
45 Ga0183367_1002 3300015688 Bacteria 1101531
46 Ga0209436_103918 3300025208 Bacteria 3794
47 Ga0207426_1004461 3300025302 Bacteria 6813
48 Ga0207426_1050329 3300025302 Bacteria 1242
49 Ga0207650_10401225 3300025925 Bacteria 1135
50 Ga0207664_10381076 3300025929 Bacteria 1252
51 Ga0207644_10022262 3300025931 Bacteria 4328
52 Ga0207689_10586676 3300025942 Bacteria 937
53 Ga0207668_10125885 3300025972 Bacteria 1948
54 Ga0207658_10009311 3300025986 Bacteria 6662
55 Ga0207639_10254700 3300026041 Bacteria 1532
56 Ga0207641_10009080 3300026088 Bacteria 8211
57 Ga0207676_10283488 3300026095 Bacteria 1505
58 Ga0268266_10000689 3300028379 Bacteria 45542
59 Ga0268266_10151693 3300028379 Bacteria 2089
60 Ga0268265_10511139 3300028380 Bacteria 1134
61 Ga0268264_10176961 3300028381 Bacteria 1934
62 Ga0307517_10007586 3300028786 Bacteria 15774
63 Ga0307515_10002531 3300028794 Bacteria 39518
64 Ga0307515_10013403 3300028794 Bacteria 15327
65 Ga0307511_10085786 3300030521 Bacteria 2174
66 Ga0307513_10024364 3300031456 Bacteria 7041
67 Ga0307509_10007642 3300031507 Bacteria 14049
68 Ga0307508_10022113 3300031616 Bacteria 5781
69 Ga0307508_10067360 3300031616 Bacteria 3149
70 Ga0307514_10102721 3300031649 Bacteria 2048
71 Ga0307516_10002829 3300031730 Bacteria 22853
72 Ga0307518_10094350 3300031838 Bacteria 2149
73 Ga0307409_100836757 3300031995 Bacteria 930
74 Ga0307507_10000113 3300033179 Bacteria 133812
75 Ga0307507_10035912 3300033179 Bacteria 5079
76 Ga0307510_10090364 3300033180 Bacteria 2909
77 Ga0307510_10124132 3300033180 Bacteria 2277
78 Ga0395905_0000381 3300037471 Bacteria 63099
79 Ga0450894_000372 3300042131 Bacteria 7798
80 Ga0450898_006564 3300042134 Bacteria 1789
81 Ga0450899_016221 3300042135 Bacteria 852
82 Ga0450906_004510 3300042145 Bacteria 2915
83 Ga0466972_0049035 3300044658 Bacteria 2040
84 Ga0495603_0004594 3300046455 Bacteria 8237
85 Ga0495603_0011542 3300046455 Bacteria 5345
86 Ga0495603_0013084 3300046455 Bacteria 5015
87 Ga0495629_0001222 3300046459 Bacteria 20192
88 Ga0495629_0003247 3300046459 Bacteria 12314
89 Ga0495605_0131854 3300046474 Bacteria 1126
90 Ga0495585_0058671 3300046492 Bacteria 2123
91 Ga0495585_0223850 3300046492 Bacteria 948
92 Ga0495594_0002385 3300046499 Bacteria 9785
93 Ga0495594_0002758 3300046499 Bacteria 9114
94 Ga0495594_0011952 3300046499 Bacteria 4515
95 Ga0495583_0037189 3300046506 Bacteria 2309
96 Ga0495583_0080277 3300046506 Bacteria 1418
97 Ga0495666_0006797 3300046526 Bacteria 5743
98 Ga0495666_0032812 3300046526 Bacteria 2540
99 Ga0495622_0001183 3300046557 Bacteria 13473
100 Ga0495622_0004532 3300046557 Bacteria 6430
101 Ga0495622_0030651 3300046557 Bacteria 2513
102 Ga0495611_0007352 3300046648 Bacteria 4676
103 Ga0495611_0054863 3300046648 Bacteria 1802
104 Ga0495625_0024345 3300046660 Bacteria 4609
105 Ga0495588_0005632 3300046674 Bacteria 5582
106 Ga0495588_0140507 3300046674 Bacteria 1275
107 Ga0495657_0007406 3300046675 Bacteria 8482
108 Ga0495613_0576819 3300046689 Bacteria 750
109 Ga0495671_0011383 3300046692 Bacteria 4897
110 Ga0495649_0170284 3300046694 Bacteria 1140
111 Ga0495589_0039908 3300046794 Bacteria 2345
112 Ga0495660_0048441 3300046810 Bacteria 2324
113 Ga0495660_0051735 3300046810 Bacteria 2234
114 Ga0495581_0024777 3300047315 Bacteria 3476
115 Ga0495636_0001964 3300047318 Bacteria 7877
116 Ga0495676_0027578 3300047321 Bacteria 4866
117 Ga0495676_0030026 3300047321 Bacteria 4621
118 Ga0495683_0014005 3300047323 Bacteria 4179
119 Ga0495683_0045405 3300047323 Bacteria 2208
120 Ga0495683_0143902 3300047323 Bacteria 1115
121 Ga0495687_005713 3300047443 Bacteria 7836
122 Ga0495687_005838 3300047443 Bacteria 7709
123 Ga0495685_006451 3300047447 Bacteria 3841
124 Ga0495685_018224 3300047447 Bacteria 2408
125 Ga0496101_0109074 3300048904 Bacteria 2082
126 Ga0496102_0004334 3300048905 Bacteria 12004
127 Ga0496102_0310067 3300048905 Bacteria 1487
128 Ga0496104_0166575 3300048907 Bacteria 2113
129 Ga0496107_0589257 3300048910 Bacteria 822
130 Ga0496108_0073572 3300048911 Bacteria 2885
131 Ga0496110_0033750 3300048913 Bacteria 4429
132 Ga0496112_0337343 3300048915 Bacteria 1451
133 Ga0496118_0219426 3300048921 Bacteria 1108
134 Ga0496121_0004556 3300048924 Bacteria 18524
135 Ga0496122_0003364 3300048925 Bacteria 21069
136 Ga0496123_0039099 3300048926 Bacteria 3322
137 Ga0496125_0082924 3300048928 Bacteria 2441
138 Ga0501031_0037654 3300049568 Bacteria 3157
139 Ga0501032_0037271 3300049569 Bacteria 3316
140 Ga0501034_1031147 3300049571 Bacteria 706
141 Ga0501038_0170027 3300049574 Bacteria 1765
142 Ga0501035_0004630 3300049822 Bacteria 13045
143 Ga0501044_0084767 3300049823 Bacteria 3202
144 nmdc:mga03683_112759_c1 3300050489 Bacteria 1203
145 nmdc:mga03n38_117807_c1 3300050490 Bacteria 1301
146 nmdc:mga03n38_246413_c1 3300050490 Bacteria 942
147 nmdc:mga00v17_196802_c1 3300050491 Bacteria 1302
148 nmdc:mga07m45_54783_c1 3300050496 Bacteria 2253
149 nmdc:mga07m45_58148_c1 3300050496 Bacteria 2187
150 nmdc:mga06r32_526626_c1 3300050510 Bacteria 1157
151 nmdc:mga0sz30_113529_c1 3300050516 Bacteria 1188
152 nmdc:mga0sz30_15810_c2 3300050516 Bacteria 2398
153 Ga0500610_0087347 3300053079 Bacteria 1622
154 Ga0500560_037541 3300053107 Bacteria 1502
155 Ga0500609_018190 3300053731 Bacteria 956
156 Ga0466962_0035750 3300061719 Bacteria 2377
157 2644013598 2643221601 Bacteria 7493239
158 2644178771 2643221631 Bacteria 8168043
159 2644439608 2643221678 Bacteria 9540101
160 2753268003 2751185782 Bacteria 11227053
161 2784589989 2784132148 Bacteria 8627943
162 2793983427 2791355406 Bacteria 11364898
163 2804847120 2802429296 Bacteria 7227771
164 2808849351 2808606359 Bacteria 9866990
165 2809233669 2808606448 Bacteria 8656184
166 2855681736 2855676851 Bacteria 7063653
167 2858851186 2858848962 Bacteria 6963058
168 2858893534 2858888857 Bacteria 7060307
169 2862287285 2862281513 Bacteria 9621493
170 2867314735 2867312974 Bacteria 7058875
171 2867431946 2867428634 Bacteria 9590268
172 2869052598 2869048445 Bacteria 6875584
173 2877679503 2877676314 Bacteria 9512378
174 2912728161 2912723979 Bacteria 8557534
175 2954384397 2954380949 Bacteria 10050426
176 2997458114 2997451912 Bacteria 8492419
177 8023627353 8023623736 Bacteria 8593882
178 8025414406 8025413630 Bacteria 7014048
179 8047896559 8047893842 Bacteria 11723082
180 8048362376 8048356638 Bacteria 11044339
181 8048373573 8048369669 Bacteria 11666822
182 8048384669 8048379754 Bacteria 11877923
183 8056837361 8056829672 Bacteria 9045328
184 Ga0495652_0123532
185 SwRhRL2b_contig_706486
186 JGI24751J29686_10010770
187 rootH2_10069984
188 rootL2_10005038
189 rootH1_10038088
190 rootH1_10187143
191 Ga0065704_10086533
192 Ga0070683_100571969
193 Ga0070670_100460090
194 Ga0068869_100662646
195 Ga0070666_10315167
196 Ga0070668_100032455
197 Ga0070671_100113152
198 Ga0070667_100033695
199 Ga0068853_100343529
200 Ga0070686_100050799
201 Ga0070665_100001107
202 Ga0070665_100071382
203 Ga0068864_100376754
204 Ga0068863_100008395
205 Ga0068858_100031494
206 Ga0068860_100090277
207 Ga0068862_100096552
208 Ga0068862_100102357
209 Ga0081455_10025659
210 Ga0075367_10029644
211 Ga0075369_10013837
212 Ga0075369_10033488
213 Ga0075369_10089397
214 Ga0075370_10060542
215 Ga0075370_10145099
216 Ga0075370_10221515
217 Ga0075431_100100267
218 Ga0105240_10999108
219 Ga0105247_10392425
220 Ga0114129_10811490
221 Ga0157369_10274788
222 Ga0157375_10970297
223 Ga0163163_10018210
224 Ga0182008_10000276
225 Ga0182006_1000129
226 Ga0182007_10062317
227 Ga0182005_1000001
228 Ga0183367_1002
229 Ga0209436_103918
230 Ga0207426_1004461
231 Ga0207426_1050329
232 Ga0207650_10401225
233 Ga0207664_10381076
234 Ga0207644_10022262
235 Ga0207689_10586676
236 Ga0207668_10125885
237 Ga0207658_10009311
238 Ga0207639_10254700
239 Ga0207641_10009080
240 Ga0207676_10283488
241 Ga0268266_10000689
242 Ga0268266_10151693
243 Ga0268265_10511139
244 Ga0268264_10176961
245 Ga0307517_10007586
246 Ga0307515_10002531
247 Ga0307515_10013403
248 Ga0307511_10085786
249 Ga0307513_10024364
250 Ga0307509_10007642
251 Ga0307508_10022113
252 Ga0307508_10067360
253 Ga0307514_10102721
254 Ga0307516_10002829
255 Ga0307518_10094350
256 Ga0307409_100836757
257 Ga0307507_10000113
258 Ga0307507_10035912
259 Ga0307510_10090364
260 Ga0307510_10124132
261 Ga0395905_0000381
262 Ga0450894_000372
263 Ga0450898_006564
264 Ga0450899_016221
265 Ga0450906_004510
266 Ga0466972_0049035
267 Ga0495603_0004594
268 Ga0495603_0011542
269 Ga0495603_0013084
270 Ga0495629_0001222
271 Ga0495629_0003247
272 Ga0495605_0131854
273 Ga0495585_0058671
274 Ga0495585_0223850
275 Ga0495594_0002385
276 Ga0495594_0002758
277 Ga0495594_0011952
278 Ga0495583_0037189
279 Ga0495583_0080277
280 Ga0495666_0006797
281 Ga0495666_0032812
282 Ga0495622_0001183
283 Ga0495622_0004532
284 Ga0495622_0030651
285 Ga0495611_0007352
286 Ga0495611_0054863
287 Ga0495625_0024345
288 Ga0495588_0005632
289 Ga0495588_0140507
290 Ga0495657_0007406
291 Ga0495613_0576819
292 Ga0495671_0011383
293 Ga0495649_0170284
294 Ga0495589_0039908
295 Ga0495660_0048441
296 Ga0495660_0051735
297 Ga0495581_0024777
298 Ga0495636_0001964
299 Ga0495676_0027578
300 Ga0495676_0030026
301 Ga0495683_0014005
302 Ga0495683_0045405
303 Ga0495683_0143902
304 Ga0495687_005713
305 Ga0495687_005838
306 Ga0495685_006451
307 Ga0495685_018224
308 Ga0496101_0109074
309 Ga0496102_0004334
310 Ga0496102_0310067
311 Ga0496104_0166575
312 Ga0496107_0589257
313 Ga0496108_0073572
314 Ga0496110_0033750
315 Ga0496112_0337343
316 Ga0496118_0219426
317 Ga0496121_0004556
318 Ga0496122_0003364
319 Ga0496123_0039099
320 Ga0496125_0082924
321 Ga0501031_0037654
322 Ga0501032_0037271
323 Ga0501034_1031147
324 Ga0501038_0170027
325 Ga0501035_0004630
326 Ga0501044_0084767
327 nmdc:mga03683_112759_c1
328 nmdc:mga03n38_117807_c1
329 nmdc:mga03n38_246413_c1
330 nmdc:mga00v17_196802_c1
331 nmdc:mga07m45_54783_c1
332 nmdc:mga07m45_58148_c1
333 nmdc:mga06r32_526626_c1
334 nmdc:mga0sz30_113529_c1
335 nmdc:mga0sz30_15810_c2
336 Ga0500610_0087347
337 Ga0500560_037541
338 Ga0500609_018190
339 Ga0466962_0035750
340 2644013598
341 2644178771
342 2644439608
343 2753268003
344 2784589989
345 2793983427
346 2804847120
347 2808849351
348 2809233669
349 2855681736
350 2858851186
351 2858893534
352 2862287285
353 2867314735
354 2867431946
355 2869052598
356 2877679503
357 2912728161
358 2954384397
359 2997458114
360 8023627353
361 8025414406
362 8047896559
363 8048362376
364 8048373573
365 8048384669
366 8056837361

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14124

DUF4291

Domain of unknown function (DUF4291)

36

216

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7rt7-assembly5.cif.gz_I crystal structure of the rhsp2 c-terminal toxin domain in complex with its immunity protein, rhsi2 0.7273 3 154
7zhl-assembly2.cif.gz_B salmonella enterica rhs1 c-terminal toxin tretu 0.7136 15 78
7rt7-assembly5.cif.gz_I crystal structure of the rhsp2 c-terminal toxin domain in complex with its immunity protein, rhsi2 0.709 3 154
7zhm-assembly1.cif.gz_A salmonella enterica rhs1 c-terminal toxin tretu complex with tritu immunity protein 0.7079 15 75
7zhl-assembly1.cif.gz_A salmonella enterica rhs1 c-terminal toxin tretu 0.6626 15 75
ID Description Score Start End Superfamily
af_Q54UT6_9_185_3.90.228.10 Alpha Beta;Alpha-Beta Complex;Phosphoenolpyruvate Carboxykinase; domain 3; 0.8597 8 184 3.90.228.10
af_Q54UT6_9_185_3.90.228.10 Alpha Beta;Alpha-Beta Complex;Phosphoenolpyruvate Carboxykinase; domain 3; 0.8456 8 184 3.90.228.10
af_Q18195_8_319_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6137 99 118 3.40.50.300
af_I1K008_33_207_3.90.228.10 Alpha Beta;Alpha-Beta Complex;Phosphoenolpyruvate Carboxykinase; domain 3; 0.5554 15 152 3.90.228.10
2jqnA00 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;Protein of unknown function DUF952 0.4778 17 86 3.20.170.20
ID Description Score Start End GO Terms
AF-A0A402B0S9-F1-model_v4 DUF4291 domain-containing protein 0.9913 3 196
AF-A0A4Q3WTI1-F1-model_v4 DUF4291 domain-containing protein 0.9909 1 190
AF-A0A7X9S0Q2-F1-model_v4 DUF4291 domain-containing protein 0.9893 3 195
AF-A0A2E9QZ81-F1-model_v4 DUF4291 domain-containing protein 0.9886 5 195
AF-A0A4R2NPU8-F1-model_v4 Uncharacterized protein DUF4291 0.9885 1 195

Map