F280930

General Info

Members Datasets Scaffolds Average Seq Length
183 116 366 239

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10077433|Ga0213875_100774332
Length 261
Sequence VSGLVSRSETFFRFSAKMSDAIPAAPLEQARERLAAAKSVAVLTGAGISAESGIPTFRGAGGLWKNYRPEDLATPQAFARDPRLVWEWYNWRRETIAKAAPNPAHRALVKLETTKASFNLITQNVDGLHDLAGNARILKLHGDIWRLRCTACGAHWPDRRVPLPKLPPHCGCGGLARPGVVWFGEPLPDGIMNEAEHAAETADVFLVIGTSAVVYPAAGLVPHAKQNGATVIEINLEPTPFSQMVDFSFQQPAGELLPQLL

Samples

Sample ID Description Type Environment
1 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
45 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
46 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
66 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
67 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
68 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
69 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
70 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
71 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
72 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
73 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
74 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
75 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
76 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
77 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
78 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
79 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
80 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
81 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
82 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
85 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
86 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
87 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
88 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
89 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
90 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
91 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
92 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
93 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
94 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
95 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
96 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
97 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
98 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
99 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
100 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
101 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
102 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
103 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
104 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
105 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
106 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
110 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
111 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
112 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
113 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
114 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
115 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
116 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.09
Rhizosphere 80.33
Stem 0
Stem Tuber 0
Unclassified 8.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213875_10077433 3300021388 Bacteria 1552
2 Ga0070676_10295834 3300005328 Bacteria 1096
3 Ga0070683_100051291 3300005329 Bacteria 3819
4 Ga0070683_100208806 3300005329 Bacteria 1855
5 Ga0070689_100304929 3300005340 Bacteria 1326
6 Ga0070669_100091643 3300005353 Bacteria 2280
7 Ga0070675_100316629 3300005354 Bacteria 1378
8 Ga0070674_100341834 3300005356 Bacteria 1206
9 Ga0070673_100078174 3300005364 Bacteria 2676
10 Ga0070673_100281558 3300005364 Bacteria 1459
11 Ga0070709_10160054 3300005434 Bacteria 1564
12 Ga0070709_10633120 3300005434 Bacteria 826
13 Ga0070714_100042098 3300005435 Bacteria 3857
14 Ga0070713_100583468 3300005436 Bacteria 1061
15 Ga0070708_100346880 3300005445 Bacteria 1399
16 Ga0070678_100299648 3300005456 Bacteria 1366
17 Ga0070681_10094993 3300005458 Bacteria 2930
18 Ga0070681_10421451 3300005458 Unclassified 1247
19 Ga0070706_100211280 3300005467 Bacteria 1812
20 Ga0070707_100440672 3300005468 Bacteria 1263
21 Ga0070679_100547310 3300005530 Bacteria 1101
22 Ga0070684_100161602 3300005535 Bacteria 2032
23 Ga0070697_100231525 3300005536 Bacteria 1576
24 Ga0070672_100324993 3300005543 Bacteria 1308
25 Ga0070665_100370937 3300005548 Bacteria 1438
26 Ga0070665_100520059 3300005548 Bacteria 1202
27 Ga0070665_100759093 3300005548 Bacteria 983
28 Ga0068857_100566533 3300005577 Bacteria 1071
29 Ga0068859_100114403 3300005617 Bacteria 2762
30 Ga0068864_100816774 3300005618 Bacteria 917
31 Ga0068864_101065894 3300005618 Bacteria 803
32 Ga0068863_100084148 3300005841 Bacteria 3015
33 Ga0081455_10008465 3300005937 Bacteria 10695
34 Ga0070717_10173907 3300006028 Bacteria 1874
35 Ga0068871_100047575 3300006358 Bacteria 3460
36 Ga0068871_100957011 3300006358 Bacteria 796
37 Ga0075436_100021569 3300006914 Bacteria 4421
38 Ga0097620_100114400 3300006931 Bacteria 2762
39 Ga0075435_100182534 3300007076 Bacteria 1774
40 Ga0105240_10002902 3300009093 Bacteria 27043
41 Ga0105240_10159861 3300009093 Unclassified 2677
42 Ga0105240_10169608 3300009093 Unclassified 2586
43 Ga0105240_10718371 3300009093 Unclassified 1089
44 Ga0111539_10625234 3300009094 Bacteria 1254
45 Ga0105248_10008778 3300009177 Bacteria 11096
46 Ga0105248_10102557 3300009177 Bacteria 3225
47 Ga0105248_10360513 3300009177 Bacteria 1637
48 Ga0105237_10013949 3300009545 Bacteria 8409
49 Ga0105237_10134422 3300009545 Unclassified 2468
50 Ga0105238_10328114 3300009551 Bacteria 1517
51 Ga0105238_10898625 3300009551 Bacteria 904
52 Ga0105239_10082400 3300010375 Bacteria 3542
53 Ga0105239_10530543 3300010375 Bacteria 1340
54 Ga0105239_10907858 3300010375 Unclassified 1011
55 Ga0157374_10068452 3300013296 Bacteria 3340
56 Ga0157378_10206698 3300013297 Bacteria 1860
57 Ga0163162_10574201 3300013306 Bacteria 1255
58 Ga0163162_10885152 3300013306 Unclassified 1007
59 Ga0163163_10042551 3300014325 Bacteria 4450
60 Ga0163163_10260825 3300014325 Bacteria 1784
61 Ga0163163_10564342 3300014325 Bacteria 1201
62 Ga0163163_10770491 3300014325 Bacteria 1025
63 Ga0157377_10000078 3300014745 Bacteria 74509
64 Ga0157376_10299831 3300014969 Bacteria 1521
65 Ga0157376_10514516 3300014969 Bacteria 1179
66 Ga0213872_10000930 3300021361 Bacteria 20639
67 Ga0213876_10002218 3300021384 Bacteria 11466
68 Ga0207699_10285807 3300025906 Bacteria 1147
69 Ga0207684_10175547 3300025910 Bacteria 1847
70 Ga0207707_10045897 3300025912 Bacteria 3806
71 Ga0207695_10012878 3300025913 Bacteria 10011
72 Ga0207695_10085658 3300025913 Unclassified 3180
73 Ga0207695_10340952 3300025913 Unclassified 1386
74 Ga0207695_10696752 3300025913 Unclassified 896
75 Ga0207671_10026096 3300025914 Bacteria 4382
76 Ga0207652_10194532 3300025921 Bacteria 1824
77 Ga0207652_10429781 3300025921 Bacteria 1191
78 Ga0207650_10655087 3300025925 Bacteria 885
79 Ga0207659_10209745 3300025926 Bacteria 1560
80 Ga0207664_10164097 3300025929 Bacteria 1897
81 Ga0207670_10193136 3300025936 Bacteria 1542
82 Ga0207711_10198427 3300025941 Bacteria 1830
83 Ga0207661_10097120 3300025944 Bacteria 2466
84 Ga0207651_10090735 3300025960 Bacteria 2235
85 Ga0207658_10108697 3300025986 Bacteria 2188
86 Ga0207703_10173262 3300026035 Bacteria 1900
87 Ga0207641_10110002 3300026088 Bacteria 2441
88 Ga0207676_10173901 3300026095 Bacteria 1879
89 Ga0207676_10875889 3300026095 Bacteria 879
90 Ga0207683_10194488 3300026121 Bacteria 1842
91 Ga0207683_10360926 3300026121 Bacteria 1334
92 Ga0268266_10244724 3300028379 Bacteria 1657
93 Ga0265340_10178205 3300031247 Bacteria 961
94 Ga0265316_10002611 3300031344 Bacteria 18577
95 Ga0265316_10010522 3300031344 Bacteria 8425
96 Ga0265316_10020623 3300031344 Bacteria 5605
97 Ga0265316_10039855 3300031344 Bacteria 3770
98 Ga0265314_10034916 3300031711 Bacteria 3669
99 Ga0373932_0001046 3300035112 Bacteria 7973
100 Ga0373927_0242211 3300035695 Bacteria 1185
101 Ga0373937_0225857 3300036401 Bacteria 1763
102 Ga0373937_0361230 3300036401 Bacteria 1376
103 Ga0316582_0007487 3300036647 Bacteria 5816
104 Ga0316582_0228659 3300036647 Unclassified 1273
105 Ga0316584_0126908 3300036712 Bacteria 1905
106 Ga0316584_0597882 3300036712 Unclassified 765
107 Ga0373925_0068700 3300037068 Bacteria 2676
108 Ga0373925_0677357 3300037068 Bacteria 850
109 Ga0436364_0111571 3300037853 Bacteria 918
110 Ga0436364_0364196 3300037853 Bacteria 9193
111 Ga0436364_0745246 3300037853 Bacteria 72310
112 Ga0436364_0880075 3300037853 Bacteria 2713
113 Ga0436364_1184099 3300037853 Bacteria 2656
114 Ga0436364_1364473 3300037853 Bacteria 1859
115 Ga0400484_14068 3300038725 Bacteria 4154
116 Ga0400484_35064 3300038725 Bacteria 4637
117 Ga0400490_22223 3300038726 Bacteria 15634
118 Ga0400490_44546 3300038726 Bacteria 3257
119 Ga0400490_53409 3300038726 Bacteria 4072
120 Ga0400490_53584 3300038726 Bacteria 2129
121 Ga0400485_07016 3300038735 Bacteria 1221
122 Ga0400485_15698 3300038735 Archaea 1009
123 Ga0400488_03378 3300038741 Bacteria 1554
124 Ga0400488_12122 3300038741 Bacteria 4401
125 Ga0400488_56811 3300038741 Bacteria 2130
126 Ga0400486_11562 3300038742 Bacteria 1388
127 Ga0400483_006857 3300039062 Bacteria 2456
128 Ga0400483_027675 3300039062 Bacteria 3677
129 Ga0400483_195277 3300039062 Bacteria 1454
130 Ga0400483_241953 3300039062 Bacteria 1876
131 Ga0400483_262602 3300039062 Bacteria 2884
132 Ga0400489_72132 3300039093 Bacteria 7980
133 Ga0400487_16163 3300039110 Bacteria 5154
134 Ga0400487_56360 3300039110 Bacteria 3443
135 Ga0436365_0074018 3300039437 Bacteria 20747
136 Ga0436365_0541355 3300039437 Bacteria 5179
137 Ga0436365_0769590 3300039437 Bacteria 2399
138 Ga0436365_0802956 3300039437 Bacteria 911
139 Ga0436361_0079738 3300039447 Bacteria 122121
140 Ga0436363_0153011 3300039450 Bacteria 1033
141 Ga0436363_0178198 3300039450 Bacteria 2094
142 Ga0451577_0010550 3300042876 Bacteria 8812
143 Ga0451576_0420144 3300045051 Bacteria 1403
144 Ga0451576_1329761 3300045051 Bacteria 749
145 Ga0495651_0164170 3300046462 Bacteria 1588
146 Ga0495580_0000704 3300046472 Bacteria 28604
147 Ga0495580_0012861 3300046472 Bacteria 6414
148 Ga0495580_0150044 3300046472 Bacteria 1615
149 Ga0495580_0192848 3300046472 Bacteria 1405
150 Ga0495608_0387717 3300046511 Bacteria 856
151 Ga0495666_0114401 3300046526 Bacteria 1266
152 Ga0495652_0013905 3300046529 Bacteria 7238
153 Ga0495665_0082108 3300046531 Bacteria 1694
154 Ga0495587_0149906 3300046536 Bacteria 1329
155 Ga0495645_0158936 3300046543 Bacteria 1564
156 Ga0495645_0349062 3300046543 Bacteria 954
157 Ga0495667_0323423 3300046559 Bacteria 976
158 Ga0495657_0096133 3300046675 Unclassified 1893
159 Ga0495599_0043567 3300046678 Unclassified 2817
160 Ga0495599_0074943 3300046678 Bacteria 2113
161 Ga0495599_0089107 3300046678 Bacteria 1926
162 Ga0495599_0224576 3300046678 Bacteria 1148
163 Ga0495623_0096905 3300046679 Bacteria 1802
164 Ga0495613_0395149 3300046689 Bacteria 944
165 Ga0495604_0076569 3300047317 Bacteria 2516
166 Ga0495674_0032849 3300047319 Bacteria 4704
167 Ga0495674_0044479 3300047319 Bacteria 3948
168 Ga0495680_0091011 3300047322 Unclassified 2287
169 Ga0495675_0075044 3300047444 Bacteria 2131
170 Ga0495684_0000360 3300047471 Bacteria 36928
171 Ga0495684_0034412 3300047471 Bacteria 3887
172 Ga0495602_0053601 3300048088 Bacteria 3570
173 Ga0495602_0108212 3300048088 Bacteria 2264
174 Ga0496109_0624494 3300048912 Bacteria 1014
175 Ga0496112_0597221 3300048915 Bacteria 1036
176 nmdc:mga05p37_260277_c1 3300050507 Bacteria 2076
177 nmdc:mga08y16_565842_c1 3300050511 Bacteria 1149
178 nmdc:mga0rr50_408601_c1 3300050513 Bacteria 1147
179 nmdc:mga08x19_17930_c1 3300050514 Bacteria 4335
180 Ga0495601_0000171 3300053077 Bacteria 34621
181 Ga0495595_0088909 3300053084 Bacteria 1480
182 Ga0495619_0394215 3300053085 Bacteria 956
183 Ga0501082_0009913 3300060353 Bacteria 8212
184 Ga0213875_10077433
185 Ga0070676_10295834
186 Ga0070683_100051291
187 Ga0070683_100208806
188 Ga0070689_100304929
189 Ga0070669_100091643
190 Ga0070675_100316629
191 Ga0070674_100341834
192 Ga0070673_100078174
193 Ga0070673_100281558
194 Ga0070709_10160054
195 Ga0070709_10633120
196 Ga0070714_100042098
197 Ga0070713_100583468
198 Ga0070708_100346880
199 Ga0070678_100299648
200 Ga0070681_10094993
201 Ga0070681_10421451
202 Ga0070706_100211280
203 Ga0070707_100440672
204 Ga0070679_100547310
205 Ga0070684_100161602
206 Ga0070697_100231525
207 Ga0070672_100324993
208 Ga0070665_100370937
209 Ga0070665_100520059
210 Ga0070665_100759093
211 Ga0068857_100566533
212 Ga0068859_100114403
213 Ga0068864_100816774
214 Ga0068864_101065894
215 Ga0068863_100084148
216 Ga0081455_10008465
217 Ga0070717_10173907
218 Ga0068871_100047575
219 Ga0068871_100957011
220 Ga0075436_100021569
221 Ga0097620_100114400
222 Ga0075435_100182534
223 Ga0105240_10002902
224 Ga0105240_10159861
225 Ga0105240_10169608
226 Ga0105240_10718371
227 Ga0111539_10625234
228 Ga0105248_10008778
229 Ga0105248_10102557
230 Ga0105248_10360513
231 Ga0105237_10013949
232 Ga0105237_10134422
233 Ga0105238_10328114
234 Ga0105238_10898625
235 Ga0105239_10082400
236 Ga0105239_10530543
237 Ga0105239_10907858
238 Ga0157374_10068452
239 Ga0157378_10206698
240 Ga0163162_10574201
241 Ga0163162_10885152
242 Ga0163163_10042551
243 Ga0163163_10260825
244 Ga0163163_10564342
245 Ga0163163_10770491
246 Ga0157377_10000078
247 Ga0157376_10299831
248 Ga0157376_10514516
249 Ga0213872_10000930
250 Ga0213876_10002218
251 Ga0207699_10285807
252 Ga0207684_10175547
253 Ga0207707_10045897
254 Ga0207695_10012878
255 Ga0207695_10085658
256 Ga0207695_10340952
257 Ga0207695_10696752
258 Ga0207671_10026096
259 Ga0207652_10194532
260 Ga0207652_10429781
261 Ga0207650_10655087
262 Ga0207659_10209745
263 Ga0207664_10164097
264 Ga0207670_10193136
265 Ga0207711_10198427
266 Ga0207661_10097120
267 Ga0207651_10090735
268 Ga0207658_10108697
269 Ga0207703_10173262
270 Ga0207641_10110002
271 Ga0207676_10173901
272 Ga0207676_10875889
273 Ga0207683_10194488
274 Ga0207683_10360926
275 Ga0268266_10244724
276 Ga0265340_10178205
277 Ga0265316_10002611
278 Ga0265316_10010522
279 Ga0265316_10020623
280 Ga0265316_10039855
281 Ga0265314_10034916
282 Ga0373932_0001046
283 Ga0373927_0242211
284 Ga0373937_0225857
285 Ga0373937_0361230
286 Ga0316582_0007487
287 Ga0316582_0228659
288 Ga0316584_0126908
289 Ga0316584_0597882
290 Ga0373925_0068700
291 Ga0373925_0677357
292 Ga0436364_0111571
293 Ga0436364_0364196
294 Ga0436364_0745246
295 Ga0436364_0880075
296 Ga0436364_1184099
297 Ga0436364_1364473
298 Ga0400484_14068
299 Ga0400484_35064
300 Ga0400490_22223
301 Ga0400490_44546
302 Ga0400490_53409
303 Ga0400490_53584
304 Ga0400485_07016
305 Ga0400485_15698
306 Ga0400488_03378
307 Ga0400488_12122
308 Ga0400488_56811
309 Ga0400486_11562
310 Ga0400483_006857
311 Ga0400483_027675
312 Ga0400483_195277
313 Ga0400483_241953
314 Ga0400483_262602
315 Ga0400489_72132
316 Ga0400487_16163
317 Ga0400487_56360
318 Ga0436365_0074018
319 Ga0436365_0541355
320 Ga0436365_0769590
321 Ga0436365_0802956
322 Ga0436361_0079738
323 Ga0436363_0153011
324 Ga0436363_0178198
325 Ga0451577_0010550
326 Ga0451576_0420144
327 Ga0451576_1329761
328 Ga0495651_0164170
329 Ga0495580_0000704
330 Ga0495580_0012861
331 Ga0495580_0150044
332 Ga0495580_0192848
333 Ga0495608_0387717
334 Ga0495666_0114401
335 Ga0495652_0013905
336 Ga0495665_0082108
337 Ga0495587_0149906
338 Ga0495645_0158936
339 Ga0495645_0349062
340 Ga0495667_0323423
341 Ga0495657_0096133
342 Ga0495599_0043567
343 Ga0495599_0074943
344 Ga0495599_0089107
345 Ga0495599_0224576
346 Ga0495623_0096905
347 Ga0495613_0395149
348 Ga0495604_0076569
349 Ga0495674_0032849
350 Ga0495674_0044479
351 Ga0495680_0091011
352 Ga0495675_0075044
353 Ga0495684_0000360
354 Ga0495684_0034412
355 Ga0495602_0053601
356 Ga0495602_0108212
357 Ga0496109_0624494
358 Ga0496112_0597221
359 nmdc:mga05p37_260277_c1
360 nmdc:mga08y16_565842_c1
361 nmdc:mga0rr50_408601_c1
362 nmdc:mga08x19_17930_c1
363 Ga0495601_0000171
364 Ga0495595_0088909
365 Ga0495619_0394215
366 Ga0501082_0009913

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02146

SIR2

Sir2 family

45

216

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1m2n-assembly1.cif.gz_B sir2 homologues (d102g/f159a/r170a) mutant-2'-o-acetyl adp ribose complex 0.9456 2 228
1ici-assembly1.cif.gz_A crystal structure of a sir2 homolog-nad complex 0.9435 2 228
1m2j-assembly1.cif.gz_A sir2 homologue h80n mutant-adp ribose complex 0.9377 2 228
1m2h-assembly1.cif.gz_A sir2 homologue s24a mutant-adp ribose complex 0.9371 2 227
1m2k-assembly1.cif.gz_A sir2 homologue f159a mutant-adp ribose complex 0.9328 2 227
ID Description Score Start End Superfamily
4buzA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9452 2 228 3.40.50.1220
1ma3A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9416 2 227 3.40.50.1220
1iciA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9366 2 228 3.40.50.1220
af_Q68FX9_35_302_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9261 2 226 3.40.50.1220
af_Q68FX9_35_302_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9063 2 226 3.40.50.1220
ID Description Score Start End GO Terms
AF-A0A2V8HAZ9-F1-model_v4 NAD-dependent protein deacylase (EC 2.3.1.286) (Regulatory protein SIR2 homolog) 0.9823 2 229 GO:0005737
GO:0008270
GO:0032041
GO:0036054
GO:0036055
GO:0046969
GO:0046970
GO:0070403
GO:0097372
GO:0140765
GO:0141222
AF-A0A496YZD8-F1-model_v4 NAD-dependent protein deacylase (EC 2.3.1.286) (Regulatory protein SIR2 homolog) 0.9756 2 227 GO:0005737
GO:0008270
GO:0032041
GO:0036054
GO:0036055
GO:0046969
GO:0046970
GO:0070403
GO:0097372
GO:0140765
GO:0141222
AF-A0A7V8NS63-F1-model_v4 protein acetyllysine N-acetyltransferase (EC 2.3.1.286) 0.9752 38 225 GO:0017136
GO:0046872
GO:0070403
AF-A0A532AWI5-F1-model_v4 NAD-dependent protein deacylase (EC 2.3.1.286) (Regulatory protein SIR2 homolog) 0.9746 2 222 GO:0005737
GO:0008270
GO:0032041
GO:0036054
GO:0036055
GO:0046969
GO:0046970
GO:0070403
GO:0097372
GO:0140765
GO:0141222
AF-A0A2V8URU2-F1-model_v4 NAD-dependent protein deacylase (EC 2.3.1.286) (Regulatory protein SIR2 homolog) 0.972 2 226 GO:0005737
GO:0008270
GO:0032041
GO:0036054
GO:0036055
GO:0046969
GO:0046970
GO:0070403
GO:0097372
GO:0140765
GO:0141222

Map