F280899

General Info

Members Datasets Scaffolds Average Seq Length
183 137 366 82

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10832894|Ga0182008_108328942
Length 91
Sequence MLRGGDRRRMRADAIFIGVEVDDAVAHDTAVATKLAEVCPVDIYAVEGGHTVLVEENLDECVLCGLCLDAAPEGAVRVLKLYDEGAALQQA

Samples

Sample ID Description Type Environment
1 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
75 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
78 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
79 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
80 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
81 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
82 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
88 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
89 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
90 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
91 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
92 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
93 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
94 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
95 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
96 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
97 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
98 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
99 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
100 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
101 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
102 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
103 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
104 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
105 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
106 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
107 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
108 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
109 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
110 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
111 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
112 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
113 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
118 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
119 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
123 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
129 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
130 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
133 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
134 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
135 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
136 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
137 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.64
Nodule 0
Rhizoplane 15.3
Rhizosphere 79.78
Stem 0
Stem Tuber 0
Unclassified 8.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182008_10832894 3300014497 Bacteria 538
2 Ga0070683_101479896 3300005329 Bacteria 653
3 Ga0070690_100327238 3300005330 Bacteria 1106
4 Ga0070682_100404390 3300005337 Bacteria 1033
5 Ga0070668_100078797 3300005347 Bacteria 2577
6 Ga0070669_100482851 3300005353 Bacteria 1026
7 Ga0070659_101507183 3300005366 Bacteria 599
8 Ga0070659_101692990 3300005366 Bacteria 566
9 Ga0070711_100397736 3300005439 Bacteria 1118
10 Ga0070700_100220476 3300005441 Bacteria 1344
11 Ga0070700_100890019 3300005441 Bacteria 724
12 Ga0070663_101618049 3300005455 Bacteria 578
13 Ga0070678_100574110 3300005456 Bacteria 1004
14 Ga0070662_100107735 3300005457 Bacteria 2118
15 Ga0070662_100687925 3300005457 Bacteria 864
16 Ga0068867_100846017 3300005459 Unclassified 819
17 Ga0070699_100602284 3300005518 Bacteria 1002
18 Ga0070684_101229344 3300005535 Bacteria 705
19 Ga0070697_101725448 3300005536 Bacteria 560
20 Ga0070696_100421829 3300005546 Bacteria 1048
21 Ga0070664_101469950 3300005564 Bacteria 645
22 Ga0068854_101901862 3300005578 Bacteria 547
23 Ga0068856_100043585 3300005614 Bacteria 4414
24 Ga0068856_100828754 3300005614 Bacteria 944
25 Ga0068856_102106126 3300005614 Bacteria 574
26 Ga0068859_102439913 3300005617 Bacteria 576
27 Ga0068861_100032884 3300005719 Bacteria 3822
28 Ga0068862_100781863 3300005844 Bacteria 931
29 Ga0081455_10071945 3300005937 Bacteria 2865
30 Ga0081455_10441775 3300005937 Bacteria 891
31 Ga0081540_1005480 3300005983 Bacteria 9469
32 Ga0081540_1105966 3300005983 Bacteria 1199
33 Ga0081539_10006660 3300005985 Bacteria 10942
34 Ga0075363_101034014 3300006048 Unclassified 507
35 Ga0070715_10511507 3300006163 Bacteria 689
36 Ga0070716_100960540 3300006173 Bacteria 673
37 Ga0075428_101471774 3300006844 Bacteria 714
38 Ga0075430_101127755 3300006846 Bacteria 646
39 Ga0075431_100229095 3300006847 Bacteria 1894
40 Ga0075434_100162514 3300006871 Bacteria 2253
41 Ga0075429_101494236 3300006880 Bacteria 588
42 Ga0068865_101393865 3300006881 Bacteria 626
43 Ga0097620_102439956 3300006931 Bacteria 576
44 Ga0111539_10033518 3300009094 Bacteria 6235
45 Ga0111539_10103493 3300009094 Bacteria 3341
46 Ga0111539_10806802 3300009094 Bacteria 1092
47 Ga0111539_12344399 3300009094 Bacteria 619
48 Ga0105245_10005584 3300009098 Bacteria 11052
49 Ga0105245_10310668 3300009098 Bacteria 1550
50 Ga0105245_13276324 3300009098 Unclassified 501
51 Ga0114129_10423916 3300009147 Bacteria 1749
52 Ga0114129_10724897 3300009147 Bacteria 1275
53 Ga0114129_11849974 3300009147 Bacteria 733
54 Ga0105243_10937915 3300009148 Bacteria 864
55 Ga0105243_12111097 3300009148 Bacteria 599
56 Ga0105242_12100341 3300009176 Bacteria 609
57 Ga0105248_12718323 3300009177 Bacteria 564
58 Ga0105238_12637540 3300009551 Bacteria 539
59 Ga0105249_10027570 3300009553 Bacteria 5125
60 Ga0105249_10560567 3300009553 Bacteria 1194
61 Ga0105239_10900344 3300010375 Bacteria 1016
62 Ga0105239_11390525 3300010375 Unclassified 810
63 Ga0105239_12785488 3300010375 Unclassified 571
64 Ga0157371_10180719 3300013102 Bacteria 1509
65 Ga0157371_11056804 3300013102 Unclassified 621
66 Ga0163162_10150678 3300013306 Bacteria 2443
67 Ga0157372_11004386 3300013307 Bacteria 966
68 Ga0157375_10221578 3300013308 Bacteria 2050
69 Ga0157377_10536137 3300014745 Bacteria 824
70 Ga0157377_11642837 3300014745 Unclassified 516
71 Ga0157379_11998955 3300014968 Unclassified 573
72 Ga0163161_10058640 3300017792 Bacteria 2798
73 Ga0206349_1070980 3300020075 Bacteria 1145
74 Ga0207688_10353628 3300025901 Bacteria 905
75 Ga0207699_10707237 3300025906 Bacteria 738
76 Ga0207645_10366720 3300025907 Bacteria 965
77 Ga0207654_10661028 3300025911 Bacteria 749
78 Ga0207662_11099406 3300025918 Bacteria 565
79 Ga0207657_10889964 3300025919 Bacteria 686
80 Ga0207687_10057456 3300025927 Bacteria 2734
81 Ga0207687_10343921 3300025927 Bacteria 1213
82 Ga0207686_11029172 3300025934 Bacteria 669
83 Ga0207704_11822581 3300025938 Unclassified 523
84 Ga0207661_10212538 3300025944 Bacteria 1706
85 Ga0207661_12054373 3300025944 Unclassified 517
86 Ga0207667_10471241 3300025949 Bacteria 1275
87 Ga0207712_10106170 3300025961 Bacteria 2097
88 Ga0207668_10018295 3300025972 Bacteria 4406
89 Ga0207703_11630050 3300026035 Unclassified 621
90 Ga0207639_12096323 3300026041 Bacteria 527
91 Ga0207708_10153495 3300026075 Bacteria 1815
92 Ga0207708_10203577 3300026075 Bacteria 1580
93 Ga0207708_10580671 3300026075 Unclassified 948
94 Ga0207702_10147027 3300026078 Bacteria 2140
95 Ga0207702_11208083 3300026078 Bacteria 750
96 Ga0207675_100002581 3300026118 Bacteria 17948
97 Ga0207683_10917719 3300026121 Bacteria 813
98 Ga0268265_11184991 3300028380 Bacteria 761
99 Ga0307405_10910146 3300031731 Unclassified 744
100 Ga0307406_10497149 3300031901 Bacteria 988
101 Ga0307416_101789127 3300032002 Bacteria 718
102 Ga0373958_0042830 3300034819 Bacteria 931
103 Ga0373949_0015263 3300035090 Bacteria 1714
104 Ga0373960_0040242 3300035121 Bacteria 1348
105 Ga0373942_0077375 3300035207 Bacteria 982
106 Ga0373942_0143599 3300035207 Bacteria 762
107 Ga0373961_0179258 3300035241 Bacteria 737
108 Ga0373931_0083849 3300035691 Bacteria 1764
109 Ga0373925_0165622 3300037068 Bacteria 1743
110 Ga0395905_1045746 3300037471 Bacteria 720
111 Ga0436364_1285858 3300037853 Bacteria 568
112 Ga0395901_1145359 3300038443 Bacteria 746
113 Ga0436363_0831197 3300039450 Bacteria 771
114 Ga0451833_0437727 3300041491 Bacteria 526
115 Ga0451833_1308260 3300041491 Bacteria 585
116 Ga0451853_0438888 3300041512 Bacteria 636
117 Ga0451853_1217194 3300041512 Bacteria 1081
118 Ga0466961_0213321 3300044693 Bacteria 1191
119 Ga0466961_0606070 3300044693 Bacteria 658
120 Ga0466957_1433826 3300044842 Bacteria 503
121 Ga0466960_0628181 3300044901 Bacteria 639
122 Ga0466959_0532604 3300045049 Bacteria 793
123 Ga0495603_0186927 3300046455 Bacteria 1198
124 Ga0495641_0039735 3300046461 Bacteria 2192
125 Ga0495585_0384238 3300046492 Unclassified 678
126 Ga0495594_0490733 3300046499 Bacteria 698
127 Ga0495596_0136466 3300046500 Bacteria 952
128 Ga0495616_0175453 3300046513 Bacteria 956
129 Ga0495631_0355770 3300046518 Bacteria 623
130 Ga0495644_0273404 3300046523 Bacteria 658
131 Ga0495663_0366475 3300046525 Bacteria 526
132 Ga0495609_0233186 3300046538 Bacteria 762
133 Ga0495656_0077470 3300046615 Bacteria 1492
134 Ga0495668_0212266 3300046616 Bacteria 1060
135 Ga0495588_0262710 3300046674 Bacteria 910
136 Ga0495669_0420842 3300046684 Bacteria 648
137 Ga0495589_0122262 3300046794 Bacteria 1253
138 Ga0495589_0535280 3300046794 Bacteria 534
139 Ga0495677_0424258 3300047445 Bacteria 527
140 Ga0495673_0271116 3300047469 Bacteria 615
141 Ga0495686_0503209 3300047472 Bacteria 638
142 Ga0496100_0248706 3300048903 Bacteria 1314
143 Ga0496100_0313929 3300048903 Bacteria 1176
144 Ga0496101_0007136 3300048904 Bacteria 7226
145 Ga0496102_0124658 3300048905 Bacteria 2407
146 Ga0496102_0229314 3300048905 Bacteria 1751
147 Ga0496102_0675570 3300048905 Bacteria 956
148 Ga0496102_0747189 3300048905 Bacteria 901
149 Ga0496103_0255255 3300048906 Bacteria 1128
150 Ga0496103_0763576 3300048906 Bacteria 611
151 Ga0496104_0120645 3300048907 Bacteria 2517
152 Ga0496105_0407091 3300048908 Bacteria 1079
153 Ga0496106_0153296 3300048909 Bacteria 1818
154 Ga0496106_0268398 3300048909 Bacteria 1366
155 Ga0496107_0004376 3300048910 Bacteria 9565
156 Ga0496107_0425341 3300048910 Bacteria 987
157 Ga0496108_0001486 3300048911 Bacteria 18524
158 Ga0496109_0001736 3300048912 Bacteria 18198
159 Ga0496109_0385867 3300048912 Bacteria 1323
160 Ga0496110_0010459 3300048913 Bacteria 7547
161 Ga0496110_0302603 3300048913 Bacteria 1456
162 Ga0496111_0016255 3300048914 Bacteria 5126
163 Ga0496111_0357740 3300048914 Bacteria 1080
164 Ga0496112_0331176 3300048915 Bacteria 1466
165 Ga0496113_0003624 3300048916 Bacteria 9282
166 Ga0496113_0377282 3300048916 Bacteria 1138
167 Ga0496114_0181173 3300048917 Bacteria 1840
168 Ga0496114_1564096 3300048917 Bacteria 547
169 Ga0496115_0011978 3300048918 Bacteria 6516
170 Ga0501068_0186177 3300049584 Bacteria 1314
171 nmdc:mga03n38_688657_c1 3300050490 Unclassified 588
172 nmdc:mga0yw44_280047_c1 3300050492 Bacteria 1114
173 nmdc:mga05p37_1491168_c1 3300050507 Bacteria 674
174 nmdc:mga05p37_1844461_c1 3300050507 Bacteria 581
175 nmdc:mga05p37_2182866_c1 3300050507 Bacteria 515
176 nmdc:mga06r32_217086_c1 3300050510 Bacteria 1900
177 nmdc:mga08y16_1066990_c1 3300050511 Bacteria 784
178 nmdc:mga08y16_144789_c1 3300050511 Bacteria 2470
179 nmdc:mga0n895_328600_c1 3300050512 Bacteria 1549
180 nmdc:mga0a205_1255070_c1 3300050515 Bacteria 589
181 Ga0495655_0097403 3300053083 Bacteria 866
182 Ga0501084_1227104 3300054114 Bacteria 629
183 Ga0501084_1448046 3300054114 Bacteria 575
184 Ga0182008_10832894
185 Ga0070683_101479896
186 Ga0070690_100327238
187 Ga0070682_100404390
188 Ga0070668_100078797
189 Ga0070669_100482851
190 Ga0070659_101507183
191 Ga0070659_101692990
192 Ga0070711_100397736
193 Ga0070700_100220476
194 Ga0070700_100890019
195 Ga0070663_101618049
196 Ga0070678_100574110
197 Ga0070662_100107735
198 Ga0070662_100687925
199 Ga0068867_100846017
200 Ga0070699_100602284
201 Ga0070684_101229344
202 Ga0070697_101725448
203 Ga0070696_100421829
204 Ga0070664_101469950
205 Ga0068854_101901862
206 Ga0068856_100043585
207 Ga0068856_100828754
208 Ga0068856_102106126
209 Ga0068859_102439913
210 Ga0068861_100032884
211 Ga0068862_100781863
212 Ga0081455_10071945
213 Ga0081455_10441775
214 Ga0081540_1005480
215 Ga0081540_1105966
216 Ga0081539_10006660
217 Ga0075363_101034014
218 Ga0070715_10511507
219 Ga0070716_100960540
220 Ga0075428_101471774
221 Ga0075430_101127755
222 Ga0075431_100229095
223 Ga0075434_100162514
224 Ga0075429_101494236
225 Ga0068865_101393865
226 Ga0097620_102439956
227 Ga0111539_10033518
228 Ga0111539_10103493
229 Ga0111539_10806802
230 Ga0111539_12344399
231 Ga0105245_10005584
232 Ga0105245_10310668
233 Ga0105245_13276324
234 Ga0114129_10423916
235 Ga0114129_10724897
236 Ga0114129_11849974
237 Ga0105243_10937915
238 Ga0105243_12111097
239 Ga0105242_12100341
240 Ga0105248_12718323
241 Ga0105238_12637540
242 Ga0105249_10027570
243 Ga0105249_10560567
244 Ga0105239_10900344
245 Ga0105239_11390525
246 Ga0105239_12785488
247 Ga0157371_10180719
248 Ga0157371_11056804
249 Ga0163162_10150678
250 Ga0157372_11004386
251 Ga0157375_10221578
252 Ga0157377_10536137
253 Ga0157377_11642837
254 Ga0157379_11998955
255 Ga0163161_10058640
256 Ga0206349_1070980
257 Ga0207688_10353628
258 Ga0207699_10707237
259 Ga0207645_10366720
260 Ga0207654_10661028
261 Ga0207662_11099406
262 Ga0207657_10889964
263 Ga0207687_10057456
264 Ga0207687_10343921
265 Ga0207686_11029172
266 Ga0207704_11822581
267 Ga0207661_10212538
268 Ga0207661_12054373
269 Ga0207667_10471241
270 Ga0207712_10106170
271 Ga0207668_10018295
272 Ga0207703_11630050
273 Ga0207639_12096323
274 Ga0207708_10153495
275 Ga0207708_10203577
276 Ga0207708_10580671
277 Ga0207702_10147027
278 Ga0207702_11208083
279 Ga0207675_100002581
280 Ga0207683_10917719
281 Ga0268265_11184991
282 Ga0307405_10910146
283 Ga0307406_10497149
284 Ga0307416_101789127
285 Ga0373958_0042830
286 Ga0373949_0015263
287 Ga0373960_0040242
288 Ga0373942_0077375
289 Ga0373942_0143599
290 Ga0373961_0179258
291 Ga0373931_0083849
292 Ga0373925_0165622
293 Ga0395905_1045746
294 Ga0436364_1285858
295 Ga0395901_1145359
296 Ga0436363_0831197
297 Ga0451833_0437727
298 Ga0451833_1308260
299 Ga0451853_0438888
300 Ga0451853_1217194
301 Ga0466961_0213321
302 Ga0466961_0606070
303 Ga0466957_1433826
304 Ga0466960_0628181
305 Ga0466959_0532604
306 Ga0495603_0186927
307 Ga0495641_0039735
308 Ga0495585_0384238
309 Ga0495594_0490733
310 Ga0495596_0136466
311 Ga0495616_0175453
312 Ga0495631_0355770
313 Ga0495644_0273404
314 Ga0495663_0366475
315 Ga0495609_0233186
316 Ga0495656_0077470
317 Ga0495668_0212266
318 Ga0495588_0262710
319 Ga0495669_0420842
320 Ga0495589_0122262
321 Ga0495589_0535280
322 Ga0495677_0424258
323 Ga0495673_0271116
324 Ga0495686_0503209
325 Ga0496100_0248706
326 Ga0496100_0313929
327 Ga0496101_0007136
328 Ga0496102_0124658
329 Ga0496102_0229314
330 Ga0496102_0675570
331 Ga0496102_0747189
332 Ga0496103_0255255
333 Ga0496103_0763576
334 Ga0496104_0120645
335 Ga0496105_0407091
336 Ga0496106_0153296
337 Ga0496106_0268398
338 Ga0496107_0004376
339 Ga0496107_0425341
340 Ga0496108_0001486
341 Ga0496109_0001736
342 Ga0496109_0385867
343 Ga0496110_0010459
344 Ga0496110_0302603
345 Ga0496111_0016255
346 Ga0496111_0357740
347 Ga0496112_0331176
348 Ga0496113_0003624
349 Ga0496113_0377282
350 Ga0496114_0181173
351 Ga0496114_1564096
352 Ga0496115_0011978
353 Ga0501068_0186177
354 nmdc:mga03n38_688657_c1
355 nmdc:mga0yw44_280047_c1
356 nmdc:mga05p37_1491168_c1
357 nmdc:mga05p37_1844461_c1
358 nmdc:mga05p37_2182866_c1
359 nmdc:mga06r32_217086_c1
360 nmdc:mga08y16_1066990_c1
361 nmdc:mga08y16_144789_c1
362 nmdc:mga0n895_328600_c1
363 nmdc:mga0a205_1255070_c1
364 Ga0495655_0097403
365 Ga0501084_1227104
366 Ga0501084_1448046

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ok0-assembly1.cif.gz_D cryo-em structure of the sulfolobus acidocaldarius rna polymerase at 2.88 a 0.8297 9 73
7oq4-assembly1.cif.gz_D cryo-em structure of the atv rnap inhibitory protein (rip) bound to the dna-binding channel of the host's rna polymerase 0.8136 9 73
8hil-assembly1.cif.gz_C a cryo-em structure of b. oleracea rna polymerase v at 3.57 angstrom 0.7919 7 73
7eu1-assembly1.cif.gz_C the cryo-em structure of a. thaliana pol iv-rdr2 holoenzyme 0.7903 7 73
2y0s-assembly2.cif.gz_D crystal structure of sulfolobus shibatae rna polymerase in p21 space group 0.7878 9 73
ID Description Score Start End Superfamily
af_Q46905_5_80_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7931 12 69 3.30.70.20
2y0sD03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7827 9 71 3.30.70.20
af_Q8IHT3_226_284_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7577 13 66 3.30.70.20
af_Q4DRD4_99_370_3.30.1360.10 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;RNA polymerase, RBP11-like subunit 0.7451 7 73 3.30.1360.10
2y0sD03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7251 9 71 3.30.70.20
ID Description Score Start End GO Terms
AF-A0A2T4UDQ8-F1-model_v4 4Fe-4S ferredoxin-type domain-containing protein 0.9774 9 82
AF-A0A538KXF8-F1-model_v4 Ferredoxin family protein 0.9718 7 80
AF-A0A5B8U4T3-F1-model_v4 4Fe-4S ferredoxin-type domain-containing protein 0.9652 7 82
AF-A0A538LMB1-F1-model_v4 Ferredoxin family protein 0.9488 7 82
AF-A0A2W6BSA5-F1-model_v4 4Fe-4S ferredoxin-type domain-containing protein 0.946 5 84

Map