F280811

General Info

Members Datasets Scaffolds Average Seq Length
183 123 183 127

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_11500482|Ga0105248_115004821
Length 128
Sequence MNPTQKLEGTKLANFTPLGAVTDLQIIDIVEGTGAVVPEGATITAHYTGALCGSGTIFQSSHDFGNDGITFGLNQVIAGWTKGVPGMKVGGTRRLVIPAVMAYGSRSPSSNIPPNSDLVFDIELLAIA

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
14 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
38 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
66 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
68 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
69 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
70 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
71 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
72 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
73 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
74 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
75 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
76 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
77 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
81 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
82 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
83 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
84 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
85 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
86 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
87 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
88 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
89 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
90 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
91 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
92 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
93 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
94 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
95 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
98 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
99 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
100 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
101 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
102 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
103 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
104 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
105 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
106 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
107 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
108 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
109 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
110 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
111 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
112 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
113 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
114 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
115 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
116 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
117 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
118 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
119 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
120 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
121 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
122 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
123 3300053738 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 35.52
Nodule 0
Rhizoplane 0.55
Rhizosphere 61.75
Stem 0
Stem Tuber 0
Unclassified 2.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10029962 3300001979 Bacteria 1779
2 JGI24744J21845_10042299 3300002077 Unclassified 851
3 rootL2_10289432 3300003322 Unclassified 2023
4 rootH1_10065833 3300003323 Bacteria 23418
5 Ga0070658_11783437 3300005327 Bacteria 532
6 Ga0070670_100008259 3300005331 Bacteria 8866
7 Ga0070682_100764991 3300005337 Bacteria 781
8 Ga0070682_101417991 3300005337 Bacteria 594
9 Ga0070660_100000786 3300005339 Bacteria 21098
10 Ga0070667_100000001 3300005367 Bacteria 1108638
11 Ga0070679_100552387 3300005530 Unclassified 1095
12 Ga0070684_100327243 3300005535 Bacteria 1408
13 Ga0068855_100019867 3300005563 Bacteria 8070
14 Ga0068855_101049122 3300005563 Bacteria 854
15 Ga0068857_100000147 3300005577 Bacteria 43506
16 Ga0068857_100072518 3300005577 Unclassified 3069
17 Ga0068854_100006324 3300005578 Bacteria 7533
18 Ga0068856_100167110 3300005614 Bacteria 2211
19 Ga0068852_100212646 3300005616 Bacteria 1835
20 Ga0068863_101387180 3300005841 Bacteria 710
21 Ga0068860_100004620 3300005843 Bacteria 14061
22 Ga0075365_10000238 3300006038 Bacteria 18824
23 Ga0075365_10010994 3300006038 Bacteria 5303
24 Ga0075365_10020417 3300006038 Unclassified 4107
25 Ga0075365_10081373 3300006038 Bacteria 2194
26 Ga0075365_10793705 3300006038 Unclassified 668
27 Ga0075365_10931415 3300006038 Unclassified 612
28 Ga0075368_10000223 3300006042 Bacteria 15924
29 Ga0075363_100008641 3300006048 Unclassified 4754
30 Ga0075364_10042400 3300006051 Bacteria 2956
31 Ga0075364_10334875 3300006051 Bacteria 1031
32 Ga0075364_10397467 3300006051 Bacteria 940
33 Ga0075364_10521421 3300006051 Bacteria 812
34 Ga0075367_10001907 3300006178 Unclassified 9250
35 Ga0075369_10000885 3300006186 Bacteria 9934
36 Ga0075366_10390380 3300006195 Bacteria 856
37 Ga0097621_100153385 3300006237 Unclassified 1976
38 Ga0075370_10003560 3300006353 Bacteria 7444
39 Ga0075370_10039392 3300006353 Unclassified 2662
40 Ga0075370_10439053 3300006353 Bacteria 785
41 Ga0075370_10458136 3300006353 Bacteria 768
42 Ga0068865_100006315 3300006881 Bacteria 7220
43 Ga0105240_10000003 3300009093 Bacteria 1183681
44 Ga0105240_10000004 3300009093 Bacteria 708156
45 Ga0105240_10003473 3300009093 Bacteria 24451
46 Ga0105245_10000122 3300009098 Bacteria 75415
47 Ga0105243_10000001 3300009148 Bacteria 1156578
48 Ga0105241_10015933 3300009174 Bacteria 5508
49 Ga0105242_10000064 3300009176 Bacteria 74150
50 Ga0105248_11500482 3300009177 Unclassified 763
51 Ga0105237_10000001 3300009545 Bacteria 1009213
52 Ga0105237_10026611 3300009545 Bacteria 5912
53 Ga0105238_10098622 3300009551 Bacteria 2906
54 Ga0105238_10765417 3300009551 Bacteria 980
55 Ga0105238_11063958 3300009551 Unclassified 831
56 Ga0105032_100001 3300009979 Bacteria 472394
57 Ga0105029_100112 3300009984 Bacteria 3979
58 Ga0105239_10027442 3300010375 Bacteria 6269
59 Ga0105239_10037705 3300010375 Bacteria 5297
60 Ga0157371_10435091 3300013102 Bacteria 963
61 Ga0157370_10003644 3300013104 Bacteria 18007
62 Ga0157370_10197426 3300013104 Unclassified 1867
63 Ga0157369_10000009 3300013105 Bacteria 303674
64 Ga0157369_10002816 3300013105 Bacteria 20752
65 Ga0157369_10047046 3300013105 Bacteria 4686
66 Ga0157369_10077069 3300013105 Bacteria 3573
67 Ga0157369_10097406 3300013105 Bacteria 3138
68 Ga0157374_10000934 3300013296 Bacteria 25443
69 Ga0157374_10547977 3300013296 Bacteria 1164
70 Ga0163162_10108917 3300013306 Unclassified 2867
71 Ga0157372_10000002 3300013307 Bacteria 687862
72 Ga0157372_10240898 3300013307 Bacteria 2099
73 Ga0157372_12112658 3300013307 Unclassified 647
74 Ga0207705_10920363 3300025909 Unclassified 677
75 Ga0207705_11234001 3300025909 Unclassified 573
76 Ga0207654_10169696 3300025911 Bacteria 1416
77 Ga0207654_10229484 3300025911 Unclassified 1235
78 Ga0207695_10000005 3300025913 Bacteria 1196715
79 Ga0207695_10000009 3300025913 Bacteria 1034276
80 Ga0207695_10006895 3300025913 Bacteria 14613
81 Ga0207671_10000003 3300025914 Bacteria 1065461
82 Ga0207671_10142428 3300025914 Unclassified 1848
83 Ga0207652_10253589 3300025921 Bacteria 1587
84 Ga0207694_10144769 3300025924 Bacteria 1912
85 Ga0207650_10112530 3300025925 Unclassified 2109
86 Ga0207687_10000111 3300025927 Bacteria 58083
87 Ga0207686_10000001 3300025934 Bacteria 1169580
88 Ga0207709_10000002 3300025935 Bacteria 1171536
89 Ga0207704_10639927 3300025938 Bacteria 875
90 Ga0207711_11455084 3300025941 Bacteria 628
91 Ga0207661_10328075 3300025944 Bacteria 1377
92 Ga0207667_10017822 3300025949 Bacteria 7984
93 Ga0207667_10590248 3300025949 Bacteria 1121
94 Ga0207667_11088727 3300025949 Bacteria 783
95 Ga0207640_10004542 3300025981 Bacteria 7534
96 Ga0207658_10000003 3300025986 Bacteria 1151934
97 Ga0207702_10248871 3300026078 Bacteria 1668
98 Ga0207702_10353379 3300026078 Bacteria 1407
99 Ga0207641_11322949 3300026088 Bacteria 721
100 Ga0207674_10000032 3300026116 Bacteria 142389
101 Ga0207674_11120918 3300026116 Bacteria 756
102 Ga0209813_10001209 3300027866 Bacteria 5764
103 Ga0268264_10004453 3300028381 Bacteria 11951
104 Ga0307517_10585481 3300028786 Unclassified 552
105 Ga0316177_1159686 3300030731 Unclassified 840
106 Ga0314311_1090285 3300030733 Bacteria 3528
107 Ga0316179_1118001 3300030734 Bacteria 18676
108 Ga0316180_1051764 3300030736 Bacteria 5444
109 Ga0316183_1065636 3300030742 Bacteria 1083
110 Ga0316183_1155050 3300030742 Bacteria 18039
111 Ga0316181_1027787 3300030744 Bacteria 826
112 Ga0316181_1080840 3300030744 Unclassified 907
113 Ga0316182_1038105 3300030745 Unclassified 572
114 Ga0316182_1059952 3300030745 Bacteria 8831
115 Ga0307405_10169450 3300031731 Bacteria 1556
116 Ga0307406_10000001 3300031901 Bacteria 638191
117 Ga0307412_10003213 3300031911 Bacteria 9088
118 Ga0395900_0000001 3300037418 Bacteria 931146
119 Ga0395898_0000002 3300037466 Bacteria 931013
120 Ga0395901_0000006 3300038443 Bacteria 514112
121 Ga0395901_0043147 3300038443 Bacteria 4679
122 Ga0439461_0001249 3300041410 Bacteria 3891
123 Ga0439431_0170970 3300041997 Unclassified 624
124 Ga0439432_001508 3300042006 Bacteria 8735
125 Ga0439446_0000001 3300042156 Bacteria 275840
126 Ga0439434_0295462 3300042435 Unclassified 559
127 Ga0439464_0120718 3300042439 Bacteria 807
128 Ga0450918_022579 3300042531 Bacteria 1099
129 Ga0495638_0000167 3300046460 Bacteria 102139
130 Ga0495597_0244260 3300046542 Unclassified 707
131 Ga0495634_0100874 3300046642 Bacteria 1865
132 Ga0495660_0000005 3300046810 Bacteria 574567
133 Ga0495672_0000016 3300047320 Bacteria 500601
134 Ga0496110_0750146 3300048913 Bacteria 879
135 Ga0496124_0087150 3300048927 Bacteria 2554
136 Ga0501034_0000241 3300049571 Bacteria 101160
137 Ga0501037_0000001 3300049573 Bacteria 753276
138 Ga0501038_0005765 3300049574 Bacteria 11468
139 nmdc:mga03683_77164_c1 3300050489 Bacteria 1433
140 nmdc:mga03n38_114087_c1 3300050490 Bacteria 1320
141 nmdc:mga00v17_120_c1 3300050491 Bacteria 46472
142 nmdc:mga00v17_451867_c1 3300050491 Bacteria 834
143 nmdc:mga00v17_474137_c1 3300050491 Bacteria 812
144 nmdc:mga0yw44_220771_c1 3300050492 Bacteria 1256
145 nmdc:mga0yw44_35952_c1 3300050492 Bacteria 2915
146 nmdc:mga0yw44_40024_c1 3300050492 Bacteria 2782
147 nmdc:mga0yw44_4_c1 3300050492 Bacteria 450247
148 nmdc:mga0yw44_53_c1 3300050492 Bacteria 40387
149 nmdc:mga0yw44_580776_c1 3300050492 Bacteria 761
150 nmdc:mga0yw44_656835_c1 3300050492 Bacteria 712
151 nmdc:mga0k408_434768_c1 3300050493 Bacteria 780
152 nmdc:mga06z11_198_c1 3300050494 Bacteria 24266
153 nmdc:mga04h51_375_c1 3300050495 Bacteria 10921
154 nmdc:mga07m45_117396_c1 3300050496 Bacteria 1535
155 nmdc:mga07m45_5989_c1 3300050496 Bacteria 6114
156 nmdc:mga0sz30_3303_c1 3300050516 Bacteria 5802
157 Ga0500643_009482 3300053087 Bacteria 3717
158 Ga0500644_0002594 3300053088 Bacteria 4515
159 Ga0500644_0033806 3300053088 Bacteria 1645
160 Ga0500646_0000011 3300053090 Bacteria 87823
161 Ga0500646_0085431 3300053090 Unclassified 969
162 Ga0500583_0000493 3300053092 Bacteria 12130
163 Ga0500583_0471355 3300053092 Bacteria 593
164 Ga0500651_0000001 3300053093 Bacteria 529808
165 Ga0500641_0000001 3300053096 Bacteria 1115973
166 Ga0500650_0039858 3300053098 Bacteria 2166
167 Ga0500650_0122110 3300053098 Bacteria 1214
168 Ga0500593_028275 3300053117 Unclassified 2505
169 Ga0500594_0000044 3300053118 Bacteria 39879
170 Ga0500652_000001 3300053131 Bacteria 946868
171 Ga0500652_157207 3300053131 Bacteria 941
172 Ga0500568_0016510 3300053139 Bacteria 3280
173 Ga0500568_0037006 3300053139 Bacteria 1982
174 Ga0500577_0033084 3300053142 Unclassified 1824
175 Ga0500616_0000012 3300053153 Bacteria 681798
176 Ga0500616_0008863 3300053153 Bacteria 6182
177 Ga0500616_0039870 3300053153 Bacteria 2529
178 Ga0500620_001512 3300053155 Bacteria 4334
179 Ga0500620_091744 3300053155 Bacteria 1059
180 Ga0500570_102103 3300053724 Bacteria 1200
181 Ga0500570_229261 3300053724 Bacteria 520
182 Ga0500656_019774 3300053732 Bacteria 825
183 Ga0500613_003109 3300053738 Bacteria 1401

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300030742 Ga0316183_1065636 Ga0316183_10656362 115
2 3300005563 Ga0068855_101049122 Ga0068855_1010491222 116
3 3300006051 Ga0075364_10521421 Ga0075364_105214211 116
4 3300006237 Ga0097621_100153385 Ga0097621_1001533853 116
5 3300006881 Ga0068865_100006315 Ga0068865_1000063159 116
6 3300009093 Ga0105240_10000003 Ga0105240_10000003761 116
7 3300009098 Ga0105245_10000122 Ga0105245_1000012260 116
8 3300009148 Ga0105243_10000001 Ga0105243_10000001531 116
9 3300009176 Ga0105242_10000064 Ga0105242_1000006453 116
10 3300009545 Ga0105237_10026611 Ga0105237_100266113 116
11 3300010375 Ga0105239_10027442 Ga0105239_100274423 116
12 3300013296 Ga0157374_10000934 Ga0157374_100009342 116
13 3300013306 Ga0163162_10108917 Ga0163162_101089173 116
14 3300025913 Ga0207695_10000005 Ga0207695_10000005770 116
15 3300025914 Ga0207671_10142428 Ga0207671_101424283 116
16 3300025927 Ga0207687_10000111 Ga0207687_1000011131 116
17 3300025934 Ga0207686_10000001 Ga0207686_10000001611 116
18 3300025935 Ga0207709_10000002 Ga0207709_10000002729 116
19 3300025938 Ga0207704_10639927 Ga0207704_106399272 116
20 3300025949 Ga0207667_11088727 Ga0207667_110887272 116
21 3300050491 nmdc:mga00v17_474137_c1 nmdc:mga00v17_474137_c1_398_757 116
22 3300005841 Ga0068863_101387180 Ga0068863_1013871802 119
23 3300009551 Ga0105238_11063958 Ga0105238_110639581 119
24 3300025941 Ga0207711_11455084 Ga0207711_114550842 119
25 3300025949 Ga0207667_10590248 Ga0207667_105902482 119
26 3300026088 Ga0207641_11322949 Ga0207641_113229491 119
27 3300026116 Ga0207674_11120918 Ga0207674_111209182 119
28 3300002077 JGI24744J21845_10042299 JGI24744J21845_100422992 123
29 3300005577 Ga0068857_100000147 Ga0068857_10000014749 123
30 3300009174 Ga0105241_10015933 Ga0105241_100159332 123
31 3300025911 Ga0207654_10169696 Ga0207654_101696962 123
32 3300026116 Ga0207674_10000032 Ga0207674_1000003291 123
33 3300031901 Ga0307406_10000001 Ga0307406_10000001625 123
34 3300037418 Ga0395900_0000001 Ga0395900_0000001_435878_436252 123
35 3300037466 Ga0395898_0000002 Ga0395898_0000002_669754_670128 123
36 3300038443 Ga0395901_0000006 Ga0395901_0000006_315430_315804 124
37 3300038443 Ga0395901_0043147 Ga0395901_0043147_673_1056 124
38 3300025909 Ga0207705_10920363 Ga0207705_109203632 125
39 3300042531 Ga0450918_022579 Ga0450918_022579_219_596 125
40 3300046460 Ga0495638_0000167 Ga0495638_0000167_59032_59409 125
41 3300003323 rootH1_10065833 rootH1_1006583332 126
42 3300005339 Ga0070660_100000786 Ga0070660_10000078637 126
43 3300005616 Ga0068852_100212646 Ga0068852_1002126462 126
44 3300006038 Ga0075365_10793705 Ga0075365_107937051 126
45 3300009093 Ga0105240_10000004 Ga0105240_10000004315 126
46 3300009545 Ga0105237_10000001 Ga0105237_10000001747 126
47 3300009551 Ga0105238_10098622 Ga0105238_100986222 126
48 3300009979 Ga0105032_100001 Ga0105032_100001206 126
49 3300013104 Ga0157370_10003644 Ga0157370_1000364420 126
50 3300013307 Ga0157372_10000002 Ga0157372_10000002292 126
51 3300025913 Ga0207695_10000009 Ga0207695_10000009694 126
52 3300025914 Ga0207671_10000003 Ga0207671_10000003750 126
53 3300025924 Ga0207694_10144769 Ga0207694_101447692 126
54 3300026078 Ga0207702_10353379 Ga0207702_103533791 126
55 3300046542 Ga0495597_0244260 Ga0495597_0244260_64_444 126
56 3300050492 nmdc:mga0yw44_220771_c1 nmdc:mga0yw44_220771_c1_200_580 126
57 3300050492 nmdc:mga0yw44_656835_c1 nmdc:mga0yw44_656835_c1_117_497 126
58 3300053732 Ga0500656_019774 Ga0500656_019774_190_570 126
59 3300005327 Ga0070658_11783437 Ga0070658_117834371 127
60 3300005331 Ga0070670_100008259 Ga0070670_1000082594 127
61 3300005337 Ga0070682_100764991 Ga0070682_1007649911 127
62 3300005367 Ga0070667_100000001 Ga0070667_100000001690 127
63 3300005530 Ga0070679_100552387 Ga0070679_1005523871 127
64 3300005535 Ga0070684_100327243 Ga0070684_1003272433 127
65 3300005577 Ga0068857_100072518 Ga0068857_1000725181 127
66 3300005614 Ga0068856_100167110 Ga0068856_1001671103 127
67 3300005843 Ga0068860_100004620 Ga0068860_1000046202 127
68 3300006038 Ga0075365_10081373 Ga0075365_100813732 127
69 3300006195 Ga0075366_10390380 Ga0075366_103903801 127
70 3300006353 Ga0075370_10003560 Ga0075370_100035603 127
71 3300006353 Ga0075370_10439053 Ga0075370_104390532 127
72 3300006353 Ga0075370_10458136 Ga0075370_104581362 127
73 3300009177 Ga0105248_11500482 Ga0105248_115004821 127
74 3300013102 Ga0157371_10435091 Ga0157371_104350911 127
75 3300013307 Ga0157372_12112658 Ga0157372_121126581 127
76 3300025909 Ga0207705_11234001 Ga0207705_112340011 127
77 3300025921 Ga0207652_10253589 Ga0207652_102535892 127
78 3300025925 Ga0207650_10112530 Ga0207650_101125303 127
79 3300025944 Ga0207661_10328075 Ga0207661_103280752 127
80 3300025986 Ga0207658_10000003 Ga0207658_10000003690 127
81 3300026078 Ga0207702_10248871 Ga0207702_102488712 127
82 3300028381 Ga0268264_10004453 Ga0268264_1000445311 127
83 3300030731 Ga0316177_1159686 Ga0316177_11596862 127
84 3300030733 Ga0314311_1090285 Ga0314311_10902852 127
85 3300030734 Ga0316179_1118001 Ga0316179_11180018 127
86 3300030736 Ga0316180_1051764 Ga0316180_10517649 127
87 3300030742 Ga0316183_1155050 Ga0316183_115505017 127
88 3300030744 Ga0316181_1027787 Ga0316181_10277872 127
89 3300030745 Ga0316182_1038105 Ga0316182_10381052 127
90 3300030745 Ga0316182_1059952 Ga0316182_10599528 127
91 3300031731 Ga0307405_10169450 Ga0307405_101694501 127
92 3300031911 Ga0307412_10003213 Ga0307412_100032135 127
93 3300048913 Ga0496110_0750146 Ga0496110_0750146_294_680 127
94 3300048927 Ga0496124_0087150 Ga0496124_0087150_580_963 127
95 3300050492 nmdc:mga0yw44_40024_c1 nmdc:mga0yw44_40024_c1_1804_2187 127
96 3300050492 nmdc:mga0yw44_580776_c1 nmdc:mga0yw44_580776_c1_12_398 127
97 3300050493 nmdc:mga0k408_434768_c1 nmdc:mga0k408_434768_c1_381_764 127
98 3300050496 nmdc:mga07m45_117396_c1 nmdc:mga07m45_117396_c1_772_1155 127
99 3300053087 Ga0500643_009482 Ga0500643_009482_32_418 127
100 3300053093 Ga0500651_0000001 Ga0500651_0000001_260423_260806 127
101 3300053118 Ga0500594_0000044 Ga0500594_0000044_109_492 127
102 3300053139 Ga0500568_0016510 Ga0500568_0016510_401_784 127
103 3300053139 Ga0500568_0037006 Ga0500568_0037006_666_1049 127
104 3300053142 Ga0500577_0033084 Ga0500577_0033084_468_851 127
105 3300053153 Ga0500616_0000012 Ga0500616_0000012_469172_469555 127
106 3300053155 Ga0500620_091744 Ga0500620_091744_264_647 127
107 3300053724 Ga0500570_229261 Ga0500570_229261_49_432 127
108 3300003322 rootL2_10289432 rootL2_102894323 128
109 3300005337 Ga0070682_101417991 Ga0070682_1014179911 128
110 3300009093 Ga0105240_10003473 Ga0105240_1000347316 128
111 3300009551 Ga0105238_10765417 Ga0105238_107654172 128
112 3300010375 Ga0105239_10037705 Ga0105239_100377054 128
113 3300025913 Ga0207695_10006895 Ga0207695_1000689515 128
114 3300046810 Ga0495660_0000005 Ga0495660_0000005_40322_40711 128
115 3300053088 Ga0500644_0002594 Ga0500644_0002594_3784_4191 128
116 3300053090 Ga0500646_0000011 Ga0500646_0000011_29455_29844 128
117 3300053092 Ga0500583_0000493 Ga0500583_0000493_454_861 128
118 3300053096 Ga0500641_0000001 Ga0500641_0000001_163658_164065 128
119 3300053098 Ga0500650_0122110 Ga0500650_0122110_626_1033 128
120 3300053131 Ga0500652_000001 Ga0500652_000001_198407_198814 128
121 3300053155 Ga0500620_001512 Ga0500620_001512_3790_4197 128
122 3300053724 Ga0500570_102103 Ga0500570_102103_151_537 128
123 3300001979 JGI24740J21852_10029962 JGI24740J21852_100299622 129
124 3300005563 Ga0068855_100019867 Ga0068855_1000198676 129
125 3300005578 Ga0068854_100006324 Ga0068854_1000063246 129
126 3300006038 Ga0075365_10000238 Ga0075365_1000023816 129
127 3300006038 Ga0075365_10010994 Ga0075365_100109942 129
128 3300006038 Ga0075365_10020417 Ga0075365_100204174 129
129 3300006038 Ga0075365_10931415 Ga0075365_109314151 129
130 3300006042 Ga0075368_10000223 Ga0075368_100002239 129
131 3300006048 Ga0075363_100008641 Ga0075363_1000086414 129
132 3300006051 Ga0075364_10042400 Ga0075364_100424004 129
133 3300006051 Ga0075364_10334875 Ga0075364_103348752 129
134 3300006051 Ga0075364_10397467 Ga0075364_103974672 129
135 3300006178 Ga0075367_10001907 Ga0075367_100019077 129
136 3300006186 Ga0075369_10000885 Ga0075369_100008852 129
137 3300006353 Ga0075370_10039392 Ga0075370_100393924 129
138 3300009984 Ga0105029_100112 Ga0105029_1001127 129
139 3300013104 Ga0157370_10197426 Ga0157370_101974262 129
140 3300013105 Ga0157369_10000009 Ga0157369_10000009338 129
141 3300013105 Ga0157369_10002816 Ga0157369_1000281610 129
142 3300013105 Ga0157369_10047046 Ga0157369_100470467 129
143 3300013105 Ga0157369_10077069 Ga0157369_100770694 129
144 3300013105 Ga0157369_10097406 Ga0157369_100974064 129
145 3300013296 Ga0157374_10547977 Ga0157374_105479773 129
146 3300013307 Ga0157372_10240898 Ga0157372_102408982 129
147 3300025911 Ga0207654_10229484 Ga0207654_102294843 129
148 3300025949 Ga0207667_10017822 Ga0207667_100178226 129
149 3300025981 Ga0207640_10004542 Ga0207640_100045426 129
150 3300027866 Ga0209813_10001209 Ga0209813_100012097 129
151 3300028786 Ga0307517_10585481 Ga0307517_105854811 129
152 3300030744 Ga0316181_1080840 Ga0316181_10808402 129
153 3300041410 Ga0439461_0001249 Ga0439461_0001249_941_1330 129
154 3300041997 Ga0439431_0170970 Ga0439431_0170970_28_417 129
155 3300042006 Ga0439432_001508 Ga0439432_001508_2105_2497 129
156 3300042156 Ga0439446_0000001 Ga0439446_0000001_87059_87448 129
157 3300042435 Ga0439434_0295462 Ga0439434_0295462_13_402 129
158 3300042439 Ga0439464_0120718 Ga0439464_0120718_302_691 129
159 3300046642 Ga0495634_0100874 Ga0495634_0100874_355_747 129
160 3300047320 Ga0495672_0000016 Ga0495672_0000016_383418_383813 129
161 3300049571 Ga0501034_0000241 Ga0501034_0000241_29343_29732 129
162 3300049573 Ga0501037_0000001 Ga0501037_0000001_268413_268802 129
163 3300049574 Ga0501038_0005765 Ga0501038_0005765_7173_7562 129
164 3300050489 nmdc:mga03683_77164_c1 nmdc:mga03683_77164_c1_334_723 129
165 3300050490 nmdc:mga03n38_114087_c1 nmdc:mga03n38_114087_c1_106_495 129
166 3300050491 nmdc:mga00v17_120_c1 nmdc:mga00v17_120_c1_38014_38403 129
167 3300050491 nmdc:mga00v17_451867_c1 nmdc:mga00v17_451867_c1_238_630 129
168 3300050492 nmdc:mga0yw44_35952_c1 nmdc:mga0yw44_35952_c1_1009_1398 129
169 3300050492 nmdc:mga0yw44_4_c1 nmdc:mga0yw44_4_c1_309098_309487 129
170 3300050492 nmdc:mga0yw44_53_c1 nmdc:mga0yw44_53_c1_17742_18131 129
171 3300050494 nmdc:mga06z11_198_c1 nmdc:mga06z11_198_c1_1841_2230 129
172 3300050495 nmdc:mga04h51_375_c1 nmdc:mga04h51_375_c1_10503_10892 129
173 3300050496 nmdc:mga07m45_5989_c1 nmdc:mga07m45_5989_c1_2675_3064 129
174 3300050516 nmdc:mga0sz30_3303_c1 nmdc:mga0sz30_3303_c1_4669_5058 129
175 3300053088 Ga0500644_0033806 Ga0500644_0033806_531_920 129
176 3300053090 Ga0500646_0085431 Ga0500646_0085431_77_466 129
177 3300053092 Ga0500583_0471355 Ga0500583_0471355_113_502 129
178 3300053098 Ga0500650_0039858 Ga0500650_0039858_111_500 129
179 3300053117 Ga0500593_028275 Ga0500593_028275_1008_1397 129
180 3300053131 Ga0500652_157207 Ga0500652_157207_104_493 129
181 3300053153 Ga0500616_0008863 Ga0500616_0008863_4717_5106 129
182 3300053153 Ga0500616_0039870 Ga0500616_0039870_1684_2073 129
183 3300053738 Ga0500613_003109 Ga0500613_003109_659_1048 129

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00254

FKBP_C

FKBP-type peptidyl-prolyl cis-trans isomerase

34

125

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ggq-assembly3.cif.gz_B crystal structure of a smt fusion peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei complexed with cj40 0.9578 26 127
5klx-assembly1.cif.gz_A crystal structure of smt fusion peptidyl-prolyl cis-trans isomerase from burkholderia pseudomallei complexed with sf110 0.9535 26 127
4dz2-assembly1.cif.gz_A crystal structure of a peptidyl-prolyl cis-trans isomerase with surface mutation r92g from burkholderia pseudomallei complexed with fk506 0.9516 26 127
4dz3-assembly1.cif.gz_B crystal structure of a peptidyl-prolyl cis-trans isomerase with surface mutation m61h from burkholderia pseudomallei complexed with fk506 0.9511 26 127
3uf8-assembly1.cif.gz_A crystal structure of a smt fusion peptidyl-prolyl cis-trans isomerase with a g95a surface mutation from burkholderia pseudomallei complexed with fk506 0.9498 26 127
ID Description Score Start End Superfamily
5xb0A02 Alpha Beta;Roll;Chitinase A; domain 3; 0.9405 26 129 3.10.50.40
af_B0G119_2_111_3.10.50.40 Alpha Beta;Roll;Chitinase A; domain 3; 0.9372 24 128 3.10.50.40
5huaA00 Alpha Beta;Roll;Chitinase A; domain 3; 0.9359 26 129 3.10.50.40
af_Q66H94_147_254_3.10.50.40 Alpha Beta;Roll;Chitinase A; domain 3; 0.934 25 129 3.10.50.40
3ni6A01 Alpha Beta;Roll;Chitinase A; domain 3; 0.9289 25 129 3.10.50.40
ID Description Score Start End GO Terms
AF-A0A1F7QR05-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 0.9979 10 129 GO:0140839
GO:0140840
AF-A0A5C7J6H8-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 0.9972 8 129 GO:0140839
GO:0140840
AF-A0A7W4EDZ3-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 0.9917 6 129 GO:0003755
AF-A0A3M8FY20-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 0.9856 24 129 GO:0140839
GO:0140840
AF-A0A7W4EDZ3-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8) 0.9838 6 129 GO:0003755

Feature Viewer

pLDDT pTM Quality
94.74 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map