F280800

General Info

Members Datasets Scaffolds Average Seq Length
183 133 366 449

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10035553|Ga0105242_100355533
Length 512
Sequence MGFVDLWKWEGKAGRRRYALVGLIGFAIKHNIDRLIAASFFKTSQRDVVGYWFNYWAPLGNAARLGHLSPTEAKFLTTMLVLSLPFIWIGMTMTLRRLRDAGQPLWLVTLFFVPFVNLPFFLTLCALPSRERAIESEAAPWPGVRPLDVIIPRSRLGSGVLAIVVTTAIGLVFSVFGATVIGAYGWSLFVALPFCLGLFSVLFYSYHAPRELGECMTVSLIPIGILGVALMAIAVEGVICLMMAAPLGLALSAFGGAIGYHLQARHWRTASPAMMCIALLAVPALFSAERAAGLPPPKYVVRSAIEINAPPETVWKQVVAFAEIPPPREILFRAGIAYPIRAEISGRGPGAIRRCVFSTGPFVEPIEVWDEPRLLRFGVLEVPTPLNELTPYGHIEPRHLHGYFVSERGQFQLTELPAGRTRLEGTTWYRDAIWPAAYWRAWSDYIIHRIHMRVLEHIKTETEESVGRSADGYRNAQSHRHFVDAQTKGNQELFAENFSRMYRLKLLWHLPS

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
79 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
89 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
90 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
91 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
98 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
99 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
102 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
103 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
104 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
105 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
106 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
107 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
108 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
109 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
110 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
111 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
112 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
115 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
116 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
117 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
118 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
119 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
120 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
121 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
122 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
123 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
124 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
125 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
126 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
127 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
128 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
129 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
130 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
131 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
132 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
133 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.91
Metatranscriptomes 1.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.28
Rhizosphere 93.99
Stem 0
Stem Tuber 0
Unclassified 18.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10035553 3300009176 Bacteria 3994
2 JGI24751J29686_10000071 3300002459 Bacteria 58417
3 Ga0065715_10004815 3300005293 Unclassified 4669
4 Ga0070670_100001555 3300005331 Bacteria 18491
5 Ga0070670_100003029 3300005331 Bacteria 13901
6 Ga0068868_100000310 3300005338 Bacteria 32647
7 Ga0070689_100108306 3300005340 Unclassified 2207
8 Ga0070688_100027623 3300005365 Unclassified 3380
9 Ga0070714_100045330 3300005435 Bacteria 3727
10 Ga0070713_100012378 3300005436 Bacteria 6254
11 Ga0070711_100009114 3300005439 Bacteria 6099
12 Ga0070700_100000079 3300005441 Bacteria 64802
13 Ga0070708_100007955 3300005445 Bacteria 8492
14 Ga0070708_100008666 3300005445 Bacteria 8173
15 Ga0070706_100000406 3300005467 Bacteria 51991
16 Ga0070706_100076718 3300005467 Bacteria 3093
17 Ga0070707_100002663 3300005468 Bacteria 16974
18 Ga0070707_100092165 3300005468 Bacteria 2934
19 Ga0070707_100203230 3300005468 Archaea 1931
20 Ga0070698_100004166 3300005471 Bacteria 15899
21 Ga0070698_100054133 3300005471 Bacteria 4076
22 Ga0070699_100014456 3300005518 Bacteria 6788
23 Ga0070699_100044889 3300005518 Bacteria 3826
24 Ga0070679_100087918 3300005530 Bacteria 3095
25 Ga0070697_100000305 3300005536 Bacteria 39083
26 Ga0070697_100002835 3300005536 Bacteria 13333
27 Ga0070697_100010862 3300005536 Bacteria 7111
28 Ga0070697_100013401 3300005536 Bacteria 6430
29 Ga0070697_100062067 3300005536 Unclassified 3049
30 Ga0070697_100113371 3300005536 Bacteria 2262
31 Ga0070695_100002048 3300005545 Bacteria 11524
32 Ga0070696_100001596 3300005546 Bacteria 14870
33 Ga0070693_100000744 3300005547 Bacteria 14367
34 Ga0070704_100012802 3300005549 Bacteria 5187
35 Ga0068855_100130841 3300005563 Bacteria 2866
36 Ga0068856_100048857 3300005614 Bacteria 4170
37 Ga0070702_100044744 3300005615 Bacteria 2501
38 Ga0068859_100040480 3300005617 Bacteria 4678
39 Ga0068859_100112357 3300005617 Unclassified 2787
40 Ga0068859_100150223 3300005617 Bacteria 2405
41 Ga0068859_100224097 3300005617 Unclassified 1968
42 Ga0068861_100024820 3300005719 Unclassified 4340
43 Ga0068863_100016206 3300005841 Bacteria 7150
44 Ga0068858_100074456 3300005842 Unclassified 3153
45 Ga0068860_100075261 3300005843 Unclassified 3211
46 Ga0068862_100063612 3300005844 Unclassified 3174
47 Ga0070712_100158041 3300006175 Bacteria 1748
48 Ga0097621_100003362 3300006237 Bacteria 11007
49 Ga0097621_100072934 3300006237 Unclassified 2841
50 Ga0075433_10016670 3300006852 Bacteria 6064
51 Ga0075434_100054936 3300006871 Bacteria 3957
52 Ga0075436_100007209 3300006914 Bacteria 7607
53 Ga0097620_100040480 3300006931 Bacteria 4678
54 Ga0097620_100112355 3300006931 Unclassified 2787
55 Ga0097620_100150225 3300006931 Bacteria 2405
56 Ga0097620_100224090 3300006931 Unclassified 1968
57 Ga0075435_100023418 3300007076 Bacteria 4777
58 Ga0075435_100080831 3300007076 Bacteria 2669
59 Ga0099794_10011315 3300007265 Bacteria 3816
60 Ga0099794_10014526 3300007265 Bacteria 3452
61 Ga0099794_10015127 3300007265 Bacteria 3399
62 Ga0099794_10020427 3300007265 Bacteria 2997
63 Ga0099794_10033255 3300007265 Unclassified 2424
64 Ga0099794_10066804 3300007265 Unclassified 1755
65 Ga0105240_10371065 3300009093 Bacteria 1618
66 Ga0105245_10000013 3300009098 Bacteria 266248
67 Ga0105241_10001302 3300009174 Bacteria 18979
68 Ga0105241_10056998 3300009174 Bacteria 2996
69 Ga0105241_10330658 3300009174 Unclassified 1317
70 Ga0105248_10000847 3300009177 Bacteria 34381
71 Ga0105248_10085610 3300009177 Unclassified 3547
72 Ga0105237_10109146 3300009545 Bacteria 2759
73 Ga0105238_10000001 3300009551 Bacteria 2036163
74 Ga0105238_10011099 3300009551 Bacteria 9055
75 Ga0105249_10037575 3300009553 Bacteria 4395
76 Ga0157373_10008148 3300013100 Bacteria 7793
77 Ga0157373_10079160 3300013100 Bacteria 2318
78 Ga0157374_10000010 3300013296 Bacteria 505635
79 Ga0157378_10000137 3300013297 Bacteria 69371
80 Ga0157378_10149557 3300013297 Bacteria 2175
81 Ga0163162_10045177 3300013306 Bacteria 4413
82 Ga0163162_10062299 3300013306 Bacteria 3770
83 Ga0163162_10071572 3300013306 Bacteria 3521
84 Ga0157372_10048785 3300013307 Bacteria 4706
85 Ga0157372_10129031 3300013307 Unclassified 2908
86 Ga0157375_10000260 3300013308 Bacteria 47918
87 Ga0163163_10000994 3300014325 Bacteria 23984
88 Ga0163163_10086029 3300014325 Bacteria 3152
89 Ga0157377_10000015 3300014745 Bacteria 190735
90 Ga0157379_10029991 3300014968 Bacteria 4837
91 Ga0157376_10000019 3300014969 Bacteria 255553
92 Ga0157376_10000038 3300014969 Bacteria 134733
93 Ga0157376_10000160 3300014969 Bacteria 46966
94 Ga0157376_10032182 3300014969 Bacteria 4208
95 Ga0207684_10023648 3300025910 Bacteria 5245
96 Ga0207684_10048222 3300025910 Bacteria 3612
97 Ga0207693_10015614 3300025915 Bacteria 6089
98 Ga0207652_10067288 3300025921 Bacteria 3106
99 Ga0207646_10000274 3300025922 Bacteria 70391
100 Ga0207694_10000001 3300025924 Bacteria 4078485
101 Ga0207694_10006513 3300025924 Bacteria 8885
102 Ga0207650_10000017 3300025925 Bacteria 354674
103 Ga0207650_10000284 3300025925 Bacteria 52149
104 Ga0207687_10000014 3300025927 Bacteria 297704
105 Ga0207686_10109631 3300025934 Bacteria 1859
106 Ga0207670_10062730 3300025936 Unclassified 2541
107 Ga0207665_10001051 3300025939 Bacteria 18583
108 Ga0207665_10003035 3300025939 Bacteria 11266
109 Ga0207665_10063418 3300025939 Unclassified 2510
110 Ga0207711_10032585 3300025941 Bacteria 4406
111 Ga0207689_10109316 3300025942 Unclassified 2272
112 Ga0207712_10005767 3300025961 Bacteria 7803
113 Ga0207677_10000310 3300026023 Bacteria 35796
114 Ga0207708_10000057 3300026075 Bacteria 97103
115 Ga0207708_10134475 3300026075 Unclassified 1936
116 Ga0207702_10139999 3300026078 Bacteria 2188
117 Ga0207641_10004305 3300026088 Bacteria 12364
118 Ga0207641_10024251 3300026088 Bacteria 5001
119 Ga0207675_100027202 3300026118 Bacteria 5327
120 Ga0209588_1004470 3300027671 Bacteria 3946
121 Ga0265354_1001840 3300028016 Bacteria 2852
122 Ga0268264_10014497 3300028381 Bacteria 6477
123 Ga0268264_10060969 3300028381 Unclassified 3163
124 Ga0307511_10013232 3300030521 Bacteria 8065
125 Ga0265770_1002286 3300030878 Bacteria 2606
126 Ga0265760_10006151 3300031090 Bacteria 3430
127 Ga0307513_10010586 3300031456 Bacteria 11537
128 Ga0307408_100013904 3300031548 Bacteria 5345
129 Ga0307410_10046402 3300031852 Bacteria 2898
130 Ga0307409_100184304 3300031995 Bacteria 1851
131 Ga0307416_100088399 3300032002 Bacteria 2649
132 Ga0307411_10029519 3300032005 Bacteria 3350
133 Ga0307415_100106198 3300032126 Bacteria 2072
134 Ga0316212_1004235 3300033547 Unclassified 2080
135 Ga0373941_0019810 3300035115 Unclassified 1879
136 Ga0373931_0020196 3300035691 Bacteria 3331
137 Ga0373931_0029347 3300035691 Bacteria 2823
138 Ga0373935_0032677 3300035692 Bacteria 3234
139 Ga0373927_0045376 3300035695 Bacteria 2843
140 Ga0373947_0049935 3300035725 Bacteria 2514
141 Ga0373937_0026278 3300036401 Unclassified 5261
142 Ga0373925_0018672 3300037068 Bacteria 5041
143 Ga0436365_0706047 3300039437 Unclassified 1906
144 Ga0451839_1330129 3300041496 Bacteria 4204
145 Ga0439458_0001171 3300042157 Bacteria 6658
146 Ga0495592_0005305 3300046454 Bacteria 9503
147 Ga0495603_0049209 3300046455 Unclassified 2509
148 Ga0495580_0015641 3300046472 Bacteria 5717
149 Ga0495582_0007256 3300046473 Bacteria 6145
150 Ga0495582_0043730 3300046473 Bacteria 2466
151 Ga0495639_0025209 3300046475 Unclassified 2622
152 Ga0495664_0025417 3300046477 Bacteria 3448
153 Ga0495647_0006022 3300046681 Bacteria 3998
154 Ga0495658_0009694 3300046683 Bacteria 4802
155 Ga0495613_0022393 3300046689 Bacteria 4709
156 Ga0495613_0044609 3300046689 Bacteria 3279
157 Ga0495581_0082711 3300047315 Unclassified 1859
158 Ga0495674_0030542 3300047319 Bacteria 4899
159 Ga0495684_0037840 3300047471 Unclassified 3701
160 Ga0496101_0101898 3300048904 Archaea 2150
161 Ga0496102_0004628 3300048905 Bacteria 11645
162 Ga0496112_0124555 3300048915 Bacteria 2548
163 Ga0496114_0030051 3300048917 Bacteria 4468
164 Ga0496115_0020410 3300048918 Bacteria 5112
165 Ga0496115_0021844 3300048918 Bacteria 4948
166 Ga0501198_003537 3300049649 Bacteria 2138
167 Ga0501209_015568 3300049656 Bacteria 1699
168 Ga0501217_001104 3300049661 Bacteria 4922
169 Ga0501223_012303 3300049663 Bacteria 1712
170 Ga0501224_002023 3300049664 Bacteria 2745
171 Ga0501227_007190 3300049665 Bacteria 2381
172 Ga0501233_008617 3300049668 Bacteria 1970
173 Ga0501235_003871 3300049669 Bacteria 3234
174 Ga0501236_003131 3300049670 Bacteria 1920
175 Ga0501225_0003862 3300049705 Unclassified 4497
176 Ga0501234_000348 3300049707 Bacteria 6852
177 Ga0501226_000856 3300049853 Bacteria 4070
178 nmdc:mga05p37_288338_c1 3300050507 Bacteria 1954
179 nmdc:mga0qj67_103787_c1 3300050509 Bacteria 2293
180 nmdc:mga0n895_135820_c1 3300050512 Bacteria 2486
181 nmdc:mga0rr50_26129_c1 3300050513 Unclassified 4068
182 nmdc:mga08x19_134_c1 3300050514 Bacteria 65861
183 nmdc:mga0a205_21742_c1 3300050515 Bacteria 6065
184 Ga0105242_10035553
185 JGI24751J29686_10000071
186 Ga0065715_10004815
187 Ga0070670_100001555
188 Ga0070670_100003029
189 Ga0068868_100000310
190 Ga0070689_100108306
191 Ga0070688_100027623
192 Ga0070714_100045330
193 Ga0070713_100012378
194 Ga0070711_100009114
195 Ga0070700_100000079
196 Ga0070708_100007955
197 Ga0070708_100008666
198 Ga0070706_100000406
199 Ga0070706_100076718
200 Ga0070707_100002663
201 Ga0070707_100092165
202 Ga0070707_100203230
203 Ga0070698_100004166
204 Ga0070698_100054133
205 Ga0070699_100014456
206 Ga0070699_100044889
207 Ga0070679_100087918
208 Ga0070697_100000305
209 Ga0070697_100002835
210 Ga0070697_100010862
211 Ga0070697_100013401
212 Ga0070697_100062067
213 Ga0070697_100113371
214 Ga0070695_100002048
215 Ga0070696_100001596
216 Ga0070693_100000744
217 Ga0070704_100012802
218 Ga0068855_100130841
219 Ga0068856_100048857
220 Ga0070702_100044744
221 Ga0068859_100040480
222 Ga0068859_100112357
223 Ga0068859_100150223
224 Ga0068859_100224097
225 Ga0068861_100024820
226 Ga0068863_100016206
227 Ga0068858_100074456
228 Ga0068860_100075261
229 Ga0068862_100063612
230 Ga0070712_100158041
231 Ga0097621_100003362
232 Ga0097621_100072934
233 Ga0075433_10016670
234 Ga0075434_100054936
235 Ga0075436_100007209
236 Ga0097620_100040480
237 Ga0097620_100112355
238 Ga0097620_100150225
239 Ga0097620_100224090
240 Ga0075435_100023418
241 Ga0075435_100080831
242 Ga0099794_10011315
243 Ga0099794_10014526
244 Ga0099794_10015127
245 Ga0099794_10020427
246 Ga0099794_10033255
247 Ga0099794_10066804
248 Ga0105240_10371065
249 Ga0105245_10000013
250 Ga0105241_10001302
251 Ga0105241_10056998
252 Ga0105241_10330658
253 Ga0105248_10000847
254 Ga0105248_10085610
255 Ga0105237_10109146
256 Ga0105238_10000001
257 Ga0105238_10011099
258 Ga0105249_10037575
259 Ga0157373_10008148
260 Ga0157373_10079160
261 Ga0157374_10000010
262 Ga0157378_10000137
263 Ga0157378_10149557
264 Ga0163162_10045177
265 Ga0163162_10062299
266 Ga0163162_10071572
267 Ga0157372_10048785
268 Ga0157372_10129031
269 Ga0157375_10000260
270 Ga0163163_10000994
271 Ga0163163_10086029
272 Ga0157377_10000015
273 Ga0157379_10029991
274 Ga0157376_10000019
275 Ga0157376_10000038
276 Ga0157376_10000160
277 Ga0157376_10032182
278 Ga0207684_10023648
279 Ga0207684_10048222
280 Ga0207693_10015614
281 Ga0207652_10067288
282 Ga0207646_10000274
283 Ga0207694_10000001
284 Ga0207694_10006513
285 Ga0207650_10000017
286 Ga0207650_10000284
287 Ga0207687_10000014
288 Ga0207686_10109631
289 Ga0207670_10062730
290 Ga0207665_10001051
291 Ga0207665_10003035
292 Ga0207665_10063418
293 Ga0207711_10032585
294 Ga0207689_10109316
295 Ga0207712_10005767
296 Ga0207677_10000310
297 Ga0207708_10000057
298 Ga0207708_10134475
299 Ga0207702_10139999
300 Ga0207641_10004305
301 Ga0207641_10024251
302 Ga0207675_100027202
303 Ga0209588_1004470
304 Ga0265354_1001840
305 Ga0268264_10014497
306 Ga0268264_10060969
307 Ga0307511_10013232
308 Ga0265770_1002286
309 Ga0265760_10006151
310 Ga0307513_10010586
311 Ga0307408_100013904
312 Ga0307410_10046402
313 Ga0307409_100184304
314 Ga0307416_100088399
315 Ga0307411_10029519
316 Ga0307415_100106198
317 Ga0316212_1004235
318 Ga0373941_0019810
319 Ga0373931_0020196
320 Ga0373931_0029347
321 Ga0373935_0032677
322 Ga0373927_0045376
323 Ga0373947_0049935
324 Ga0373937_0026278
325 Ga0373925_0018672
326 Ga0436365_0706047
327 Ga0451839_1330129
328 Ga0439458_0001171
329 Ga0495592_0005305
330 Ga0495603_0049209
331 Ga0495580_0015641
332 Ga0495582_0007256
333 Ga0495582_0043730
334 Ga0495639_0025209
335 Ga0495664_0025417
336 Ga0495647_0006022
337 Ga0495658_0009694
338 Ga0495613_0022393
339 Ga0495613_0044609
340 Ga0495581_0082711
341 Ga0495674_0030542
342 Ga0495684_0037840
343 Ga0496101_0101898
344 Ga0496102_0004628
345 Ga0496112_0124555
346 Ga0496114_0030051
347 Ga0496115_0020410
348 Ga0496115_0021844
349 Ga0501198_003537
350 Ga0501209_015568
351 Ga0501217_001104
352 Ga0501223_012303
353 Ga0501224_002023
354 Ga0501227_007190
355 Ga0501233_008617
356 Ga0501235_003871
357 Ga0501236_003131
358 Ga0501225_0003862
359 Ga0501234_000348
360 Ga0501226_000856
361 nmdc:mga05p37_288338_c1
362 nmdc:mga0qj67_103787_c1
363 nmdc:mga0n895_135820_c1
364 nmdc:mga0rr50_26129_c1
365 nmdc:mga08x19_134_c1
366 nmdc:mga0a205_21742_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05656

DUF805

Protein of unknown function (DUF805)

6

135

0.74

Map