F280611

General Info

Members Datasets Scaffolds Average Seq Length
183 128 366 403

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10177516|Ga0070717_101775161
Length 427
Sequence MPHKEAIQTIRLFSGFTRGSVQLVLRGNRAYWMWLGFLGALIVSGVLAYAAQVRTGLGITAMRDQVSWGFYIGNFTFLVGVAAAAVVLVIPAYIYNWKPIREIVIYGELLAVSAITMCLMFVLVDIGRPDRFWHLIPPIGFLNFPRSVLAWDVLVLNLYFLVNFIVVTHILYRAFHGKHYIKKLVVPMVLLSVPMAVGIHTVTAFLYNGLAARPYWNSSILAPQFLASAFCSGPAILLVVLQLLRRFTRFEIQDAAIWKIAELMAYAMFLNLFLHGAEAFKEFYSNTQHLLFTRYWYFGIGAHRTLVPYAWSAVGLNLASFLLFVSPKTRQNFVTLNIGCLATYAGVYVEKGMGLIIPGLTPDTLGEIYEYAPTLNELRVAAGIFAIGFLLFTLMLKVAVPISLGEFMGQRHEGAEAPEGEVAVAAT

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
54 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
55 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
56 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
57 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
58 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
59 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
60 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
61 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
62 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
63 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
64 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
65 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
66 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
67 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
68 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
69 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
70 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
71 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
72 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
73 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
74 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
75 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
76 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
77 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
80 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
81 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
83 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
84 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
85 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
86 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
87 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
88 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
89 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
90 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
91 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
92 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
93 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
94 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
95 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
96 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
97 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
98 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
99 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
100 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
101 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
102 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
103 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
104 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
105 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
106 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
107 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
108 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
109 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
110 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
116 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
117 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
118 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
119 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
120 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
121 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
122 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
125 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
126 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
127 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
128 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.55
Rhizosphere 99.45
Stem 0
Stem Tuber 0
Unclassified 1.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10177516 3300006028 Bacteria 1855
2 Ga0065712_10112860 3300005290 Bacteria 1792
3 Ga0065707_10123809 3300005295 Bacteria 2057
4 Ga0070683_100000030 3300005329 Bacteria 152931
5 Ga0070690_100063864 3300005330 Bacteria 2377
6 Ga0070666_10046164 3300005335 Bacteria 2921
7 Ga0068868_100182734 3300005338 Bacteria 1741
8 Ga0070660_100177923 3300005339 Bacteria 1721
9 Ga0070689_100010505 3300005340 Bacteria 6599
10 Ga0070661_100130385 3300005344 Bacteria 1888
11 Ga0070668_100174442 3300005347 Bacteria 1752
12 Ga0070669_100182223 3300005353 Bacteria 1643
13 Ga0070713_100038074 3300005436 Bacteria 3894
14 Ga0070700_100092780 3300005441 Bacteria 1974
15 Ga0068867_100092366 3300005459 Bacteria 2298
16 Ga0070684_100000088 3300005535 Bacteria 60042
17 Ga0070672_100053845 3300005543 Bacteria 3147
18 Ga0070695_100130644 3300005545 Bacteria 1731
19 Ga0070693_100034156 3300005547 Bacteria 2813
20 Ga0070704_100065767 3300005549 Bacteria 2611
21 Ga0068854_100007627 3300005578 Bacteria 6922
22 Ga0070702_100016164 3300005615 Bacteria 3824
23 Ga0068852_100353941 3300005616 Bacteria 1434
24 Ga0068851_10061102 3300005834 Bacteria 1931
25 Ga0068858_100114518 3300005842 Bacteria 2519
26 Ga0068860_100087580 3300005843 Bacteria 2964
27 Ga0068860_100221278 3300005843 Bacteria 1838
28 Ga0068862_100065129 3300005844 Bacteria 3138
29 Ga0068871_100182732 3300006358 Bacteria 1803
30 Ga0075430_100023255 3300006846 Bacteria 5273
31 Ga0075431_100047600 3300006847 Bacteria 4421
32 Ga0075429_100035311 3300006880 Bacteria 4348
33 Ga0068865_100224952 3300006881 Bacteria 1469
34 Ga0075435_100179994 3300007076 Bacteria 1786
35 Ga0105240_10028995 3300009093 Bacteria 7219
36 Ga0105240_10138064 3300009093 Bacteria 2917
37 Ga0105240_10235714 3300009093 Bacteria 2124
38 Ga0105245_10071772 3300009098 Bacteria 3145
39 Ga0114129_10005980 3300009147 Bacteria 17236
40 Ga0105248_10097669 3300009177 Bacteria 3309
41 Ga0105238_10102357 3300009551 Bacteria 2846
42 Ga0105249_10162025 3300009553 Bacteria 2162
43 Ga0157379_10156854 3300014968 Bacteria 2054
44 Ga0207645_10013101 3300025907 Bacteria 5600
45 Ga0207695_10079908 3300025913 Bacteria 3313
46 Ga0207662_10030242 3300025918 Bacteria 3142
47 Ga0207657_10158909 3300025919 Bacteria 1837
48 Ga0207706_10083482 3300025933 Bacteria 2809
49 Ga0207691_10088288 3300025940 Bacteria 2781
50 Ga0207661_10000035 3300025944 Bacteria 152976
51 Ga0207661_10043178 3300025944 Bacteria 3557
52 Ga0207667_10199912 3300025949 Bacteria 2051
53 Ga0207651_10069197 3300025960 Bacteria 2491
54 Ga0207708_10024240 3300026075 Bacteria 4588
55 Ga0207648_10005319 3300026089 Bacteria 12984
56 Ga0207683_10075332 3300026121 Bacteria 2987
57 Ga0207428_10003683 3300027907 Bacteria 14741
58 Ga0265323_10000261 3300028653 Bacteria 30888
59 Ga0265330_10007200 3300031235 Bacteria 5445
60 Ga0265330_10026202 3300031235 Bacteria 2639
61 Ga0265332_10000053 3300031238 Bacteria 108878
62 Ga0265328_10002020 3300031239 Bacteria 9191
63 Ga0265329_10002246 3300031242 Bacteria 8887
64 Ga0265329_10008610 3300031242 Bacteria 3856
65 Ga0265331_10000130 3300031250 Bacteria 99140
66 Ga0265327_10001260 3300031251 Bacteria 33540
67 Ga0265327_10007126 3300031251 Bacteria 8722
68 Ga0265316_10000085 3300031344 Bacteria 99136
69 Ga0265316_10002721 3300031344 Bacteria 18144
70 Ga0265316_10004833 3300031344 Bacteria 13281
71 Ga0265316_10074582 3300031344 Unclassified 2611
72 Ga0307408_100004083 3300031548 Bacteria 9959
73 Ga0307408_100033435 3300031548 Bacteria 3593
74 Ga0316579_10032193 3300031691 Bacteria 2404
75 Ga0265314_10000540 3300031711 Bacteria 48694
76 Ga0265342_10009916 3300031712 Bacteria 6660
77 Ga0316578_10005624 3300031728 Bacteria 6101
78 Ga0316577_10000674 3300031733 Bacteria 14341
79 Ga0307410_10025590 3300031852 Bacteria 3705
80 Ga0307410_10068103 3300031852 Bacteria 2457
81 Ga0307409_100050885 3300031995 Bacteria 3167
82 Ga0307411_10012975 3300032005 Bacteria 4575
83 Ga0307411_10014057 3300032005 Bacteria 4441
84 Ga0307415_100100267 3300032126 Bacteria 2122
85 Ga0373934_0001221 3300035086 Bacteria 9336
86 Ga0373951_0001170 3300035091 Bacteria 6935
87 Ga0316574_0020469 3300035398 Bacteria 3917
88 Ga0373931_0060551 3300035691 Bacteria 2038
89 Ga0373927_0000334 3300035695 Bacteria 36930
90 Ga0373927_0046718 3300035695 Bacteria 2801
91 Ga0373933_0163848 3300035724 Bacteria 1413
92 Ga0373937_0000507 3300036401 Bacteria 35568
93 Ga0373937_0002734 3300036401 Bacteria 14719
94 Ga0373937_0008532 3300036401 Bacteria 8901
95 Ga0373937_0097912 3300036401 Bacteria 2721
96 Ga0373937_0106243 3300036401 Bacteria 2610
97 Ga0373937_0164792 3300036401 Bacteria 2078
98 Ga0316582_0044874 3300036647 Bacteria 2781
99 Ga0316584_0066438 3300036712 Bacteria 2702
100 Ga0373925_0000258 3300037068 Bacteria 55071
101 Ga0373925_0005061 3300037068 Bacteria 9870
102 Ga0373925_0083320 3300037068 Bacteria 2435
103 Ga0316581_0020759 3300037588 Bacteria 1925
104 Ga0439453_0007051 3300041408 Bacteria 1769
105 Ga0451577_0000031 3300042876 Bacteria 388524
106 Ga0451577_0000177 3300042876 Bacteria 140523
107 Ga0451577_0003029 3300042876 Bacteria 19102
108 Ga0451577_0007018 3300042876 Bacteria 11110
109 Ga0451577_0052461 3300042876 Bacteria 3641
110 Ga0451577_0078589 3300042876 Bacteria 2941
111 Ga0451577_0165435 3300042876 Bacteria 1992
112 Ga0451577_0194388 3300042876 Bacteria 1831
113 Ga0453683_0000273 3300044673 Bacteria 67792
114 Ga0453683_0002003 3300044673 Bacteria 16472
115 Ga0453683_0019435 3300044673 Bacteria 4350
116 Ga0453683_0024826 3300044673 Bacteria 3811
117 Ga0453683_0039596 3300044673 Bacteria 2962
118 Ga0453683_0046068 3300044673 Bacteria 2734
119 Ga0453684_0000560 3300044712 Bacteria 140195
120 Ga0453684_0010240 3300044712 Bacteria 16061
121 Ga0453684_0010530 3300044712 Bacteria 15789
122 Ga0453684_0072437 3300044712 Bacteria 4349
123 Ga0453684_0120139 3300044712 Bacteria 3174
124 Ga0453684_0265351 3300044712 Bacteria 1965
125 Ga0451576_0000779 3300045051 Bacteria 62676
126 Ga0451576_0008382 3300045051 Bacteria 12138
127 Ga0451576_0011220 3300045051 Bacteria 10208
128 Ga0451576_0099422 3300045051 Bacteria 3026
129 Ga0451576_0158993 3300045051 Bacteria 2357
130 Ga0451576_0248526 3300045051 Bacteria 1859
131 Ga0451576_0387330 3300045051 Bacteria 1465
132 Ga0495629_0000629 3300046459 Bacteria 28662
133 Ga0495651_0016136 3300046462 Bacteria 5784
134 Ga0495651_0022737 3300046462 Bacteria 4873
135 Ga0495580_0021986 3300046472 Bacteria 4701
136 Ga0495582_0005353 3300046473 Bacteria 7164
137 Ga0495664_0010301 3300046477 Bacteria 5246
138 Ga0495608_0002904 3300046511 Bacteria 12266
139 Ga0495628_0013709 3300046516 Bacteria 6811
140 Ga0495628_0053357 3300046516 Bacteria 3190
141 Ga0495652_0069008 3300046529 Bacteria 2960
142 Ga0495587_0021270 3300046536 Bacteria 4001
143 Ga0495645_0008177 3300046543 Bacteria 7295
144 Ga0495667_0098291 3300046559 Bacteria 1895
145 Ga0495635_0000343 3300046663 Bacteria 29779
146 Ga0495657_0160146 3300046675 Bacteria 1393
147 Ga0495599_0033595 3300046678 Bacteria 3224
148 Ga0495599_0050874 3300046678 Bacteria 2596
149 Ga0495623_0034975 3300046679 Bacteria 3221
150 Ga0495646_0016252 3300046680 Bacteria 4724
151 Ga0495647_0014179 3300046681 Bacteria 2774
152 Ga0495658_0000033 3300046683 Bacteria 70077
153 Ga0495613_0001591 3300046689 Bacteria 17201
154 Ga0495613_0023131 3300046689 Unclassified 4632
155 Ga0495613_0099721 3300046689 Bacteria 2098
156 Ga0495674_0129452 3300047319 Bacteria 2127
157 Ga0495680_0000018 3300047322 Bacteria 119374
158 Ga0495680_0065980 3300047322 Bacteria 2771
159 Ga0495680_0090350 3300047322 Bacteria 2298
160 Ga0495675_0049074 3300047444 Bacteria 2684
161 Ga0495684_0011535 3300047471 Bacteria 6828
162 Ga0495684_0029205 3300047471 Bacteria 4232
163 Ga0496112_0137406 3300048915 Bacteria 2414
164 Ga0501036_0023783 3300049572 Bacteria 5163
165 Ga0501040_0012483 3300049576 Bacteria 5568
166 Ga0501046_0165543 3300049580 Bacteria 1661
167 Ga0501072_0012964 3300049588 Bacteria 6379
168 Ga0501075_0024110 3300049591 Bacteria 4456
169 Ga0501076_0065541 3300049592 Bacteria 2897
170 Ga0501077_0093780 3300049593 Bacteria 1903
171 Ga0501079_0008587 3300049741 Bacteria 7754
172 Ga0501079_0057546 3300049741 Bacteria 3000
173 Ga0501080_0082561 3300049742 Bacteria 2985
174 Ga0501081_0061672 3300049743 Bacteria 2600
175 Ga0501045_0010844 3300049824 Bacteria 6389
176 Ga0501045_0074332 3300049824 Bacteria 2503
177 nmdc:mga05p37_1807_c2 3300050507 Bacteria 8660
178 nmdc:mga06r32_150284_c1 3300050510 Bacteria 2307
179 nmdc:mga06r32_61028_c1 3300050510 Bacteria 3628
180 nmdc:mga08y16_260_c1 3300050511 Bacteria 47553
181 Ga0495619_0000446 3300053085 Bacteria 27836
182 Ga0501082_0290798 3300060353 Bacteria 1423
183 Ga0530510_0024185 3300061734 Bacteria 4333
184 Ga0070717_10177516
185 Ga0065712_10112860
186 Ga0065707_10123809
187 Ga0070683_100000030
188 Ga0070690_100063864
189 Ga0070666_10046164
190 Ga0068868_100182734
191 Ga0070660_100177923
192 Ga0070689_100010505
193 Ga0070661_100130385
194 Ga0070668_100174442
195 Ga0070669_100182223
196 Ga0070713_100038074
197 Ga0070700_100092780
198 Ga0068867_100092366
199 Ga0070684_100000088
200 Ga0070672_100053845
201 Ga0070695_100130644
202 Ga0070693_100034156
203 Ga0070704_100065767
204 Ga0068854_100007627
205 Ga0070702_100016164
206 Ga0068852_100353941
207 Ga0068851_10061102
208 Ga0068858_100114518
209 Ga0068860_100087580
210 Ga0068860_100221278
211 Ga0068862_100065129
212 Ga0068871_100182732
213 Ga0075430_100023255
214 Ga0075431_100047600
215 Ga0075429_100035311
216 Ga0068865_100224952
217 Ga0075435_100179994
218 Ga0105240_10028995
219 Ga0105240_10138064
220 Ga0105240_10235714
221 Ga0105245_10071772
222 Ga0114129_10005980
223 Ga0105248_10097669
224 Ga0105238_10102357
225 Ga0105249_10162025
226 Ga0157379_10156854
227 Ga0207645_10013101
228 Ga0207695_10079908
229 Ga0207662_10030242
230 Ga0207657_10158909
231 Ga0207706_10083482
232 Ga0207691_10088288
233 Ga0207661_10000035
234 Ga0207661_10043178
235 Ga0207667_10199912
236 Ga0207651_10069197
237 Ga0207708_10024240
238 Ga0207648_10005319
239 Ga0207683_10075332
240 Ga0207428_10003683
241 Ga0265323_10000261
242 Ga0265330_10007200
243 Ga0265330_10026202
244 Ga0265332_10000053
245 Ga0265328_10002020
246 Ga0265329_10002246
247 Ga0265329_10008610
248 Ga0265331_10000130
249 Ga0265327_10001260
250 Ga0265327_10007126
251 Ga0265316_10000085
252 Ga0265316_10002721
253 Ga0265316_10004833
254 Ga0265316_10074582
255 Ga0307408_100004083
256 Ga0307408_100033435
257 Ga0316579_10032193
258 Ga0265314_10000540
259 Ga0265342_10009916
260 Ga0316578_10005624
261 Ga0316577_10000674
262 Ga0307410_10025590
263 Ga0307410_10068103
264 Ga0307409_100050885
265 Ga0307411_10012975
266 Ga0307411_10014057
267 Ga0307415_100100267
268 Ga0373934_0001221
269 Ga0373951_0001170
270 Ga0316574_0020469
271 Ga0373931_0060551
272 Ga0373927_0000334
273 Ga0373927_0046718
274 Ga0373933_0163848
275 Ga0373937_0000507
276 Ga0373937_0002734
277 Ga0373937_0008532
278 Ga0373937_0097912
279 Ga0373937_0106243
280 Ga0373937_0164792
281 Ga0316582_0044874
282 Ga0316584_0066438
283 Ga0373925_0000258
284 Ga0373925_0005061
285 Ga0373925_0083320
286 Ga0316581_0020759
287 Ga0439453_0007051
288 Ga0451577_0000031
289 Ga0451577_0000177
290 Ga0451577_0003029
291 Ga0451577_0007018
292 Ga0451577_0052461
293 Ga0451577_0078589
294 Ga0451577_0165435
295 Ga0451577_0194388
296 Ga0453683_0000273
297 Ga0453683_0002003
298 Ga0453683_0019435
299 Ga0453683_0024826
300 Ga0453683_0039596
301 Ga0453683_0046068
302 Ga0453684_0000560
303 Ga0453684_0010240
304 Ga0453684_0010530
305 Ga0453684_0072437
306 Ga0453684_0120139
307 Ga0453684_0265351
308 Ga0451576_0000779
309 Ga0451576_0008382
310 Ga0451576_0011220
311 Ga0451576_0099422
312 Ga0451576_0158993
313 Ga0451576_0248526
314 Ga0451576_0387330
315 Ga0495629_0000629
316 Ga0495651_0016136
317 Ga0495651_0022737
318 Ga0495580_0021986
319 Ga0495582_0005353
320 Ga0495664_0010301
321 Ga0495608_0002904
322 Ga0495628_0013709
323 Ga0495628_0053357
324 Ga0495652_0069008
325 Ga0495587_0021270
326 Ga0495645_0008177
327 Ga0495667_0098291
328 Ga0495635_0000343
329 Ga0495657_0160146
330 Ga0495599_0033595
331 Ga0495599_0050874
332 Ga0495623_0034975
333 Ga0495646_0016252
334 Ga0495647_0014179
335 Ga0495658_0000033
336 Ga0495613_0001591
337 Ga0495613_0023131
338 Ga0495613_0099721
339 Ga0495674_0129452
340 Ga0495680_0000018
341 Ga0495680_0065980
342 Ga0495680_0090350
343 Ga0495675_0049074
344 Ga0495684_0011535
345 Ga0495684_0029205
346 Ga0496112_0137406
347 Ga0501036_0023783
348 Ga0501040_0012483
349 Ga0501046_0165543
350 Ga0501072_0012964
351 Ga0501075_0024110
352 Ga0501076_0065541
353 Ga0501077_0093780
354 Ga0501079_0008587
355 Ga0501079_0057546
356 Ga0501080_0082561
357 Ga0501081_0061672
358 Ga0501045_0010844
359 Ga0501045_0074332
360 nmdc:mga05p37_1807_c2
361 nmdc:mga06r32_150284_c1
362 nmdc:mga06r32_61028_c1
363 nmdc:mga08y16_260_c1
364 Ga0495619_0000446
365 Ga0501082_0290798
366 Ga0530510_0024185

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03916

NrfD

Polysulphide reductase, NrfD

58

362

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6btm-assembly1.cif.gz_C structure of alternative complex iii from flavobacterium johnsoniae (wild type) 0.8277 11 396
6f0k-assembly1.cif.gz_C alternative complex iii 0.8139 19 410
6loe-assembly1.cif.gz_C cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.8046 13 400
6btm-assembly1.cif.gz_C structure of alternative complex iii from flavobacterium johnsoniae (wild type) 0.7768 11 396
6f0k-assembly1.cif.gz_C alternative complex iii 0.7758 19 410
ID Description Score Start End Superfamily
af_P37180_41_337_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.8101 61 349 1.20.1630.10
af_P32709_7_307_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.7988 64 345 1.20.1630.10
af_P37180_41_337_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.7758 61 349 1.20.1630.10
af_P32709_7_307_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.7501 64 345 1.20.1630.10
af_A9Z1K9_108_335_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.548 60 241 1.20.120.1770
ID Description Score Start End GO Terms
AF-A0A2S7U4H9-F1-model_v4 Polysulfide reductase 0.962 7 401 GO:0005886
AF-A0A7C1EYY8-F1-model_v4 Polysulfide reductase 0.9607 6 404 GO:0005886
AF-A0A2M8DF63-F1-model_v4 Polysulfide reductase 0.9602 6 403 GO:0005886
AF-A0A2A4T3M3-F1-model_v4 Polysulfide reductase 0.9601 6 404 GO:0005886
AF-A0A1G3AG55-F1-model_v4 Polysulfide reductase 0.9591 6 402 GO:0005886

Map