F280491

General Info

Members Datasets Scaffolds Average Seq Length
183 126 366 249

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100753789|Ga0070707_1007537891
Length 259
Sequence MAKRKKTPKIGPLAVLSLLREVRTGAGDQRPILVDGARELVPLLARELRAGGDPSAVREGGGDPHGAAALVWIGPADEERLRAASRAHIPIVGLTQGESLPYVLDTDLVFVRPGERLPAEQVAHALARLLGERGTALAARLPALRGPVVDELIRGMARRNALVAAAVWVPGVDMPILTLNQIRLVLRIALAYGEEVGPERVPELLGVIGAGLGMRAVARELLDFVPVAGWAVKGALAYGGTRAVGEAARRRFAMGKETA

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
25 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
26 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
27 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
28 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
30 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
48 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
49 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
50 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
51 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
52 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
53 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
54 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
55 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
56 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
57 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
58 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
59 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
60 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
61 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
62 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
63 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
64 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
65 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
66 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
67 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
70 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
71 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
72 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
73 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
74 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
75 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
76 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
77 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
78 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
79 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
80 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
81 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
82 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
83 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
84 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
85 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
86 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
87 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
88 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
89 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
90 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
91 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
92 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
93 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
94 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
95 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
96 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
97 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
98 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
99 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
100 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
101 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
102 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
103 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
104 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
105 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
106 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
107 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
110 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
111 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
112 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
113 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
114 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
115 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
116 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
121 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
122 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
123 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
124 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
125 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
126 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.27
Metatranscriptomes 2.73
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.2
Rhizosphere 91.26
Stem 0
Stem Tuber 0
Unclassified 7.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100753789 3300005468 Bacteria 937
2 rootH1_10088161 3300003323 Bacteria 2449
3 Ga0070658_10008188 3300005327 Bacteria 8404
4 Ga0070683_100003268 3300005329 Bacteria 13105
5 Ga0070683_100384919 3300005329 Bacteria 1337
6 Ga0070680_100012277 3300005336 Bacteria 6651
7 Ga0070660_100063131 3300005339 Bacteria 2879
8 Ga0070660_100143022 3300005339 Bacteria 1920
9 Ga0070660_100212233 3300005339 Bacteria 1572
10 Ga0070691_10290961 3300005341 Bacteria 889
11 Ga0070661_100007196 3300005344 Bacteria 7667
12 Ga0070671_100052657 3300005355 Bacteria 3384
13 Ga0070714_100142294 3300005435 Bacteria 2154
14 Ga0070714_100388090 3300005435 Bacteria 1317
15 Ga0070713_100054337 3300005436 Bacteria 3322
16 Ga0070711_100028765 3300005439 Bacteria 3660
17 Ga0070711_100287240 3300005439 Unclassified 1304
18 Ga0070678_100073123 3300005456 Bacteria 2572
19 Ga0070681_10047307 3300005458 Bacteria 4300
20 Ga0070679_100013404 3300005530 Bacteria 7851
21 Ga0070684_100003380 3300005535 Bacteria 11961
22 Ga0070684_100027315 3300005535 Bacteria 4815
23 Ga0068855_100027384 3300005563 Bacteria 6818
24 Ga0068855_100235191 3300005563 Bacteria 2049
25 Ga0068855_100518250 3300005563 Bacteria 1294
26 Ga0068857_100042668 3300005577 Bacteria 4024
27 Ga0068856_100098033 3300005614 Bacteria 2921
28 Ga0070717_10092674 3300006028 Bacteria 2553
29 Ga0070717_10259625 3300006028 Unclassified 1537
30 Ga0070712_100004988 3300006175 Bacteria 8213
31 Ga0070712_100316567 3300006175 Bacteria 1268
32 Ga0075434_100302477 3300006871 Bacteria 1620
33 Ga0105240_10188879 3300009093 Bacteria 2424
34 Ga0105240_10192598 3300009093 Bacteria 2396
35 Ga0105242_10028905 3300009176 Bacteria 4417
36 Ga0157370_10025355 3300013104 Bacteria 5869
37 Ga0157369_10001378 3300013105 Bacteria 29916
38 Ga0157369_10005226 3300013105 Bacteria 15146
39 Ga0157369_10025501 3300013105 Bacteria 6563
40 Ga0197907_10350611 3300020069 Bacteria 1124
41 Ga0206356_11656572 3300020070 Bacteria 4239
42 Ga0206354_11424069 3300020081 Bacteria 3183
43 Ga0206353_10147455 3300020082 Bacteria 7147
44 Ga0206353_11320045 3300020082 Bacteria 2727
45 Ga0207705_10015501 3300025909 Bacteria 5469
46 Ga0207695_10090408 3300025913 Bacteria 3077
47 Ga0207695_10144624 3300025913 Bacteria 2323
48 Ga0207693_10005497 3300025915 Bacteria 10553
49 Ga0207693_10136429 3300025915 Bacteria 1929
50 Ga0207660_10241801 3300025917 Bacteria 1422
51 Ga0207657_10001610 3300025919 Bacteria 24275
52 Ga0207649_10305935 3300025920 Bacteria 1164
53 Ga0207652_10354996 3300025921 Bacteria 1323
54 Ga0207646_10306695 3300025922 Bacteria 1434
55 Ga0207664_10125087 3300025929 Bacteria 2158
56 Ga0207664_10562003 3300025929 Unclassified 1024
57 Ga0207686_10031844 3300025934 Bacteria 3134
58 Ga0207661_10013360 3300025944 Bacteria 5997
59 Ga0207661_10247845 3300025944 Bacteria 1582
60 Ga0207667_10089979 3300025949 Bacteria 3172
61 Ga0207667_10281218 3300025949 Bacteria 1700
62 Ga0207639_10263057 3300026041 Bacteria 1509
63 Ga0207702_10065774 3300026078 Bacteria 3106
64 Ga0207702_10195507 3300026078 Bacteria 1872
65 Ga0207674_10039376 3300026116 Bacteria 4900
66 Ga0207683_10120605 3300026121 Unclassified 2354
67 Ga0265318_10003244 3300028577 Bacteria 8286
68 Ga0265322_10011446 3300028654 Bacteria 2572
69 Ga0265338_10003592 3300028800 Bacteria 21643
70 Ga0265340_10041687 3300031247 Bacteria 2256
71 Ga0265339_10051629 3300031249 Bacteria 2243
72 Ga0265327_10005895 3300031251 Bacteria 10011
73 Ga0265327_10024222 3300031251 Bacteria 3573
74 Ga0265316_10100044 3300031344 Bacteria 2204
75 Ga0373926_0143902 3300035083 Bacteria 906
76 Ga0373953_0006931 3300035117 Bacteria 3765
77 Ga0373954_0098836 3300035118 Bacteria 1407
78 Ga0373943_0003697 3300035170 Bacteria 6959
79 Ga0373943_0026784 3300035170 Unclassified 2703
80 Ga0373943_0057599 3300035170 Unclassified 1931
81 Ga0373946_0003435 3300035171 Bacteria 5620
82 Ga0373955_0046672 3300035172 Unclassified 2342
83 Ga0373935_0006819 3300035692 Bacteria 6823
84 Ga0373927_0016233 3300035695 Bacteria 4914
85 Ga0373947_0000994 3300035725 Bacteria 17318
86 Ga0373947_0001247 3300035725 Bacteria 15666
87 Ga0373947_0122597 3300035725 Bacteria 1652
88 Ga0373937_0021777 3300036401 Bacteria 5753
89 Ga0373925_0052629 3300037068 Bacteria 3042
90 Ga0395900_0008250 3300037418 Bacteria 10725
91 Ga0395898_0024692 3300037466 Bacteria 6062
92 Ga0395898_0069914 3300037466 Bacteria 3395
93 Ga0395905_0006211 3300037471 Bacteria 12058
94 Ga0395901_0000391 3300038443 Bacteria 52295
95 Ga0395901_0014311 3300038443 Bacteria 8077
96 Ga0395901_0019100 3300038443 Bacteria 7009
97 Ga0466966_0040262 3300044684 Bacteria 3007
98 Ga0466961_0031231 3300044693 Bacteria 3424
99 Ga0466963_0000468 3300044694 Bacteria 18789
100 Ga0466963_0010856 3300044694 Bacteria 5531
101 Ga0466963_0028057 3300044694 Bacteria 3611
102 Ga0466963_0034993 3300044694 Bacteria 3271
103 Ga0466963_0387342 3300044694 Unclassified 985
104 Ga0466957_0162328 3300044842 Bacteria 1452
105 Ga0466959_0114960 3300045049 Bacteria 1917
106 Ga0466959_0121179 3300045049 Bacteria 1859
107 Ga0466958_0008142 3300045836 Bacteria 5803
108 Ga0466967_0003452 3300045976 Bacteria 10315
109 Ga0466967_0006478 3300045976 Bacteria 8293
110 Ga0466967_0019999 3300045976 Bacteria 5399
111 Ga0466967_0023235 3300045976 Bacteria 5078
112 Ga0466967_0035077 3300045976 Bacteria 4266
113 Ga0466967_0060348 3300045976 Bacteria 3360
114 Ga0466967_0082169 3300045976 Bacteria 2911
115 Ga0466967_0462739 3300045976 Bacteria 1241
116 Ga0466967_0465139 3300045976 Bacteria 1237
117 Ga0495629_0007444 3300046459 Bacteria 8064
118 Ga0495641_0000612 3300046461 Bacteria 30028
119 Ga0495651_0031071 3300046462 Bacteria 4166
120 Ga0495651_0069615 3300046462 Bacteria 2679
121 Ga0495653_0204372 3300046463 Bacteria 1338
122 Ga0495580_0085474 3300046472 Unclassified 2197
123 Ga0495582_0001627 3300046473 Bacteria 12641
124 Ga0495662_0000620 3300046476 Bacteria 16478
125 Ga0495664_0098187 3300046477 Bacteria 1763
126 Ga0495618_0029762 3300046514 Bacteria 3407
127 Ga0495628_0052774 3300046516 Bacteria 3211
128 Ga0495666_0019916 3300046526 Unclassified 3328
129 Ga0495652_0028410 3300046529 Bacteria 4921
130 Ga0495652_0455737 3300046529 Bacteria 894
131 Ga0495667_0003848 3300046559 Bacteria 10076
132 Ga0495667_0245242 3300046559 Bacteria 1140
133 Ga0495667_0258351 3300046559 Bacteria 1108
134 Ga0495635_0007673 3300046663 Bacteria 7529
135 Ga0495657_0139098 3300046675 Bacteria 1514
136 Ga0495623_0016212 3300046679 Bacteria 4812
137 Ga0495646_0033039 3300046680 Bacteria 3218
138 Ga0495646_0209356 3300046680 Bacteria 1059
139 Ga0495647_0002158 3300046681 Bacteria 6149
140 Ga0495658_0001191 3300046683 Bacteria 13704
141 Ga0495613_0001533 3300046689 Bacteria 17578
142 Ga0495624_0159955 3300046690 Bacteria 1376
143 Ga0495600_0010197 3300046809 Bacteria 5824
144 Ga0495581_0008754 3300047315 Bacteria 5858
145 Ga0495604_0036133 3300047317 Bacteria 3896
146 Ga0495674_0055350 3300047319 Bacteria 3480
147 Ga0495674_0388335 3300047319 Bacteria 1128
148 Ga0495676_0004932 3300047321 Bacteria 12238
149 Ga0495676_0067511 3300047321 Bacteria 2766
150 Ga0495680_0085649 3300047322 Bacteria 2372
151 Ga0495684_0012093 3300047471 Bacteria 6659
152 Ga0495684_0013965 3300047471 Bacteria 6178
153 Ga0495593_0001083 3300047673 Bacteria 15906
154 Ga0495614_0002623 3300048089 Bacteria 7993
155 Ga0496101_0034463 3300048904 Bacteria 3575
156 Ga0496102_0049623 3300048905 Bacteria 3818
157 Ga0496104_0010932 3300048907 Bacteria 8120
158 Ga0496104_0016649 3300048907 Bacteria 6682
159 Ga0496105_0008583 3300048908 Bacteria 7938
160 Ga0496106_0002754 3300048909 Bacteria 13019
161 Ga0496107_0019954 3300048910 Bacteria 4733
162 Ga0496108_0008642 3300048911 Bacteria 8263
163 Ga0496109_0003020 3300048912 Bacteria 14035
164 Ga0496110_0417116 3300048913 Unclassified 1224
165 Ga0496114_0019690 3300048917 Bacteria 5469
166 Ga0496114_0276841 3300048917 Bacteria 1479
167 Ga0496115_0006179 3300048918 Bacteria 8758
168 Ga0496115_0184537 3300048918 Unclassified 1724
169 Ga0496115_0186372 3300048918 Unclassified 1715
170 Ga0501047_0285820 3300049581 Bacteria 1493
171 Ga0501069_0051100 3300049585 Bacteria 2300
172 Ga0501069_0176048 3300049585 Bacteria 1236
173 Ga0501070_0022298 3300049586 Bacteria 5305
174 Ga0501076_0248291 3300049592 Bacteria 1456
175 Ga0501077_0017604 3300049593 Bacteria 4512
176 Ga0501080_0228400 3300049742 Bacteria 1701
177 Ga0501080_0241090 3300049742 Bacteria 1650
178 Ga0501035_0117460 3300049822 Bacteria 2328
179 Ga0495601_0073534 3300053077 Bacteria 2185
180 Ga0495619_0027367 3300053085 Bacteria 3671
181 Ga0495619_0095355 3300053085 Bacteria 2018
182 Ga0495619_0119616 3300053085 Unclassified 1805
183 Ga0501084_0134707 3300054114 Bacteria 2080
184 Ga0070707_100753789
185 rootH1_10088161
186 Ga0070658_10008188
187 Ga0070683_100003268
188 Ga0070683_100384919
189 Ga0070680_100012277
190 Ga0070660_100063131
191 Ga0070660_100143022
192 Ga0070660_100212233
193 Ga0070691_10290961
194 Ga0070661_100007196
195 Ga0070671_100052657
196 Ga0070714_100142294
197 Ga0070714_100388090
198 Ga0070713_100054337
199 Ga0070711_100028765
200 Ga0070711_100287240
201 Ga0070678_100073123
202 Ga0070681_10047307
203 Ga0070679_100013404
204 Ga0070684_100003380
205 Ga0070684_100027315
206 Ga0068855_100027384
207 Ga0068855_100235191
208 Ga0068855_100518250
209 Ga0068857_100042668
210 Ga0068856_100098033
211 Ga0070717_10092674
212 Ga0070717_10259625
213 Ga0070712_100004988
214 Ga0070712_100316567
215 Ga0075434_100302477
216 Ga0105240_10188879
217 Ga0105240_10192598
218 Ga0105242_10028905
219 Ga0157370_10025355
220 Ga0157369_10001378
221 Ga0157369_10005226
222 Ga0157369_10025501
223 Ga0197907_10350611
224 Ga0206356_11656572
225 Ga0206354_11424069
226 Ga0206353_10147455
227 Ga0206353_11320045
228 Ga0207705_10015501
229 Ga0207695_10090408
230 Ga0207695_10144624
231 Ga0207693_10005497
232 Ga0207693_10136429
233 Ga0207660_10241801
234 Ga0207657_10001610
235 Ga0207649_10305935
236 Ga0207652_10354996
237 Ga0207646_10306695
238 Ga0207664_10125087
239 Ga0207664_10562003
240 Ga0207686_10031844
241 Ga0207661_10013360
242 Ga0207661_10247845
243 Ga0207667_10089979
244 Ga0207667_10281218
245 Ga0207639_10263057
246 Ga0207702_10065774
247 Ga0207702_10195507
248 Ga0207674_10039376
249 Ga0207683_10120605
250 Ga0265318_10003244
251 Ga0265322_10011446
252 Ga0265338_10003592
253 Ga0265340_10041687
254 Ga0265339_10051629
255 Ga0265327_10005895
256 Ga0265327_10024222
257 Ga0265316_10100044
258 Ga0373926_0143902
259 Ga0373953_0006931
260 Ga0373954_0098836
261 Ga0373943_0003697
262 Ga0373943_0026784
263 Ga0373943_0057599
264 Ga0373946_0003435
265 Ga0373955_0046672
266 Ga0373935_0006819
267 Ga0373927_0016233
268 Ga0373947_0000994
269 Ga0373947_0001247
270 Ga0373947_0122597
271 Ga0373937_0021777
272 Ga0373925_0052629
273 Ga0395900_0008250
274 Ga0395898_0024692
275 Ga0395898_0069914
276 Ga0395905_0006211
277 Ga0395901_0000391
278 Ga0395901_0014311
279 Ga0395901_0019100
280 Ga0466966_0040262
281 Ga0466961_0031231
282 Ga0466963_0000468
283 Ga0466963_0010856
284 Ga0466963_0028057
285 Ga0466963_0034993
286 Ga0466963_0387342
287 Ga0466957_0162328
288 Ga0466959_0114960
289 Ga0466959_0121179
290 Ga0466958_0008142
291 Ga0466967_0003452
292 Ga0466967_0006478
293 Ga0466967_0019999
294 Ga0466967_0023235
295 Ga0466967_0035077
296 Ga0466967_0060348
297 Ga0466967_0082169
298 Ga0466967_0462739
299 Ga0466967_0465139
300 Ga0495629_0007444
301 Ga0495641_0000612
302 Ga0495651_0031071
303 Ga0495651_0069615
304 Ga0495653_0204372
305 Ga0495580_0085474
306 Ga0495582_0001627
307 Ga0495662_0000620
308 Ga0495664_0098187
309 Ga0495618_0029762
310 Ga0495628_0052774
311 Ga0495666_0019916
312 Ga0495652_0028410
313 Ga0495652_0455737
314 Ga0495667_0003848
315 Ga0495667_0245242
316 Ga0495667_0258351
317 Ga0495635_0007673
318 Ga0495657_0139098
319 Ga0495623_0016212
320 Ga0495646_0033039
321 Ga0495646_0209356
322 Ga0495647_0002158
323 Ga0495658_0001191
324 Ga0495613_0001533
325 Ga0495624_0159955
326 Ga0495600_0010197
327 Ga0495581_0008754
328 Ga0495604_0036133
329 Ga0495674_0055350
330 Ga0495674_0388335
331 Ga0495676_0004932
332 Ga0495676_0067511
333 Ga0495680_0085649
334 Ga0495684_0012093
335 Ga0495684_0013965
336 Ga0495593_0001083
337 Ga0495614_0002623
338 Ga0496101_0034463
339 Ga0496102_0049623
340 Ga0496104_0010932
341 Ga0496104_0016649
342 Ga0496105_0008583
343 Ga0496106_0002754
344 Ga0496107_0019954
345 Ga0496108_0008642
346 Ga0496109_0003020
347 Ga0496110_0417116
348 Ga0496114_0019690
349 Ga0496114_0276841
350 Ga0496115_0006179
351 Ga0496115_0184537
352 Ga0496115_0186372
353 Ga0501047_0285820
354 Ga0501069_0051100
355 Ga0501069_0176048
356 Ga0501070_0022298
357 Ga0501076_0248291
358 Ga0501077_0017604
359 Ga0501080_0228400
360 Ga0501080_0241090
361 Ga0501035_0117460
362 Ga0495601_0073534
363 Ga0495619_0027367
364 Ga0495619_0095355
365 Ga0495619_0119616
366 Ga0501084_0134707

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2an1-assembly3.cif.gz_A structural genomics, the crystal structure of a putative kinase from salmonella typhimurim lt2 0.669 27 94
3szm-assembly4.cif.gz_D structure of human microcephalin (mcph1) tandem brct domains in complex with a gamma-h2ax phosphopeptide 0.6671 26 88
3rvj-assembly1.cif.gz_A structure of the chey-bef3 complex with substitutions at 59 and 89: n59d and e89q 0.6509 22 125
1y3h-assembly1.cif.gz_A-2 crystal structure of inorganic polyphosphate/atp-nad kinase from mycobacterium tuberculosis 0.6485 27 94
5c4r-assembly1.cif.gz_A cobk precorrin-6a reductase 0.648 27 92
ID Description Score Start End Superfamily
af_P0A8R7_182_342_3.90.20.20 Alpha Beta;Alpha-Beta Complex;Hemagglutinin Ectodomain; Chain B;GrpE nucleotide exchange factor, coiled-coil domain 0.7746 139 245 3.90.20.20
3shtA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;BRCT domain 0.6611 26 88 3.40.50.10190
af_Q9U370_624_706_3.40.50.10190 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;BRCT domain 0.6495 27 88 3.40.50.10190
af_Q20129_129_227_3.40.50.10190 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;BRCT domain 0.6335 22 88 3.40.50.10190
2rjnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.6308 24 89 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A6I3BQM5-F1-model_v4 DUF697 domain-containing protein 0.9399 8 248
AF-A0A7W1RW71-F1-model_v4 DUF697 domain-containing protein 0.9387 39 251 GO:0016020
AF-A0A7W1RW71-F1-model_v4 DUF697 domain-containing protein 0.9303 39 251 GO:0016020
AF-A0A7V1H1R5-F1-model_v4 DUF697 domain-containing protein 0.9267 127 249 GO:0016020
AF-A0A538LMH2-F1-model_v4 DUF697 domain-containing protein 0.9223 1 250

Map