F280308

General Info

Members Datasets Scaffolds Average Seq Length
183 157 366 213

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100117109|Ga0070680_1001171092
Length 218
Sequence VVSPVATAVIVDYGSGNLRSAAKAFERAARDAGIATAIKVSGDAEDVRAAERIVLPGVGAFADCRRGLAAVSGMEEALEEAVRRRGRPFFGICVGMQLMAERGREFAVTAGLGWLRGEVAAIAPADPDLKVPHMGWNELELRGVHPVLAGLADGTHAYFVHSYGIGGADPGDVLATVDYGGALTAIVARDNLIGTQFHPEKSQAAGLAMIANFLRWRP

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
4 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
18 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
19 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
22 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
23 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
24 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
25 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
26 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
27 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
28 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
29 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
40 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
41 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
42 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
43 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
44 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
45 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
46 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
47 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
48 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
49 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
50 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
51 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
52 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
53 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
54 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
55 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
56 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
57 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
58 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
59 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
60 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
61 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
62 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
63 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
64 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
65 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
66 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
67 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
68 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
69 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
70 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
71 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
72 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
73 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
74 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
75 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
76 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
77 2509276019 Ensifer aridi TW10 Isolate Nodule
78 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
79 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
80 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
81 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
82 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
83 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
84 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
85 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
86 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
87 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
88 2643221558 Rhizobium sp. Root149 Isolate Unclassified
89 2643221607 Rhizobium sp. Root73 Isolate Unclassified
90 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
91 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
92 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
93 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
94 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
95 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
96 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
97 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
98 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
99 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
100 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
101 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
102 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
103 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
104 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
105 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
106 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
107 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
108 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
109 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
110 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
111 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
112 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
113 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
114 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
115 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
116 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
117 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
118 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
119 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
120 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
121 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
122 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
123 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
124 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
125 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
126 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
127 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
128 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
129 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
130 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
131 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
132 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
133 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
134 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
135 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
136 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
137 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
138 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
139 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
140 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
141 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
142 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
143 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
144 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
145 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
146 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
147 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
148 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
149 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
150 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
151 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
152 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
153 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
154 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
155 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
156 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
157 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 54.64
Metatranscriptomes 0.55
Isolates 44.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.19
Nodule 44.81
Rhizoplane 1.09
Rhizosphere 45.9
Stem 0
Stem Tuber 0
Unclassified 0.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100117109 3300005336 Bacteria 2221
2 JGI25404J52841_10027570 3300003659 Bacteria 1221
3 Ga0055526_1011560 3300003771 Bacteria 3960
4 Ga0070680_100003831 3300005336 Bacteria 11249
5 Ga0070692_10266491 3300005345 Bacteria 1032
6 Ga0070671_100067505 3300005355 Bacteria 2982
7 Ga0070713_100125393 3300005436 Bacteria 2258
8 Ga0070711_100239439 3300005439 Bacteria 1418
9 Ga0070711_100358480 3300005439 Bacteria 1174
10 Ga0070678_100652316 3300005456 Bacteria 944
11 Ga0070678_101174384 3300005456 Bacteria 711
12 Ga0070681_10000290 3300005458 Bacteria 40569
13 Ga0070681_10355371 3300005458 Bacteria 1375
14 Ga0070679_100006551 3300005530 Bacteria 10853
15 Ga0070679_100373110 3300005530 Bacteria 1373
16 Ga0070679_100384713 3300005530 Bacteria 1350
17 Ga0070679_100387035 3300005530 Bacteria 1345
18 Ga0070684_100715573 3300005535 Bacteria 934
19 Ga0070697_100231967 3300005536 Bacteria 1575
20 Ga0068857_100096605 3300005577 Bacteria 2648
21 Ga0068856_100305512 3300005614 Bacteria 1609
22 Ga0068852_100398778 3300005616 Bacteria 1353
23 Ga0081455_10033885 3300005937 Bacteria 4582
24 Ga0081455_10067016 3300005937 Bacteria 2993
25 Ga0081540_1000107 3300005983 Bacteria 89480
26 Ga0081540_1013033 3300005983 Bacteria 5428
27 Ga0075430_100004116 3300006846 Bacteria 12273
28 Ga0079104_1000534 3300006946 Bacteria 40267
29 Ga0105240_10033685 3300009093 Bacteria 6615
30 Ga0105238_10113144 3300009551 Bacteria 2694
31 Ga0105239_10781503 3300010375 Bacteria 1094
32 Ga0157370_10002708 3300013104 Bacteria 21192
33 Ga0157370_10027388 3300013104 Bacteria 5620
34 Ga0157369_10001671 3300013105 Bacteria 27057
35 Ga0157369_10420164 3300013105 Bacteria 1386
36 Ga0214543_1000015 3300021327 Bacteria 305679
37 Ga0213872_10103796 3300021361 Bacteria 1266
38 Ga0228711_1000030 3300022739 Bacteria 94546
39 Ga0228710_1000002 3300022740 Bacteria 287279
40 Ga0207707_10005011 3300025912 Bacteria 11631
41 Ga0207707_10108623 3300025912 Bacteria 2425
42 Ga0207707_10121246 3300025912 Bacteria 2286
43 Ga0207693_10357484 3300025915 Bacteria 1142
44 Ga0207660_10086158 3300025917 Bacteria 2319
45 Ga0207652_10198360 3300025921 Bacteria 1806
46 Ga0207652_10232718 3300025921 Bacteria 1661
47 Ga0207652_10619671 3300025921 Bacteria 969
48 Ga0207652_10973708 3300025921 Bacteria 747
49 Ga0207694_10180307 3300025924 Bacteria 1713
50 Ga0207700_10111850 3300025928 Bacteria 2199
51 Ga0207677_10351337 3300026023 Bacteria 1235
52 Ga0207702_10364539 3300026078 Bacteria 1386
53 Ga0207674_10112442 3300026116 Bacteria 2697
54 Ga0207698_10250653 3300026142 Bacteria 1620
55 Ga0209281_1000030 3300027111 Bacteria 425931
56 Ga0209282_1000004 3300027666 Bacteria 425931
57 Ga0315914_1000001 3300031967 Bacteria 416633
58 Ga0316593_10205661 3300032168 Bacteria 729
59 Ga0315913_1000022 3300033430 Bacteria 94546
60 Ga0315915_1000002 3300033464 Bacteria 425854
61 Ga0373936_0014755 3300035113 Bacteria 2990
62 Ga0373954_0041976 3300035118 Bacteria 2133
63 Ga0373956_0325106 3300035119 Bacteria 733
64 Ga0373955_0022327 3300035172 Bacteria 3209
65 Ga0373933_0001204 3300035724 Bacteria 15332
66 Ga0373933_0017455 3300035724 Bacteria 4026
67 Ga0373937_0003917 3300036401 Bacteria 12594
68 Ga0373937_0013575 3300036401 Bacteria 7175
69 Ga0373937_0123880 3300036401 Bacteria 2410
70 Ga0373937_0971449 3300036401 Bacteria 798
71 Ga0373925_0306155 3300037068 Bacteria 1284
72 Ga0373925_0468224 3300037068 Bacteria 1033
73 Ga0395900_0083690 3300037418 Bacteria 3278
74 Ga0395905_0203317 3300037471 Bacteria 1857
75 Ga0395905_0373252 3300037471 Bacteria 1320
76 Ga0436364_0685645 3300037853 Bacteria 2965
77 Ga0400483_111704 3300039062 Bacteria 1485
78 Ga0436365_0656354 3300039437 Bacteria 1150
79 Ga0436361_0160288 3300039447 Bacteria 864
80 Ga0436361_0849711 3300039447 Bacteria 1202
81 Ga0436361_0853495 3300039447 Bacteria 6292
82 Ga0436363_0170736 3300039450 Bacteria 2538
83 Ga0436363_1460068 3300039450 Bacteria 1029
84 Ga0436362_0613745 3300039453 Unclassified 857
85 Ga0436362_0657531 3300039453 Bacteria 2388
86 Ga0466963_0199081 3300044694 Bacteria 1401
87 Ga0466967_0574750 3300045976 Bacteria 1111
88 Ga0495606_0066858 3300046507 Bacteria 2278
89 Ga0495586_0091351 3300046535 Bacteria 1682
90 Ga0495646_0234220 3300046680 Bacteria 989
91 Ga0496106_0628590 3300048909 Bacteria 859
92 Ga0496115_0411814 3300048918 Bacteria 1096
93 Ga0501047_0584792 3300049581 Bacteria 939
94 Ga0501070_0050829 3300049586 Bacteria 3440
95 Ga0501073_0419145 3300049589 Bacteria 925
96 Ga0501075_0277246 3300049591 Bacteria 1278
97 Ga0501280_003286 3300049776 Bacteria 2511
98 Ga0495601_0164873 3300053077 Bacteria 1448
99 Ga0500644_0040748 3300053088 Bacteria 1539
100 Ga0500588_0002863 3300053146 Bacteria 3578
101 Ga0500604_0091443 3300053151 Bacteria 994
102 2509108804 2508501122 Bacteria 6292184
103 2509377935 2509276019 Bacteria 6802256
104 2510308498 2510065057 Bacteria 6649661
105 2512534794 2512047086 Bacteria 6850303
106 2512973392 2512875026 Bacteria 6861065
107 2513602090 2513237089 Bacteria 6553624
108 2513983544 2513237156 Bacteria 6402557
109 2514003311 2513237160 Bacteria 6650282
110 2517571605 2517487022 Bacteria 7227575
111 2524450260 2524023207 Bacteria 6813453
112 2558867570 2558860100 Bacteria 8458965
113 2585166440 2582581283 Bacteria 6030556
114 2643814932 2643221558 Bacteria 5460675
115 2644052504 2643221607 Bacteria 6314006
116 2644201113 2643221636 Bacteria 6583769
117 2644484782 2643221686 Bacteria 6310811
118 2792582397 2791355082 Bacteria 5973319
119 2802717030 2802428858 Bacteria 6636079
120 2802724982 2802428859 Bacteria 6667919
121 2802729732 2802428860 Bacteria 6525526
122 2802737078 2802428861 Bacteria 6534206
123 2802743483 2802428862 Bacteria 6633353
124 2802749391 2802428863 Bacteria 6410669
125 2850082809 2850079185 Bacteria 6848280
126 2855842931 2855839649 Bacteria 7135830
127 2884298350 2884298095 Bacteria 3823049
128 2915981655 2915980308 Bacteria 6624279
129 2916000682 2915993759 Bacteria 7016183
130 2916048236 2916041962 Bacteria 6820487
131 2916054412 2916048683 Bacteria 6543552
132 2916066426 2916061851 Bacteria 6737736
133 2916076815 2916076590 Bacteria 6596108
134 2921207771 2921201388 Bacteria 6926299
135 2921252743 2921250672 Bacteria 6677771
136 2924158725 2924158325 Bacteria 7188855
137 2937031667 2937029754 Bacteria 6424026
138 2937041399 2937036028 Bacteria 6846469
139 2937056496 2937049772 Bacteria 6757901
140 2937081548 2937078374 Bacteria 6610289
141 2937090820 2937084907 Bacteria 6618516
142 2937098516 2937091812 Bacteria 6979387
143 2937102896 2937098957 Bacteria 7249374
144 2937109733 2937106411 Bacteria 6947143
145 2957376734 2957375807 Bacteria 6425588
146 2957395139 2957388812 Bacteria 6778072
147 2957441729 2957437181 Bacteria 6568994
148 2957448331 2957443900 Bacteria 6869977
149 2960592858 2960591022 Bacteria 6622873
150 2960616822 2960610863 Bacteria 6691244
151 2960619034 2960617483 Bacteria 6727748
152 2960631089 2960624210 Bacteria 6875384
153 2960635533 2960631154 Bacteria 6732508
154 2960664870 2960660292 Bacteria 7041660
155 2960681783 2960680706 Bacteria 6624464
156 2960693552 2960687367 Bacteria 6535474
157 2964655155 2964649959 Bacteria 6675118
158 2964660036 2964656573 Bacteria 7100150
159 2967670431 2967664464 Bacteria 6948836
160 2967681305 2967678726 Bacteria 7264382
161 2967692369 2967686174 Bacteria 6678622
162 2967696522 2967693043 Bacteria 6804451
163 2967721253 2967714385 Bacteria 7000047
164 2967728432 2967721400 Bacteria 7073753
165 2967732219 2967728569 Bacteria 6641507
166 2967738520 2967735183 Bacteria 6827012
167 2967765739 2967762386 Bacteria 6923502
168 2970022046 2970019648 Bacteria 7072033
169 2970028620 2970026789 Bacteria 6785236
170 2970046656 2970040964 Bacteria 6731123
171 2970120898 2970116247 Bacteria 6501857
172 2970127919 2970122695 Bacteria 6625855
173 2970133465 2970129317 Bacteria 6806560
174 2970147393 2970143518 Bacteria 6446480
175 2970184196 2970177841 Bacteria 6768001
176 2970189704 2970184632 Bacteria 7054431
177 2977523788 2977516862 Bacteria 6940108
178 2977531258 2977530762 Bacteria 6951399
179 2977547434 2977544691 Bacteria 6875412
180 2977557955 2977551784 Bacteria 7125765
181 2977583010 2977579622 Bacteria 6772100
182 8004003272 8003999396 Bacteria 7063185
183 8018152132 8018150411 Bacteria 5549903
184 Ga0070680_100117109
185 JGI25404J52841_10027570
186 Ga0055526_1011560
187 Ga0070680_100003831
188 Ga0070692_10266491
189 Ga0070671_100067505
190 Ga0070713_100125393
191 Ga0070711_100239439
192 Ga0070711_100358480
193 Ga0070678_100652316
194 Ga0070678_101174384
195 Ga0070681_10000290
196 Ga0070681_10355371
197 Ga0070679_100006551
198 Ga0070679_100373110
199 Ga0070679_100384713
200 Ga0070679_100387035
201 Ga0070684_100715573
202 Ga0070697_100231967
203 Ga0068857_100096605
204 Ga0068856_100305512
205 Ga0068852_100398778
206 Ga0081455_10033885
207 Ga0081455_10067016
208 Ga0081540_1000107
209 Ga0081540_1013033
210 Ga0075430_100004116
211 Ga0079104_1000534
212 Ga0105240_10033685
213 Ga0105238_10113144
214 Ga0105239_10781503
215 Ga0157370_10002708
216 Ga0157370_10027388
217 Ga0157369_10001671
218 Ga0157369_10420164
219 Ga0214543_1000015
220 Ga0213872_10103796
221 Ga0228711_1000030
222 Ga0228710_1000002
223 Ga0207707_10005011
224 Ga0207707_10108623
225 Ga0207707_10121246
226 Ga0207693_10357484
227 Ga0207660_10086158
228 Ga0207652_10198360
229 Ga0207652_10232718
230 Ga0207652_10619671
231 Ga0207652_10973708
232 Ga0207694_10180307
233 Ga0207700_10111850
234 Ga0207677_10351337
235 Ga0207702_10364539
236 Ga0207674_10112442
237 Ga0207698_10250653
238 Ga0209281_1000030
239 Ga0209282_1000004
240 Ga0315914_1000001
241 Ga0316593_10205661
242 Ga0315913_1000022
243 Ga0315915_1000002
244 Ga0373936_0014755
245 Ga0373954_0041976
246 Ga0373956_0325106
247 Ga0373955_0022327
248 Ga0373933_0001204
249 Ga0373933_0017455
250 Ga0373937_0003917
251 Ga0373937_0013575
252 Ga0373937_0123880
253 Ga0373937_0971449
254 Ga0373925_0306155
255 Ga0373925_0468224
256 Ga0395900_0083690
257 Ga0395905_0203317
258 Ga0395905_0373252
259 Ga0436364_0685645
260 Ga0400483_111704
261 Ga0436365_0656354
262 Ga0436361_0160288
263 Ga0436361_0849711
264 Ga0436361_0853495
265 Ga0436363_0170736
266 Ga0436363_1460068
267 Ga0436362_0613745
268 Ga0436362_0657531
269 Ga0466963_0199081
270 Ga0466967_0574750
271 Ga0495606_0066858
272 Ga0495586_0091351
273 Ga0495646_0234220
274 Ga0496106_0628590
275 Ga0496115_0411814
276 Ga0501047_0584792
277 Ga0501070_0050829
278 Ga0501073_0419145
279 Ga0501075_0277246
280 Ga0501280_003286
281 Ga0495601_0164873
282 Ga0500644_0040748
283 Ga0500588_0002863
284 Ga0500604_0091443
285 2509108804
286 2509377935
287 2510308498
288 2512534794
289 2512973392
290 2513602090
291 2513983544
292 2514003311
293 2517571605
294 2524450260
295 2558867570
296 2585166440
297 2643814932
298 2644052504
299 2644201113
300 2644484782
301 2792582397
302 2802717030
303 2802724982
304 2802729732
305 2802737078
306 2802743483
307 2802749391
308 2850082809
309 2855842931
310 2884298350
311 2915981655
312 2916000682
313 2916048236
314 2916054412
315 2916066426
316 2916076815
317 2921207771
318 2921252743
319 2924158725
320 2937031667
321 2937041399
322 2937056496
323 2937081548
324 2937090820
325 2937098516
326 2937102896
327 2937109733
328 2957376734
329 2957395139
330 2957441729
331 2957448331
332 2960592858
333 2960616822
334 2960619034
335 2960631089
336 2960635533
337 2960664870
338 2960681783
339 2960693552
340 2964655155
341 2964660036
342 2967670431
343 2967681305
344 2967692369
345 2967696522
346 2967721253
347 2967728432
348 2967732219
349 2967738520
350 2967765739
351 2970022046
352 2970028620
353 2970046656
354 2970120898
355 2970127919
356 2970133465
357 2970147393
358 2970184196
359 2970189704
360 2977523788
361 2977531258
362 2977547434
363 2977557955
364 2977583010
365 8004003272
366 8018152132

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

9

216

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gud-assembly2.cif.gz_B crystal structure of amidotransferase hish from vibrio cholerae 0.9485 1 212
4gud-assembly1.cif.gz_A crystal structure of amidotransferase hish from vibrio cholerae 0.942 2 214
4gud-assembly1.cif.gz_A crystal structure of amidotransferase hish from vibrio cholerae 0.9374 2 214
3zr4-assembly2.cif.gz_D structural evidence for ammonia tunneling across the (beta-alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex 0.9362 2 213
7ac8-assembly3.cif.gz_F error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9349 2 213
ID Description Score Start End Superfamily
af_Q57929_1_195_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9596 4 214 3.40.50.880
af_Q57929_1_195_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.95 4 214 3.40.50.880
4gudA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9374 2 214 3.40.50.880
2wjzB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9335 2 213 3.40.50.880
4gudA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9327 2 214 3.40.50.880
ID Description Score Start End GO Terms
AF-P58788-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9977 2 216 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0016829
AF-A0A2N9ARJ9-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9974 2 216 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0006541
GO:0016020
GO:0016829
AF-A0A839F7Y1-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9971 2 216 GO:0000105
GO:0000107
GO:0005737
GO:0006541
GO:0016787
GO:0016829
AF-A0A7R6Z8E3-F1-model_v4 deleted 0.9962 2 216
AF-A0A4Q3FG20-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH 0.9954 50 216 GO:0000105
GO:0000107
GO:0004359
GO:0006541
GO:0016829

Map