F280308
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 183 | 157 | 366 | 213 |
Family's Representative Sequence
| Representative Sequence | 3300005336|Ga0070680_100117109|Ga0070680_1001171092 |
| Length | 218 |
| Sequence | VVSPVATAVIVDYGSGNLRSAAKAFERAARDAGIATAIKVSGDAEDVRAAERIVLPGVGAFADCRRGLAAVSGMEEALEEAVRRRGRPFFGICVGMQLMAERGREFAVTAGLGWLRGEVAAIAPADPDLKVPHMGWNELELRGVHPVLAGLADGTHAYFVHSYGIGGADPGDVLATVDYGGALTAIVARDNLIGTQFHPEKSQAAGLAMIANFLRWRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 2 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 3 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 4 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 5 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 7 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 14 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 15 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 16 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 17 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 18 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 19 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 20 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 21 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 22 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 23 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 24 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 25 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 26 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 27 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 28 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 29 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 40 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 41 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 42 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 43 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 44 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 45 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 46 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 47 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 48 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 49 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 50 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 51 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 52 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 53 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 54 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 55 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 56 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 57 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 58 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 59 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 60 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 61 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 62 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 63 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 64 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 65 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 66 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 67 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 68 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 69 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 70 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 71 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 72 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 74 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 75 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 76 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 77 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 78 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 79 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 80 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 81 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 82 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 83 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 84 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 85 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 86 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 87 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 88 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 89 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 90 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 91 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 92 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 93 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 94 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 95 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 96 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 97 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 98 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 99 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 100 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 101 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 102 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 103 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 104 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 105 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 106 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 107 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 108 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 109 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 110 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 111 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 112 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 113 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 114 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 115 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 116 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 117 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 118 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 119 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 120 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 121 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 122 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 123 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 124 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 125 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 126 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 127 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 128 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 129 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 130 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 131 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 132 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 133 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 134 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 135 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 136 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 137 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 138 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 139 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 140 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 141 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 142 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 143 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 144 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 145 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 146 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 147 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 148 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 149 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 150 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 151 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 152 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 153 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 154 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 155 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 156 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 157 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 54.64 |
| Metatranscriptomes | 0.55 |
| Isolates | 44.81 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.19 |
| Nodule | 44.81 |
| Rhizoplane | 1.09 |
| Rhizosphere | 45.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070680_100117109 | 3300005336 | Bacteria | 2221 |
| 2 | JGI25404J52841_10027570 | 3300003659 | Bacteria | 1221 |
| 3 | Ga0055526_1011560 | 3300003771 | Bacteria | 3960 |
| 4 | Ga0070680_100003831 | 3300005336 | Bacteria | 11249 |
| 5 | Ga0070692_10266491 | 3300005345 | Bacteria | 1032 |
| 6 | Ga0070671_100067505 | 3300005355 | Bacteria | 2982 |
| 7 | Ga0070713_100125393 | 3300005436 | Bacteria | 2258 |
| 8 | Ga0070711_100239439 | 3300005439 | Bacteria | 1418 |
| 9 | Ga0070711_100358480 | 3300005439 | Bacteria | 1174 |
| 10 | Ga0070678_100652316 | 3300005456 | Bacteria | 944 |
| 11 | Ga0070678_101174384 | 3300005456 | Bacteria | 711 |
| 12 | Ga0070681_10000290 | 3300005458 | Bacteria | 40569 |
| 13 | Ga0070681_10355371 | 3300005458 | Bacteria | 1375 |
| 14 | Ga0070679_100006551 | 3300005530 | Bacteria | 10853 |
| 15 | Ga0070679_100373110 | 3300005530 | Bacteria | 1373 |
| 16 | Ga0070679_100384713 | 3300005530 | Bacteria | 1350 |
| 17 | Ga0070679_100387035 | 3300005530 | Bacteria | 1345 |
| 18 | Ga0070684_100715573 | 3300005535 | Bacteria | 934 |
| 19 | Ga0070697_100231967 | 3300005536 | Bacteria | 1575 |
| 20 | Ga0068857_100096605 | 3300005577 | Bacteria | 2648 |
| 21 | Ga0068856_100305512 | 3300005614 | Bacteria | 1609 |
| 22 | Ga0068852_100398778 | 3300005616 | Bacteria | 1353 |
| 23 | Ga0081455_10033885 | 3300005937 | Bacteria | 4582 |
| 24 | Ga0081455_10067016 | 3300005937 | Bacteria | 2993 |
| 25 | Ga0081540_1000107 | 3300005983 | Bacteria | 89480 |
| 26 | Ga0081540_1013033 | 3300005983 | Bacteria | 5428 |
| 27 | Ga0075430_100004116 | 3300006846 | Bacteria | 12273 |
| 28 | Ga0079104_1000534 | 3300006946 | Bacteria | 40267 |
| 29 | Ga0105240_10033685 | 3300009093 | Bacteria | 6615 |
| 30 | Ga0105238_10113144 | 3300009551 | Bacteria | 2694 |
| 31 | Ga0105239_10781503 | 3300010375 | Bacteria | 1094 |
| 32 | Ga0157370_10002708 | 3300013104 | Bacteria | 21192 |
| 33 | Ga0157370_10027388 | 3300013104 | Bacteria | 5620 |
| 34 | Ga0157369_10001671 | 3300013105 | Bacteria | 27057 |
| 35 | Ga0157369_10420164 | 3300013105 | Bacteria | 1386 |
| 36 | Ga0214543_1000015 | 3300021327 | Bacteria | 305679 |
| 37 | Ga0213872_10103796 | 3300021361 | Bacteria | 1266 |
| 38 | Ga0228711_1000030 | 3300022739 | Bacteria | 94546 |
| 39 | Ga0228710_1000002 | 3300022740 | Bacteria | 287279 |
| 40 | Ga0207707_10005011 | 3300025912 | Bacteria | 11631 |
| 41 | Ga0207707_10108623 | 3300025912 | Bacteria | 2425 |
| 42 | Ga0207707_10121246 | 3300025912 | Bacteria | 2286 |
| 43 | Ga0207693_10357484 | 3300025915 | Bacteria | 1142 |
| 44 | Ga0207660_10086158 | 3300025917 | Bacteria | 2319 |
| 45 | Ga0207652_10198360 | 3300025921 | Bacteria | 1806 |
| 46 | Ga0207652_10232718 | 3300025921 | Bacteria | 1661 |
| 47 | Ga0207652_10619671 | 3300025921 | Bacteria | 969 |
| 48 | Ga0207652_10973708 | 3300025921 | Bacteria | 747 |
| 49 | Ga0207694_10180307 | 3300025924 | Bacteria | 1713 |
| 50 | Ga0207700_10111850 | 3300025928 | Bacteria | 2199 |
| 51 | Ga0207677_10351337 | 3300026023 | Bacteria | 1235 |
| 52 | Ga0207702_10364539 | 3300026078 | Bacteria | 1386 |
| 53 | Ga0207674_10112442 | 3300026116 | Bacteria | 2697 |
| 54 | Ga0207698_10250653 | 3300026142 | Bacteria | 1620 |
| 55 | Ga0209281_1000030 | 3300027111 | Bacteria | 425931 |
| 56 | Ga0209282_1000004 | 3300027666 | Bacteria | 425931 |
| 57 | Ga0315914_1000001 | 3300031967 | Bacteria | 416633 |
| 58 | Ga0316593_10205661 | 3300032168 | Bacteria | 729 |
| 59 | Ga0315913_1000022 | 3300033430 | Bacteria | 94546 |
| 60 | Ga0315915_1000002 | 3300033464 | Bacteria | 425854 |
| 61 | Ga0373936_0014755 | 3300035113 | Bacteria | 2990 |
| 62 | Ga0373954_0041976 | 3300035118 | Bacteria | 2133 |
| 63 | Ga0373956_0325106 | 3300035119 | Bacteria | 733 |
| 64 | Ga0373955_0022327 | 3300035172 | Bacteria | 3209 |
| 65 | Ga0373933_0001204 | 3300035724 | Bacteria | 15332 |
| 66 | Ga0373933_0017455 | 3300035724 | Bacteria | 4026 |
| 67 | Ga0373937_0003917 | 3300036401 | Bacteria | 12594 |
| 68 | Ga0373937_0013575 | 3300036401 | Bacteria | 7175 |
| 69 | Ga0373937_0123880 | 3300036401 | Bacteria | 2410 |
| 70 | Ga0373937_0971449 | 3300036401 | Bacteria | 798 |
| 71 | Ga0373925_0306155 | 3300037068 | Bacteria | 1284 |
| 72 | Ga0373925_0468224 | 3300037068 | Bacteria | 1033 |
| 73 | Ga0395900_0083690 | 3300037418 | Bacteria | 3278 |
| 74 | Ga0395905_0203317 | 3300037471 | Bacteria | 1857 |
| 75 | Ga0395905_0373252 | 3300037471 | Bacteria | 1320 |
| 76 | Ga0436364_0685645 | 3300037853 | Bacteria | 2965 |
| 77 | Ga0400483_111704 | 3300039062 | Bacteria | 1485 |
| 78 | Ga0436365_0656354 | 3300039437 | Bacteria | 1150 |
| 79 | Ga0436361_0160288 | 3300039447 | Bacteria | 864 |
| 80 | Ga0436361_0849711 | 3300039447 | Bacteria | 1202 |
| 81 | Ga0436361_0853495 | 3300039447 | Bacteria | 6292 |
| 82 | Ga0436363_0170736 | 3300039450 | Bacteria | 2538 |
| 83 | Ga0436363_1460068 | 3300039450 | Bacteria | 1029 |
| 84 | Ga0436362_0613745 | 3300039453 | Unclassified | 857 |
| 85 | Ga0436362_0657531 | 3300039453 | Bacteria | 2388 |
| 86 | Ga0466963_0199081 | 3300044694 | Bacteria | 1401 |
| 87 | Ga0466967_0574750 | 3300045976 | Bacteria | 1111 |
| 88 | Ga0495606_0066858 | 3300046507 | Bacteria | 2278 |
| 89 | Ga0495586_0091351 | 3300046535 | Bacteria | 1682 |
| 90 | Ga0495646_0234220 | 3300046680 | Bacteria | 989 |
| 91 | Ga0496106_0628590 | 3300048909 | Bacteria | 859 |
| 92 | Ga0496115_0411814 | 3300048918 | Bacteria | 1096 |
| 93 | Ga0501047_0584792 | 3300049581 | Bacteria | 939 |
| 94 | Ga0501070_0050829 | 3300049586 | Bacteria | 3440 |
| 95 | Ga0501073_0419145 | 3300049589 | Bacteria | 925 |
| 96 | Ga0501075_0277246 | 3300049591 | Bacteria | 1278 |
| 97 | Ga0501280_003286 | 3300049776 | Bacteria | 2511 |
| 98 | Ga0495601_0164873 | 3300053077 | Bacteria | 1448 |
| 99 | Ga0500644_0040748 | 3300053088 | Bacteria | 1539 |
| 100 | Ga0500588_0002863 | 3300053146 | Bacteria | 3578 |
| 101 | Ga0500604_0091443 | 3300053151 | Bacteria | 994 |
| 102 | 2509108804 | 2508501122 | Bacteria | 6292184 |
| 103 | 2509377935 | 2509276019 | Bacteria | 6802256 |
| 104 | 2510308498 | 2510065057 | Bacteria | 6649661 |
| 105 | 2512534794 | 2512047086 | Bacteria | 6850303 |
| 106 | 2512973392 | 2512875026 | Bacteria | 6861065 |
| 107 | 2513602090 | 2513237089 | Bacteria | 6553624 |
| 108 | 2513983544 | 2513237156 | Bacteria | 6402557 |
| 109 | 2514003311 | 2513237160 | Bacteria | 6650282 |
| 110 | 2517571605 | 2517487022 | Bacteria | 7227575 |
| 111 | 2524450260 | 2524023207 | Bacteria | 6813453 |
| 112 | 2558867570 | 2558860100 | Bacteria | 8458965 |
| 113 | 2585166440 | 2582581283 | Bacteria | 6030556 |
| 114 | 2643814932 | 2643221558 | Bacteria | 5460675 |
| 115 | 2644052504 | 2643221607 | Bacteria | 6314006 |
| 116 | 2644201113 | 2643221636 | Bacteria | 6583769 |
| 117 | 2644484782 | 2643221686 | Bacteria | 6310811 |
| 118 | 2792582397 | 2791355082 | Bacteria | 5973319 |
| 119 | 2802717030 | 2802428858 | Bacteria | 6636079 |
| 120 | 2802724982 | 2802428859 | Bacteria | 6667919 |
| 121 | 2802729732 | 2802428860 | Bacteria | 6525526 |
| 122 | 2802737078 | 2802428861 | Bacteria | 6534206 |
| 123 | 2802743483 | 2802428862 | Bacteria | 6633353 |
| 124 | 2802749391 | 2802428863 | Bacteria | 6410669 |
| 125 | 2850082809 | 2850079185 | Bacteria | 6848280 |
| 126 | 2855842931 | 2855839649 | Bacteria | 7135830 |
| 127 | 2884298350 | 2884298095 | Bacteria | 3823049 |
| 128 | 2915981655 | 2915980308 | Bacteria | 6624279 |
| 129 | 2916000682 | 2915993759 | Bacteria | 7016183 |
| 130 | 2916048236 | 2916041962 | Bacteria | 6820487 |
| 131 | 2916054412 | 2916048683 | Bacteria | 6543552 |
| 132 | 2916066426 | 2916061851 | Bacteria | 6737736 |
| 133 | 2916076815 | 2916076590 | Bacteria | 6596108 |
| 134 | 2921207771 | 2921201388 | Bacteria | 6926299 |
| 135 | 2921252743 | 2921250672 | Bacteria | 6677771 |
| 136 | 2924158725 | 2924158325 | Bacteria | 7188855 |
| 137 | 2937031667 | 2937029754 | Bacteria | 6424026 |
| 138 | 2937041399 | 2937036028 | Bacteria | 6846469 |
| 139 | 2937056496 | 2937049772 | Bacteria | 6757901 |
| 140 | 2937081548 | 2937078374 | Bacteria | 6610289 |
| 141 | 2937090820 | 2937084907 | Bacteria | 6618516 |
| 142 | 2937098516 | 2937091812 | Bacteria | 6979387 |
| 143 | 2937102896 | 2937098957 | Bacteria | 7249374 |
| 144 | 2937109733 | 2937106411 | Bacteria | 6947143 |
| 145 | 2957376734 | 2957375807 | Bacteria | 6425588 |
| 146 | 2957395139 | 2957388812 | Bacteria | 6778072 |
| 147 | 2957441729 | 2957437181 | Bacteria | 6568994 |
| 148 | 2957448331 | 2957443900 | Bacteria | 6869977 |
| 149 | 2960592858 | 2960591022 | Bacteria | 6622873 |
| 150 | 2960616822 | 2960610863 | Bacteria | 6691244 |
| 151 | 2960619034 | 2960617483 | Bacteria | 6727748 |
| 152 | 2960631089 | 2960624210 | Bacteria | 6875384 |
| 153 | 2960635533 | 2960631154 | Bacteria | 6732508 |
| 154 | 2960664870 | 2960660292 | Bacteria | 7041660 |
| 155 | 2960681783 | 2960680706 | Bacteria | 6624464 |
| 156 | 2960693552 | 2960687367 | Bacteria | 6535474 |
| 157 | 2964655155 | 2964649959 | Bacteria | 6675118 |
| 158 | 2964660036 | 2964656573 | Bacteria | 7100150 |
| 159 | 2967670431 | 2967664464 | Bacteria | 6948836 |
| 160 | 2967681305 | 2967678726 | Bacteria | 7264382 |
| 161 | 2967692369 | 2967686174 | Bacteria | 6678622 |
| 162 | 2967696522 | 2967693043 | Bacteria | 6804451 |
| 163 | 2967721253 | 2967714385 | Bacteria | 7000047 |
| 164 | 2967728432 | 2967721400 | Bacteria | 7073753 |
| 165 | 2967732219 | 2967728569 | Bacteria | 6641507 |
| 166 | 2967738520 | 2967735183 | Bacteria | 6827012 |
| 167 | 2967765739 | 2967762386 | Bacteria | 6923502 |
| 168 | 2970022046 | 2970019648 | Bacteria | 7072033 |
| 169 | 2970028620 | 2970026789 | Bacteria | 6785236 |
| 170 | 2970046656 | 2970040964 | Bacteria | 6731123 |
| 171 | 2970120898 | 2970116247 | Bacteria | 6501857 |
| 172 | 2970127919 | 2970122695 | Bacteria | 6625855 |
| 173 | 2970133465 | 2970129317 | Bacteria | 6806560 |
| 174 | 2970147393 | 2970143518 | Bacteria | 6446480 |
| 175 | 2970184196 | 2970177841 | Bacteria | 6768001 |
| 176 | 2970189704 | 2970184632 | Bacteria | 7054431 |
| 177 | 2977523788 | 2977516862 | Bacteria | 6940108 |
| 178 | 2977531258 | 2977530762 | Bacteria | 6951399 |
| 179 | 2977547434 | 2977544691 | Bacteria | 6875412 |
| 180 | 2977557955 | 2977551784 | Bacteria | 7125765 |
| 181 | 2977583010 | 2977579622 | Bacteria | 6772100 |
| 182 | 8004003272 | 8003999396 | Bacteria | 7063185 |
| 183 | 8018152132 | 8018150411 | Bacteria | 5549903 |
| 184 | Ga0070680_100117109 | |||
| 185 | JGI25404J52841_10027570 | |||
| 186 | Ga0055526_1011560 | |||
| 187 | Ga0070680_100003831 | |||
| 188 | Ga0070692_10266491 | |||
| 189 | Ga0070671_100067505 | |||
| 190 | Ga0070713_100125393 | |||
| 191 | Ga0070711_100239439 | |||
| 192 | Ga0070711_100358480 | |||
| 193 | Ga0070678_100652316 | |||
| 194 | Ga0070678_101174384 | |||
| 195 | Ga0070681_10000290 | |||
| 196 | Ga0070681_10355371 | |||
| 197 | Ga0070679_100006551 | |||
| 198 | Ga0070679_100373110 | |||
| 199 | Ga0070679_100384713 | |||
| 200 | Ga0070679_100387035 | |||
| 201 | Ga0070684_100715573 | |||
| 202 | Ga0070697_100231967 | |||
| 203 | Ga0068857_100096605 | |||
| 204 | Ga0068856_100305512 | |||
| 205 | Ga0068852_100398778 | |||
| 206 | Ga0081455_10033885 | |||
| 207 | Ga0081455_10067016 | |||
| 208 | Ga0081540_1000107 | |||
| 209 | Ga0081540_1013033 | |||
| 210 | Ga0075430_100004116 | |||
| 211 | Ga0079104_1000534 | |||
| 212 | Ga0105240_10033685 | |||
| 213 | Ga0105238_10113144 | |||
| 214 | Ga0105239_10781503 | |||
| 215 | Ga0157370_10002708 | |||
| 216 | Ga0157370_10027388 | |||
| 217 | Ga0157369_10001671 | |||
| 218 | Ga0157369_10420164 | |||
| 219 | Ga0214543_1000015 | |||
| 220 | Ga0213872_10103796 | |||
| 221 | Ga0228711_1000030 | |||
| 222 | Ga0228710_1000002 | |||
| 223 | Ga0207707_10005011 | |||
| 224 | Ga0207707_10108623 | |||
| 225 | Ga0207707_10121246 | |||
| 226 | Ga0207693_10357484 | |||
| 227 | Ga0207660_10086158 | |||
| 228 | Ga0207652_10198360 | |||
| 229 | Ga0207652_10232718 | |||
| 230 | Ga0207652_10619671 | |||
| 231 | Ga0207652_10973708 | |||
| 232 | Ga0207694_10180307 | |||
| 233 | Ga0207700_10111850 | |||
| 234 | Ga0207677_10351337 | |||
| 235 | Ga0207702_10364539 | |||
| 236 | Ga0207674_10112442 | |||
| 237 | Ga0207698_10250653 | |||
| 238 | Ga0209281_1000030 | |||
| 239 | Ga0209282_1000004 | |||
| 240 | Ga0315914_1000001 | |||
| 241 | Ga0316593_10205661 | |||
| 242 | Ga0315913_1000022 | |||
| 243 | Ga0315915_1000002 | |||
| 244 | Ga0373936_0014755 | |||
| 245 | Ga0373954_0041976 | |||
| 246 | Ga0373956_0325106 | |||
| 247 | Ga0373955_0022327 | |||
| 248 | Ga0373933_0001204 | |||
| 249 | Ga0373933_0017455 | |||
| 250 | Ga0373937_0003917 | |||
| 251 | Ga0373937_0013575 | |||
| 252 | Ga0373937_0123880 | |||
| 253 | Ga0373937_0971449 | |||
| 254 | Ga0373925_0306155 | |||
| 255 | Ga0373925_0468224 | |||
| 256 | Ga0395900_0083690 | |||
| 257 | Ga0395905_0203317 | |||
| 258 | Ga0395905_0373252 | |||
| 259 | Ga0436364_0685645 | |||
| 260 | Ga0400483_111704 | |||
| 261 | Ga0436365_0656354 | |||
| 262 | Ga0436361_0160288 | |||
| 263 | Ga0436361_0849711 | |||
| 264 | Ga0436361_0853495 | |||
| 265 | Ga0436363_0170736 | |||
| 266 | Ga0436363_1460068 | |||
| 267 | Ga0436362_0613745 | |||
| 268 | Ga0436362_0657531 | |||
| 269 | Ga0466963_0199081 | |||
| 270 | Ga0466967_0574750 | |||
| 271 | Ga0495606_0066858 | |||
| 272 | Ga0495586_0091351 | |||
| 273 | Ga0495646_0234220 | |||
| 274 | Ga0496106_0628590 | |||
| 275 | Ga0496115_0411814 | |||
| 276 | Ga0501047_0584792 | |||
| 277 | Ga0501070_0050829 | |||
| 278 | Ga0501073_0419145 | |||
| 279 | Ga0501075_0277246 | |||
| 280 | Ga0501280_003286 | |||
| 281 | Ga0495601_0164873 | |||
| 282 | Ga0500644_0040748 | |||
| 283 | Ga0500588_0002863 | |||
| 284 | Ga0500604_0091443 | |||
| 285 | 2509108804 | |||
| 286 | 2509377935 | |||
| 287 | 2510308498 | |||
| 288 | 2512534794 | |||
| 289 | 2512973392 | |||
| 290 | 2513602090 | |||
| 291 | 2513983544 | |||
| 292 | 2514003311 | |||
| 293 | 2517571605 | |||
| 294 | 2524450260 | |||
| 295 | 2558867570 | |||
| 296 | 2585166440 | |||
| 297 | 2643814932 | |||
| 298 | 2644052504 | |||
| 299 | 2644201113 | |||
| 300 | 2644484782 | |||
| 301 | 2792582397 | |||
| 302 | 2802717030 | |||
| 303 | 2802724982 | |||
| 304 | 2802729732 | |||
| 305 | 2802737078 | |||
| 306 | 2802743483 | |||
| 307 | 2802749391 | |||
| 308 | 2850082809 | |||
| 309 | 2855842931 | |||
| 310 | 2884298350 | |||
| 311 | 2915981655 | |||
| 312 | 2916000682 | |||
| 313 | 2916048236 | |||
| 314 | 2916054412 | |||
| 315 | 2916066426 | |||
| 316 | 2916076815 | |||
| 317 | 2921207771 | |||
| 318 | 2921252743 | |||
| 319 | 2924158725 | |||
| 320 | 2937031667 | |||
| 321 | 2937041399 | |||
| 322 | 2937056496 | |||
| 323 | 2937081548 | |||
| 324 | 2937090820 | |||
| 325 | 2937098516 | |||
| 326 | 2937102896 | |||
| 327 | 2937109733 | |||
| 328 | 2957376734 | |||
| 329 | 2957395139 | |||
| 330 | 2957441729 | |||
| 331 | 2957448331 | |||
| 332 | 2960592858 | |||
| 333 | 2960616822 | |||
| 334 | 2960619034 | |||
| 335 | 2960631089 | |||
| 336 | 2960635533 | |||
| 337 | 2960664870 | |||
| 338 | 2960681783 | |||
| 339 | 2960693552 | |||
| 340 | 2964655155 | |||
| 341 | 2964660036 | |||
| 342 | 2967670431 | |||
| 343 | 2967681305 | |||
| 344 | 2967692369 | |||
| 345 | 2967696522 | |||
| 346 | 2967721253 | |||
| 347 | 2967728432 | |||
| 348 | 2967732219 | |||
| 349 | 2967738520 | |||
| 350 | 2967765739 | |||
| 351 | 2970022046 | |||
| 352 | 2970028620 | |||
| 353 | 2970046656 | |||
| 354 | 2970120898 | |||
| 355 | 2970127919 | |||
| 356 | 2970133465 | |||
| 357 | 2970147393 | |||
| 358 | 2970184196 | |||
| 359 | 2970189704 | |||
| 360 | 2977523788 | |||
| 361 | 2977531258 | |||
| 362 | 2977547434 | |||
| 363 | 2977557955 | |||
| 364 | 2977583010 | |||
| 365 | 8004003272 | |||
| 366 | 8018152132 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4gud-assembly2.cif.gz_B | crystal structure of amidotransferase hish from vibrio cholerae | 0.9485 | 1 | 212 |
| 4gud-assembly1.cif.gz_A | crystal structure of amidotransferase hish from vibrio cholerae | 0.942 | 2 | 214 |
| 4gud-assembly1.cif.gz_A | crystal structure of amidotransferase hish from vibrio cholerae | 0.9374 | 2 | 214 |
| 3zr4-assembly2.cif.gz_D | structural evidence for ammonia tunneling across the (beta-alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex | 0.9362 | 2 | 213 |
| 7ac8-assembly3.cif.gz_F | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9349 | 2 | 213 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57929_1_195_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9596 | 4 | 214 | 3.40.50.880 |
| af_Q57929_1_195_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.95 | 4 | 214 | 3.40.50.880 |
| 4gudA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9374 | 2 | 214 | 3.40.50.880 |
| 2wjzB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9335 | 2 | 213 | 3.40.50.880 |
| 4gudA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9327 | 2 | 214 | 3.40.50.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-P58788-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) | 0.9977 | 2 | 216 |
GO:0000105
GO:0000107 GO:0004359 GO:0005737 GO:0016829 |
| AF-A0A2N9ARJ9-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) | 0.9974 | 2 | 216 |
GO:0000105
GO:0000107 GO:0004359 GO:0005737 GO:0006541 GO:0016020 GO:0016829 |
| AF-A0A839F7Y1-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) | 0.9971 | 2 | 216 |
GO:0000105
GO:0000107 GO:0005737 GO:0006541 GO:0016787 GO:0016829 |
| AF-A0A7R6Z8E3-F1-model_v4 | deleted | 0.9962 | 2 | 216 |
|
| AF-A0A4Q3FG20-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisH | 0.9954 | 50 | 216 |
GO:0000105
GO:0000107 GO:0004359 GO:0006541 GO:0016829 |