F280009

General Info

Members Datasets Scaffolds Average Seq Length
182 152 156 297

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2906602504|2906603382
Length 329
Sequence LRRYQPCRSLVGWRPQLCQQCLWHAAQGLGLVSQPSIFDSETPLPSDTLAKREKTLLGFDTRYARVHDQLRLLLNVRELAGWSHKNHGKSLPICDLVAEQYPLVIFHGDVGTGKTATAECIANKLVIEARSEDSILFKLSNRVRGSGMVGEMGTLIAEAFKKVIQSAGKHRRAVLIIDEGDSLAASRAQEHSHHEDKVAVNTLIQGVDDLRQYGGRIVVILCTNRLSVLDPALCRRAAIIEEFRRPTDDERRQLLTMDLAGLSLTPIQLSQLVEATGARAGKPSWTYSDIRTRLYPAALAKAFPSGPLRFDQLKLAAAAITASPVMEDR

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2511231014 Pseudomonas sp. GM48 Isolate Nodule
3 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
4 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
5 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
6 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
7 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
8 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
9 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
10 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
11 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
12 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
13 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
14 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
15 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
16 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
17 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
18 3004167301 Mesorhizobium loti 582 Isolate Unclassified
19 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
20 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
21 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
22 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
23 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
24 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
25 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
26 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
28 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
59 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
62 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
79 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
80 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
81 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
82 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
83 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
84 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
85 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
86 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
87 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
90 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
91 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
92 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
93 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
94 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
95 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
96 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
97 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
98 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
99 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
100 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
101 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
102 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
103 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
104 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
105 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
106 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
107 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
108 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
109 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
110 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
111 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
112 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
113 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
114 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
115 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
116 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
117 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
118 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
119 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
120 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
121 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
122 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
123 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
124 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
127 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
128 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
129 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
130 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
131 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
132 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
133 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
134 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
140 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
141 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
144 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
145 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
146 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
147 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
148 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
149 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
150 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
151 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
152 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.71
Metatranscriptomes 0
Isolates 14.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.65
Nodule 6.59
Rhizoplane 1.1
Rhizosphere 76.37
Stem 0
Stem Tuber 0
Unclassified 14.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_10483077 2162886012 Bacteria 2874
2 JGI24737J22298_10000421 3300001990 Bacteria 14531
3 JGI24735J21928_10000282 3300002067 Bacteria 17784
4 JGI24750J21931_1000216 3300002070 Bacteria 9795
5 JGI24738J21930_10000098 3300002075 Bacteria 19903
6 rootH1_10038865 3300003323 Plasmid 4928
7 rootH1_10232602 3300003323 Bacteria 8397
8 Ga0065714_10064421 3300005288 Bacteria 398277
9 Ga0065712_10067726 3300005290 Bacteria 211002
10 Ga0065715_10089071 3300005293 Bacteria 14942
11 Ga0070690_100000552 3300005330 Bacteria 18704
12 Ga0070666_10000834 3300005335 Bacteria 18704
13 Ga0070687_100097623 3300005343 Unclassified 1638
14 Ga0070692_10030152 3300005345 Bacteria 2710
15 Ga0070668_100032509 3300005347 Bacteria 3970
16 Ga0070671_100008878 3300005355 Bacteria 8065
17 Ga0070667_100002704 3300005367 Bacteria 15348
18 Ga0070694_100002531 3300005444 Bacteria 10795
19 Ga0070698_100172392 3300005471 Bacteria 2104
20 Ga0070697_100036751 3300005536 Plasmid 3956
21 Ga0068853_100002551 3300005539 Bacteria 13678
22 Ga0070686_100000181 3300005544 Bacteria 44461
23 Ga0070664_100037300 3300005564 Bacteria 4086
24 Ga0068852_100002228 3300005616 Bacteria 13295
25 Ga0068864_100001179 3300005618 Bacteria 21773
26 Ga0068863_100000339 3300005841 Bacteria 47676
27 Ga0068860_100002491 3300005843 Bacteria 19318
28 Ga0068860_100021388 3300005843 Bacteria 6264
29 Ga0068862_100000762 3300005844 Bacteria 32105
30 Ga0075432_10002253 3300006058 Bacteria 6419
31 Ga0099794_10008468 3300007265 Bacteria 4272
32 Ga0099794_10063271 3300007265 Unclassified 1800
33 Ga0105251_10014685 3300009011 Bacteria 4316
34 Ga0105245_10000354 3300009098 Bacteria 42780
35 Ga0105242_10003592 3300009176 Bacteria 12062
36 Ga0105248_10000841 3300009177 Bacteria 34508
37 Ga0105248_10360039 3300009177 Bacteria 1638
38 Ga0105249_10000491 3300009553 Bacteria 36562
39 Ga0105239_10006822 3300010375 Bacteria 13172
40 Ga0157371_10000262 3300013102 Bacteria 72390
41 Ga0157371_10117227 3300013102 Bacteria 1893
42 Ga0157370_10009154 3300013104 Bacteria 10615
43 Ga0157370_10029361 3300013104 Bacteria 5397
44 Ga0157370_10030521 3300013104 Bacteria 5281
45 Ga0182008_10000121 3300014497 Bacteria 59239
46 Ga0182008_10008288 3300014497 Bacteria 5678
47 Ga0182006_1009730 3300015261 Bacteria 4298
48 Ga0182007_10088406 3300015262 Bacteria 1019
49 Ga0163161_10001202 3300017792 Bacteria 19511
50 Ga0163161_10003340 3300017792 Bacteria 11253
51 Ga0213875_10012059 3300021388 Bacteria 4280
52 Ga0207713_1014353 3300025735 Bacteria 4121
53 Ga0207680_10000041 3300025903 Bacteria 69609
54 Ga0207647_10039746 3300025904 Bacteria 2966
55 Ga0207644_10000091 3300025931 Bacteria 65055
56 Ga0207686_10000591 3300025934 Bacteria 22664
57 Ga0207711_10001651 3300025941 Bacteria 20573
58 Ga0207712_10000158 3300025961 Bacteria 69863
59 Ga0207668_10194285 3300025972 Unclassified 1611
60 Ga0207658_10002273 3300025986 Bacteria 14192
61 Ga0207639_10001617 3300026041 Bacteria 15151
62 Ga0207641_10000165 3300026088 Bacteria 93436
63 Ga0207676_10000275 3300026095 Bacteria 44782
64 Ga0207698_10001208 3300026142 Bacteria 15074
65 Ga0207698_10057302 3300026142 Bacteria 3014
66 Ga0207428_10021516 3300027907 Bacteria 5460
67 Ga0268265_10000120 3300028380 Bacteria 98362
68 Ga0268264_10000350 3300028381 Bacteria 69863
69 Ga0268264_10015065 3300028381 Bacteria 6342
70 Ga0265337_1006438 3300028556 Plasmid 4527
71 Ga0265326_10003699 3300028558 Bacteria 4994
72 Ga0265318_10002206 3300028577 Bacteria 10519
73 Ga0265322_10042781 3300028654 Bacteria 1289
74 Ga0265324_10011999 3300029957 Plasmid 3284
75 Ga0265316_10013216 3300031344 Bacteria 7353
76 Ga0307509_10000006 3300031507 Bacteria 421538
77 Ga0265314_10006445 3300031711 Bacteria 10389
78 Ga0307516_10009061 3300031730 Bacteria 11147
79 Ga0436364_0853962 3300037853 Bacteria 14558
80 Ga0395901_0000224 3300038443 Bacteria 70977
81 Ga0453683_0059885 3300044673 Bacteria 2380
82 Ga0495617_000513 3300046452 Bacteria 20292
83 Ga0495617_002912 3300046452 Bacteria 6579
84 Ga0495617_022645 3300046452 Bacteria 2124
85 Ga0495650_0058559 3300046471 Bacteria 1554
86 Ga0495605_0001175 3300046474 Bacteria 17392
87 Ga0495584_0016588 3300046491 Bacteria 3756
88 Ga0495596_0000026 3300046500 Bacteria 104636
89 Ga0495596_0000055 3300046500 Bacteria 82573
90 Ga0495596_0001045 3300046500 Bacteria 16449
91 Ga0495607_0001457 3300046501 Bacteria 21080
92 Ga0495583_0000142 3300046506 Bacteria 121513
93 Ga0495606_0000530 3300046507 Bacteria 61714
94 Ga0495606_0003802 3300046507 Bacteria 15685
95 Ga0495610_0003873 3300046512 Bacteria 11367
96 Ga0495618_0000066 3300046514 Bacteria 74940
97 Ga0495631_0070231 3300046518 Bacteria 1514
98 Ga0495632_0028011 3300046519 Bacteria 2943
99 Ga0495637_0024704 3300046520 Bacteria 2718
100 Ga0495643_0000428 3300046522 Bacteria 54821
101 Ga0495643_0000856 3300046522 Bacteria 32746
102 Ga0495648_0037002 3300046524 Plasmid 3141
103 Ga0495666_0003028 3300046526 Bacteria 8438
104 Ga0495654_0033372 3300046530 Bacteria 2606
105 Ga0495654_0034725 3300046530 Bacteria 2543
106 Ga0495587_0017093 3300046536 Bacteria 4510
107 Ga0495597_0036755 3300046542 Bacteria 2203
108 Ga0495633_0003342 3300046558 Bacteria 10771
109 Ga0495611_0104642 3300046648 Unclassified 1316
110 Ga0495625_0002175 3300046660 Bacteria 21767
111 Ga0495661_0001447 3300046665 Bacteria 19860
112 Ga0495661_0015215 3300046665 Bacteria 5136
113 Ga0495661_0144918 3300046665 Unclassified 1288
114 Ga0495670_0056867 3300046691 Unclassified 1963
115 Ga0495671_0004326 3300046692 Bacteria 8532
116 Ga0495671_0041199 3300046692 Bacteria 2326
117 Ga0495649_0006712 3300046694 Bacteria 7137
118 Ga0495672_0011819 3300047320 Bacteria 6132
119 Ga0495676_0000062 3300047321 Bacteria 82614
120 Ga0495680_0252894 3300047322 Unclassified 1248
121 Ga0495687_000996 3300047443 Bacteria 28392
122 Ga0495677_0061190 3300047445 Unclassified 1396
123 Ga0495679_003033 3300047446 Bacteria 8250
124 Ga0495673_0003900 3300047469 Bacteria 9595
125 Ga0495681_0000477 3300047470 Bacteria 30682
126 Ga0495681_0001876 3300047470 Bacteria 15446
127 Ga0495681_0008430 3300047470 Bacteria 6467
128 Ga0495626_0001080 3300048091 Bacteria 23214
129 Ga0495626_0004479 3300048091 Bacteria 8562
130 Ga0496109_0201520 3300048912 Bacteria 1871
131 Ga0496116_0106579 3300048919 Bacteria 1659
132 Ga0496117_0005797 3300048920 Bacteria 12814
133 Ga0496117_0013878 3300048920 Bacteria 6986
134 Ga0496118_0000409 3300048921 Bacteria 71632
135 Ga0496118_0051456 3300048921 Bacteria 3151
136 Ga0496121_0060326 3300048924 Bacteria 3120
137 Ga0496122_0000049 3300048925 Bacteria 268493
138 Ga0496123_0000042 3300048926 Bacteria 254481
139 Ga0496124_0000454 3300048927 Bacteria 71761
140 Ga0496126_0002618 3300048929 Bacteria 23976
141 Ga0496126_0004383 3300048929 Bacteria 16925
142 Ga0501031_0035154 3300049568 Bacteria 3269
143 Ga0501033_0000170 3300049570 Bacteria 62524
144 Ga0501033_0167517 3300049570 Bacteria 1579
145 Ga0501034_0177737 3300049571 Bacteria 2094
146 Ga0501043_0124441 3300049579 Bacteria 2022
147 Ga0501043_0325050 3300049579 Bacteria 1172
148 Ga0501047_0143475 3300049581 Bacteria 2265
149 Ga0501223_000005 3300049663 Bacteria 137995
150 Ga0501225_0000024 3300049705 Bacteria 51541
151 Ga0501035_0102644 3300049822 Bacteria 2509
152 Ga0501044_0169947 3300049823 Bacteria 2152
153 Ga0501044_0562790 3300049823 Bacteria 1036
154 Ga0500566_0003427 3300053094 Bacteria 9458
155 Ga0500628_000062 3300053129 Bacteria 29180
156 Ga0500616_0000588 3300053153 Bacteria 44217

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046542 Ga0495597_0036755 Ga0495597_0036755_1399_2172 256
2 3300046452 Ga0495617_000513 Ga0495617_000513_13377_14273 278
3 3300046530 Ga0495654_0033372 Ga0495654_0033372_784_1680 278
4 3300046660 Ga0495625_0002175 Ga0495625_0002175_6316_7212 278
5 3300007265 Ga0099794_10063271 Ga0099794_100632712 280
6 3300021388 Ga0213875_10012059 Ga0213875_100120594 280
7 3300049568 Ga0501031_0035154 Ga0501031_0035154_258_1163 281
8 3300049570 Ga0501033_0000170 Ga0501033_0000170_53669_54574 281
9 3300049571 Ga0501034_0177737 Ga0501034_0177737_484_1389 281
10 3300049579 Ga0501043_0124441 Ga0501043_0124441_67_972 281
11 3300037853 Ga0436364_0853962 Ga0436364_0853962_4644_5549 283
12 3300013104 Ga0157370_10009154 Ga0157370_1000915412 286
13 3300009098 Ga0105245_10000354 Ga0105245_1000035430 290
14 3300009176 Ga0105242_10003592 Ga0105242_100035928 292
15 3300025934 Ga0207686_10000591 Ga0207686_100005916 292
16 iso_pu_bacteria 2511231014 2511314342 293
17 iso_pu_bacteria 2513237101 2513698365 293
18 iso_pu_bacteria 2585427527 2585532967 293
19 iso_pu_bacteria 2599185248 2599772191 293
20 iso_pu_bacteria 2643221646 2644256218 293
21 iso_pu_bacteria 2738541317 2738948080 293
22 iso_pu_bacteria 2842489311 2842492146 293
23 iso_pu_bacteria 2869162929 2869164181 293
24 iso_pu_bacteria 2874620515 2874622768 293
25 iso_pu_bacteria 2903748898 2903750415 293
26 iso_pu_bacteria 2913308742 2913313079 293
27 iso_pu_bacteria 2921643360 2921646151 293
28 iso_pu_bacteria 2931396565 2931400732 293
29 iso_pu_bacteria 3004167301 3004174570 293
30 iso_pu_bacteria 3005594810 3005602487 293
31 iso_pu_bacteria 3005718088 3005725957 293
32 iso_pu_bacteria 640427133 640486551 293
33 iso_pu_bacteria 8005542996 8005549947 293
34 iso_pu_bacteria 8055266321 8055268375 293
35 iso_pu_bacteria 8056115690 8056120287 293
36 3300005536 Ga0070697_100036751 Ga0070697_1000367514 295
37 iso_pu_bacteria 8006964411 8006970726 295
38 iso_pu_bacteria 8006994254 8007002300 295
39 3300014497 Ga0182008_10008288 Ga0182008_100082883 296
40 3300047443 Ga0495687_000996 Ga0495687_000996_23506_24399 296
41 3300048925 Ga0496122_0000049 Ga0496122_0000049_228775_229665 296
42 3300048926 Ga0496123_0000042 Ga0496123_0000042_24795_25685 296
43 iso_pu_bacteria 2844315083 2844322917 296
44 iso_pu_bacteria 2903727486 2903730009 296
45 iso_pu_bacteria 8056967851 8056971622 296
46 3300001990 JGI24737J22298_10000421 JGI24737J22298_100004215 297
47 3300002067 JGI24735J21928_10000282 JGI24735J21928_1000028215 297
48 3300002070 JGI24750J21931_1000216 JGI24750J21931_10002163 297
49 3300002075 JGI24738J21930_10000098 JGI24738J21930_100000984 297
50 3300003323 rootH1_10232602 rootH1_102326024 297
51 3300005330 Ga0070690_100000552 Ga0070690_10000055211 297
52 3300005335 Ga0070666_10000834 Ga0070666_1000083411 297
53 3300005343 Ga0070687_100097623 Ga0070687_1000976232 297
54 3300005347 Ga0070668_100032509 Ga0070668_1000325095 297
55 3300005355 Ga0070671_100008878 Ga0070671_1000088788 297
56 3300005367 Ga0070667_100002704 Ga0070667_1000027046 297
57 3300005539 Ga0068853_100002551 Ga0068853_1000025519 297
58 3300005544 Ga0070686_100000181 Ga0070686_10000018112 297
59 3300005564 Ga0070664_100037300 Ga0070664_1000373003 297
60 3300005616 Ga0068852_100002228 Ga0068852_1000022284 297
61 3300005618 Ga0068864_100001179 Ga0068864_10000117920 297
62 3300005841 Ga0068863_100000339 Ga0068863_10000033943 297
63 3300005843 Ga0068860_100002491 Ga0068860_10000249112 297
64 3300005843 Ga0068860_100021388 Ga0068860_1000213889 297
65 3300005844 Ga0068862_100000762 Ga0068862_10000076224 297
66 3300006058 Ga0075432_10002253 Ga0075432_100022534 297
67 3300007265 Ga0099794_10008468 Ga0099794_100084682 297
68 3300009011 Ga0105251_10014685 Ga0105251_100146855 297
69 3300009177 Ga0105248_10000841 Ga0105248_1000084115 297
70 3300009553 Ga0105249_10000491 Ga0105249_1000049132 297
71 3300010375 Ga0105239_10006822 Ga0105239_100068229 297
72 3300013102 Ga0157371_10000262 Ga0157371_1000026253 297
73 3300013102 Ga0157371_10117227 Ga0157371_101172272 297
74 3300013104 Ga0157370_10029361 Ga0157370_100293615 297
75 3300013104 Ga0157370_10030521 Ga0157370_100305214 297
76 3300014497 Ga0182008_10000121 Ga0182008_1000012141 297
77 3300015261 Ga0182006_1009730 Ga0182006_10097303 297
78 3300015262 Ga0182007_10088406 Ga0182007_100884061 297
79 3300017792 Ga0163161_10001202 Ga0163161_1000120212 297
80 3300017792 Ga0163161_10003340 Ga0163161_100033408 297
81 3300025735 Ga0207713_1014353 Ga0207713_10143534 297
82 3300025903 Ga0207680_10000041 Ga0207680_1000004113 297
83 3300025904 Ga0207647_10039746 Ga0207647_100397463 297
84 3300025931 Ga0207644_10000091 Ga0207644_1000009155 297
85 3300025941 Ga0207711_10001651 Ga0207711_1000165116 297
86 3300025961 Ga0207712_10000158 Ga0207712_1000015855 297
87 3300025972 Ga0207668_10194285 Ga0207668_101942852 297
88 3300025986 Ga0207658_10002273 Ga0207658_100022734 297
89 3300026041 Ga0207639_10001617 Ga0207639_1000161711 297
90 3300026088 Ga0207641_10000165 Ga0207641_1000016580 297
91 3300026095 Ga0207676_10000275 Ga0207676_1000027536 297
92 3300026142 Ga0207698_10001208 Ga0207698_100012084 297
93 3300027907 Ga0207428_10021516 Ga0207428_100215162 297
94 3300028380 Ga0268265_10000120 Ga0268265_1000012069 297
95 3300028381 Ga0268264_10000350 Ga0268264_1000035055 297
96 3300028381 Ga0268264_10015065 Ga0268264_100150659 297
97 3300031507 Ga0307509_10000006 Ga0307509_10000006245 297
98 3300031711 Ga0265314_10006445 Ga0265314_100064453 297
99 3300031730 Ga0307516_10009061 Ga0307516_100090618 297
100 3300044673 Ga0453683_0059885 Ga0453683_0059885_617_1513 297
101 3300046452 Ga0495617_002912 Ga0495617_002912_5232_6128 297
102 3300046452 Ga0495617_022645 Ga0495617_022645_133_1029 297
103 3300046471 Ga0495650_0058559 Ga0495650_0058559_285_1181 297
104 3300046474 Ga0495605_0001175 Ga0495605_0001175_9333_10229 297
105 3300046491 Ga0495584_0016588 Ga0495584_0016588_2268_3164 297
106 3300046501 Ga0495607_0001457 Ga0495607_0001457_14046_14942 297
107 3300046506 Ga0495583_0000142 Ga0495583_0000142_101477_102373 297
108 3300046507 Ga0495606_0000530 Ga0495606_0000530_8610_9506 297
109 3300046507 Ga0495606_0003802 Ga0495606_0003802_7096_7992 297
110 3300046512 Ga0495610_0003873 Ga0495610_0003873_5568_6464 297
111 3300046514 Ga0495618_0000066 Ga0495618_0000066_68756_69652 297
112 3300046518 Ga0495631_0070231 Ga0495631_0070231_253_1149 297
113 3300046519 Ga0495632_0028011 Ga0495632_0028011_1143_2039 297
114 3300046520 Ga0495637_0024704 Ga0495637_0024704_242_1138 297
115 3300046522 Ga0495643_0000428 Ga0495643_0000428_33466_34362 297
116 3300046522 Ga0495643_0000856 Ga0495643_0000856_21076_21972 297
117 3300046524 Ga0495648_0037002 Ga0495648_0037002_1139_2041 297
118 3300046526 Ga0495666_0003028 Ga0495666_0003028_3829_4725 297
119 3300046530 Ga0495654_0034725 Ga0495654_0034725_440_1336 297
120 3300046558 Ga0495633_0003342 Ga0495633_0003342_8092_8988 297
121 3300046648 Ga0495611_0104642 Ga0495611_0104642_375_1271 297
122 3300046665 Ga0495661_0015215 Ga0495661_0015215_3209_4105 297
123 3300046665 Ga0495661_0144918 Ga0495661_0144918_127_1023 297
124 3300046691 Ga0495670_0056867 Ga0495670_0056867_116_1012 297
125 3300046692 Ga0495671_0004326 Ga0495671_0004326_1112_2008 297
126 3300046692 Ga0495671_0041199 Ga0495671_0041199_766_1662 297
127 3300046694 Ga0495649_0006712 Ga0495649_0006712_1960_2856 297
128 3300047321 Ga0495676_0000062 Ga0495676_0000062_80025_80921 297
129 3300047322 Ga0495680_0252894 Ga0495680_0252894_193_1089 297
130 3300047445 Ga0495677_0061190 Ga0495677_0061190_367_1263 297
131 3300047446 Ga0495679_003033 Ga0495679_003033_6098_6994 297
132 3300047469 Ga0495673_0003900 Ga0495673_0003900_5436_6332 297
133 3300047470 Ga0495681_0000477 Ga0495681_0000477_20117_21013 297
134 3300047470 Ga0495681_0001876 Ga0495681_0001876_7360_8256 297
135 3300047470 Ga0495681_0008430 Ga0495681_0008430_1469_2365 297
136 3300048091 Ga0495626_0001080 Ga0495626_0001080_8413_9309 297
137 3300048912 Ga0496109_0201520 Ga0496109_0201520_87_983 297
138 3300048919 Ga0496116_0106579 Ga0496116_0106579_329_1225 297
139 3300048920 Ga0496117_0005797 Ga0496117_0005797_5335_6231 297
140 3300048920 Ga0496117_0013878 Ga0496117_0013878_1460_2356 297
141 3300048921 Ga0496118_0000409 Ga0496118_0000409_16410_17306 297
142 3300048921 Ga0496118_0051456 Ga0496118_0051456_764_1660 297
143 3300048927 Ga0496124_0000454 Ga0496124_0000454_54756_55652 297
144 3300049570 Ga0501033_0167517 Ga0501033_0167517_254_1150 297
145 3300049579 Ga0501043_0325050 Ga0501043_0325050_122_1018 297
146 3300049581 Ga0501047_0143475 Ga0501047_0143475_414_1310 297
147 3300049822 Ga0501035_0102644 Ga0501035_0102644_621_1517 297
148 3300049823 Ga0501044_0169947 Ga0501044_0169947_59_955 297
149 3300053094 Ga0500566_0003427 Ga0500566_0003427_869_1771 297
150 3300053129 Ga0500628_000062 Ga0500628_000062_4678_5574 297
151 3300053153 Ga0500616_0000588 Ga0500616_0000588_16096_16992 297
152 3300003323 rootH1_10038865 rootH1_100388653 298
153 3300005471 Ga0070698_100172392 Ga0070698_1001723921 298
154 3300026142 Ga0207698_10057302 Ga0207698_100573024 298
155 3300038443 Ga0395901_0000224 Ga0395901_0000224_39125_40024 298
156 3300046500 Ga0495596_0000055 Ga0495596_0000055_35642_36541 298
157 3300046500 Ga0495596_0001045 Ga0495596_0001045_8597_9496 298
158 3300046536 Ga0495587_0017093 Ga0495587_0017093_1686_2585 298
159 3300046665 Ga0495661_0001447 Ga0495661_0001447_4315_5214 298
160 3300047320 Ga0495672_0011819 Ga0495672_0011819_2568_3467 298
161 3300048091 Ga0495626_0004479 Ga0495626_0004479_2489_3388 298
162 3300028556 Ga0265337_1006438 Ga0265337_10064383 299
163 3300028558 Ga0265326_10003699 Ga0265326_100036992 299
164 3300028577 Ga0265318_10002206 Ga0265318_100022066 299
165 3300028654 Ga0265322_10042781 Ga0265322_100427812 299
166 3300029957 Ga0265324_10011999 Ga0265324_100119992 299
167 3300031344 Ga0265316_10013216 Ga0265316_100132166 299
168 3300048929 Ga0496126_0002618 Ga0496126_0002618_20342_21244 299
169 3300048929 Ga0496126_0004383 Ga0496126_0004383_6483_7391 299
170 3300009177 Ga0105248_10360039 Ga0105248_103600391 300
171 3300046500 Ga0495596_0000026 Ga0495596_0000026_91954_92859 300
172 3300048924 Ga0496121_0060326 Ga0496121_0060326_738_1643 300
173 3300049663 Ga0501223_000005 Ga0501223_000005_132242_133147 300
174 3300049705 Ga0501225_0000024 Ga0501225_0000024_16995_17900 300
175 3300049823 Ga0501044_0562790 Ga0501044_0562790_63_971 300
176 iso_pu_bacteria 2906602504 2906603382 301
177 2162886012 MBSR1b_contig_10483077 MBSR1b_0696.00006430 304
178 3300005288 Ga0065714_10064421 Ga0065714_100644217 304
179 3300005290 Ga0065712_10067726 Ga0065712_10067726185 304
180 3300005293 Ga0065715_10089071 Ga0065715_100890717 304
181 3300005345 Ga0070692_10030152 Ga0070692_100301522 304
182 3300005444 Ga0070694_100002531 Ga0070694_1000025315 304

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00004

AAA

ATPase family associated with various cellular activities (AAA)

104

245

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6p8v-assembly1.cif.gz_B structure of e. coli ms115-1 horma:cdnc:trip13 complex 0.8801 11 302
6p8v-assembly1.cif.gz_A structure of e. coli ms115-1 horma:cdnc:trip13 complex 0.8797 11 302
6p8v-assembly1.cif.gz_A structure of e. coli ms115-1 horma:cdnc:trip13 complex 0.8524 11 302
6p8v-assembly1.cif.gz_B structure of e. coli ms115-1 horma:cdnc:trip13 complex 0.8504 11 302
6p8v-assembly1.cif.gz_E structure of e. coli ms115-1 horma:cdnc:trip13 complex 0.8152 10 302
ID Description Score Start End Superfamily
af_Q0IR92_11_102_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.869 125 211 3.40.50.300
af_Q4DFV8_2_126_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.838 94 210 3.40.50.300
af_A0A0R0EXN2_381_538_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8361 74 218 3.40.50.300
af_Q4DFV8_6_114_1.10.8.60 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8306 97 210 1.10.8.60
1r7rA05 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.813 72 217 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1G8LX95-F1-model_v4 ATPase family associated with various cellular activities (AAA) 0.9669 7 302 GO:0005524
GO:0016887
AF-A0A3G6TLS3-F1-model_v4 deleted 0.9596 8 302
AF-A0A1G8LX95-F1-model_v4 ATPase family associated with various cellular activities (AAA) 0.9542 7 302 GO:0005524
GO:0016887
AF-A0A3G6TLS3-F1-model_v4 deleted 0.9501 8 302
AF-A0A377F602-F1-model_v4 ATPase 0.9277 147 304 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
88.97 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map