F279845

General Info

Members Datasets Scaffolds Average Seq Length
182 121 364 228

Family's Representative Sequence

Representative Sequence 3300049579|Ga0501043_0238195|Ga0501043_0238195_286_1047
Length 253
Sequence MTGKHPSPKHRPDVLTAVWQSASLLLGYPDETLLADLPLVRAAADTVPDQLADPLRAVADRLESMPLEAAQAAYVDTFDNRRRCSLFLTYFAHGDTRKRGVALLRFKQTYLRSGFVLDEHGGELPDHLCVVLEYAATVDQKLGWRLILDHRAGLELLRLTLTDTGSPWAGAVQAVCATLPPLRGDERDAVRQLAAEGPPAEEVGMTPYGTPAFDAALMAVPTGATYSPGRTQDLPMPGIGAPALAHGVRGAAR

Samples

Sample ID Description Type Environment
1 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
33 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
34 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
50 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
51 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
52 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
53 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
54 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
55 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
56 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
57 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
58 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
59 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
60 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
61 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
62 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
63 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
64 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
65 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
66 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
67 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
68 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
69 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
70 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
71 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
72 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
73 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
74 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
75 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
76 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
77 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
78 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
79 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
80 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
81 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
82 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
97 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
98 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
99 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
100 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
101 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
102 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
103 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
104 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
105 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
106 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
109 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
110 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
111 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
112 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
113 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
114 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
115 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
116 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
117 2643221576 Nocardioides sp. Root614 Isolate Unclassified
118 2643221590 Nocardioides sp. Root682 Isolate Unclassified
119 2643221641 Nocardioides sp. Root122 Isolate Unclassified
120 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
121 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.25
Metatranscriptomes 0
Isolates 2.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.95
Nodule 0
Rhizoplane 18.13
Rhizosphere 73.08
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501043_0238195 3300049579 Bacteria 1404
2 JGI24737J22298_10005848 3300001990 Bacteria 4235
3 JGI24743J22301_10000461 3300001991 Bacteria 4670
4 rootH1_10035215 3300003323 Bacteria 1005
5 Ga0070658_10502788 3300005327 Bacteria 1047
6 Ga0070683_100309208 3300005329 Bacteria 1504
7 Ga0070683_100517827 3300005329 Bacteria 1140
8 Ga0070682_100046094 3300005337 Bacteria 2704
9 Ga0070692_10313403 3300005345 Bacteria 962
10 Ga0070659_100020194 3300005366 Bacteria 5058
11 Ga0070713_100125827 3300005436 Bacteria 2254
12 Ga0070710_10235436 3300005437 Bacteria 1171
13 Ga0070679_100214428 3300005530 Bacteria 1888
14 Ga0070684_100069653 3300005535 Bacteria 3093
15 Ga0068853_101068053 3300005539 Bacteria 778
16 Ga0070665_100000151 3300005548 Bacteria 127579
17 Ga0068855_101005448 3300005563 Bacteria 876
18 Ga0068857_100017446 3300005577 Bacteria 6292
19 Ga0068854_100190361 3300005578 Bacteria 1607
20 Ga0081455_10204315 3300005937 Bacteria 1477
21 Ga0075365_10099526 3300006038 Bacteria 1990
22 Ga0075363_100000536 3300006048 Bacteria 12260
23 Ga0075364_10007240 3300006051 Bacteria 6576
24 Ga0075370_10005529 3300006353 Bacteria 6294
25 Ga0075428_100524441 3300006844 Bacteria 1267
26 Ga0111539_10114837 3300009094 Bacteria 3158
27 Ga0111539_11406566 3300009094 Bacteria 809
28 Ga0105245_10282092 3300009098 Bacteria 1624
29 Ga0105245_11236952 3300009098 Bacteria 795
30 Ga0105243_10178725 3300009148 Bacteria 1844
31 Ga0105246_10223861 3300011119 Bacteria 1476
32 Ga0157369_10378045 3300013105 Bacteria 1470
33 Ga0157372_10162781 3300013307 Bacteria 2579
34 Ga0157372_10387289 3300013307 Bacteria 1629
35 Ga0157375_10375432 3300013308 Bacteria 1588
36 Ga0157375_10467348 3300013308 Bacteria 1427
37 Ga0157380_10360783 3300014326 Bacteria 1363
38 Ga0157380_10502616 3300014326 Bacteria 1178
39 Ga0157380_10561598 3300014326 Bacteria 1122
40 Ga0157380_11001424 3300014326 Bacteria 869
41 Ga0157377_10001248 3300014745 Bacteria 10873
42 Ga0207692_10392179 3300025898 Bacteria 864
43 Ga0207647_10006214 3300025904 Bacteria 8706
44 Ga0207647_10036307 3300025904 Bacteria 3132
45 Ga0207705_10135906 3300025909 Bacteria 1833
46 Ga0207705_10504247 3300025909 Bacteria 940
47 Ga0207652_10264499 3300025921 Bacteria 1551
48 Ga0207687_10141904 3300025927 Bacteria 1823
49 Ga0207690_10036921 3300025932 Bacteria 3168
50 Ga0207709_10088209 3300025935 Bacteria 2019
51 Ga0207709_10442877 3300025935 Bacteria 1002
52 Ga0207704_10205050 3300025938 Bacteria 1446
53 Ga0207667_10772563 3300025949 Bacteria 959
54 Ga0207668_10188612 3300025972 Bacteria 1632
55 Ga0207640_10080934 3300025981 Bacteria 2219
56 Ga0207639_10083215 3300026041 Bacteria 2539
57 Ga0207678_10216221 3300026067 Bacteria 1640
58 Ga0207674_10216777 3300026116 Bacteria 1862
59 Ga0207674_10288014 3300026116 Bacteria 1591
60 Ga0268266_10003412 3300028379 Bacteria 15900
61 Ga0316181_1204320 3300030744 Bacteria 1161
62 Ga0307405_10117756 3300031731 Bacteria 1812
63 Ga0307405_10769096 3300031731 Bacteria 804
64 Ga0307410_10159394 3300031852 Bacteria 1689
65 Ga0307410_10761325 3300031852 Bacteria 821
66 Ga0307407_10375191 3300031903 Bacteria 1014
67 Ga0307409_100064370 3300031995 Bacteria 2880
68 Ga0307409_100096338 3300031995 Bacteria 2441
69 Ga0307409_100500674 3300031995 Bacteria 1183
70 Ga0307409_100548773 3300031995 Bacteria 1134
71 Ga0307409_101155192 3300031995 Bacteria 797
72 Ga0307416_101059184 3300032002 Bacteria 915
73 Ga0307414_10502679 3300032004 Bacteria 1073
74 Ga0307411_10115426 3300032005 Bacteria 1931
75 Ga0395900_0142360 3300037418 Bacteria 2455
76 Ga0395898_0002239 3300037466 Bacteria 23529
77 Ga0395898_0851181 3300037466 Bacteria 851
78 Ga0395901_0032777 3300038443 Bacteria 5360
79 Ga0395901_0092235 3300038443 Bacteria 3171
80 Ga0451791_0603636 3300041451 Bacteria 760
81 Ga0451802_0572019 3300041460 Bacteria 1170
82 Ga0451837_1393737 3300041494 Bacteria 1367
83 Ga0451853_3999189 3300041512 Bacteria 1121
84 Ga0466967_0132402 3300045976 Bacteria 2316
85 Ga0495582_0236856 3300046473 Bacteria 1046
86 Ga0495585_0197640 3300046492 Bacteria 1026
87 Ga0495647_0225260 3300046681 Bacteria 829
88 Ga0496100_0046541 3300048903 Bacteria 2790
89 Ga0496100_0065608 3300048903 Bacteria 2406
90 Ga0496101_0160556 3300048904 Bacteria 1723
91 Ga0496102_0009423 3300048905 Bacteria 8389
92 Ga0496102_0025065 3300048905 Bacteria 5305
93 Ga0496102_0929282 3300048905 Bacteria 791
94 Ga0496103_0012738 3300048906 Bacteria 4988
95 Ga0496104_0003571 3300048907 Bacteria 13423
96 Ga0496106_0035642 3300048909 Bacteria 3720
97 Ga0496107_0013069 3300048910 Bacteria 5800
98 Ga0496107_0039569 3300048910 Bacteria 3382
99 Ga0496108_0078936 3300048911 Bacteria 2786
100 Ga0496108_0122396 3300048911 Bacteria 2232
101 Ga0496108_0167339 3300048911 Bacteria 1901
102 Ga0496109_0124155 3300048912 Bacteria 2406
103 Ga0496109_0176761 3300048912 Bacteria 2004
104 Ga0496109_0251007 3300048912 Bacteria 1666
105 Ga0496109_0874401 3300048912 Bacteria 837
106 Ga0496110_0041350 3300048913 Bacteria 4022
107 Ga0496110_0145417 3300048913 Bacteria 2144
108 Ga0496111_0098897 3300048914 Bacteria 2142
109 Ga0496111_0359868 3300048914 Bacteria 1077
110 Ga0496112_0304847 3300048915 Bacteria 1538
111 Ga0496112_0672546 3300048915 Bacteria 964
112 Ga0496114_0018841 3300048917 Bacteria 5589
113 Ga0496114_0031148 3300048917 Bacteria 4387
114 Ga0496114_0079431 3300048917 Bacteria 2769
115 Ga0496114_0122603 3300048917 Bacteria 2237
116 Ga0496114_0207589 3300048917 Bacteria 1717
117 Ga0496114_0377704 3300048917 Bacteria 1254
118 Ga0496115_0005267 3300048918 Bacteria 9401
119 Ga0501031_0003388 3300049568 Bacteria 10230
120 Ga0501031_0375300 3300049568 Bacteria 920
121 Ga0501032_0058243 3300049569 Bacteria 2594
122 Ga0501033_0036388 3300049570 Bacteria 3689
123 Ga0501034_0166072 3300049571 Bacteria 2176
124 Ga0501036_0226908 3300049572 Bacteria 1568
125 Ga0501037_0096210 3300049573 Bacteria 2140
126 Ga0501038_0012405 3300049574 Bacteria 7788
127 Ga0501039_0045891 3300049575 Bacteria 3376
128 Ga0501039_0452567 3300049575 Bacteria 1008
129 Ga0501040_0093533 3300049576 Bacteria 2091
130 Ga0501040_0440929 3300049576 Bacteria 937
131 Ga0501041_0018436 3300049577 Bacteria 4158
132 Ga0501041_0306325 3300049577 Bacteria 1001
133 Ga0501042_0019965 3300049578 Bacteria 4660
134 Ga0501042_0156097 3300049578 Bacteria 1646
135 Ga0501043_0044626 3300049579 Bacteria 3486
136 Ga0501043_0466905 3300049579 Bacteria 946
137 Ga0501043_0480100 3300049579 Bacteria 931
138 Ga0501046_0003372 3300049580 Bacteria 14666
139 Ga0501046_0068833 3300049580 Bacteria 2755
140 Ga0501047_0014870 3300049581 Bacteria 7408
141 Ga0501048_0027266 3300049582 Bacteria 4154
142 Ga0501067_0018414 3300049583 Bacteria 3869
143 Ga0501068_0052054 3300049584 Bacteria 2478
144 Ga0501068_0078233 3300049584 Bacteria 2026
145 Ga0501068_0362617 3300049584 Bacteria 932
146 Ga0501070_0018506 3300049586 Bacteria 5845
147 Ga0501070_0192857 3300049586 Bacteria 1674
148 Ga0501070_0197021 3300049586 Bacteria 1654
149 Ga0501070_0575744 3300049586 Bacteria 899
150 Ga0501070_0678617 3300049586 Bacteria 816
151 Ga0501071_0017089 3300049587 Bacteria 4998
152 Ga0501071_0071863 3300049587 Bacteria 2523
153 Ga0501072_0053582 3300049588 Bacteria 3177
154 Ga0501072_0475150 3300049588 Bacteria 989
155 Ga0501073_0034163 3300049589 Bacteria 3620
156 Ga0501073_0214985 3300049589 Bacteria 1328
157 Ga0501074_0010913 3300049590 Bacteria 6594
158 Ga0501074_0183120 3300049590 Bacteria 1494
159 Ga0501076_0013168 3300049592 Bacteria 6195
160 Ga0501076_0299337 3300049592 Bacteria 1319
161 Ga0501077_0082274 3300049593 Bacteria 2040
162 Ga0501077_0375872 3300049593 Bacteria 908
163 Ga0501080_0263378 3300049742 Bacteria 1570
164 Ga0501035_0004267 3300049822 Bacteria 13572
165 Ga0501035_0042488 3300049822 Bacteria 4100
166 Ga0501044_0004663 3300049823 Bacteria 15339
167 Ga0501045_0048062 3300049824 Bacteria 3110
168 nmdc:mga03n38_9357_c1 3300050490 Bacteria 3562
169 nmdc:mga00v17_5249_c1 3300050491 Bacteria 6822
170 nmdc:mga00v17_57986_c1 3300050491 Bacteria 2370
171 nmdc:mga0yw44_49570_c1 3300050492 Bacteria 2535
172 nmdc:mga07m45_3517_c1 3300050496 Bacteria 7560
173 nmdc:mga08y16_22454_c1 3300050511 Bacteria 6660
174 Ga0495655_0138343 3300053083 Bacteria 756
175 Ga0501084_0043685 3300054114 Bacteria 3749
176 Ga0501084_0407094 3300054114 Bacteria 1150
177 Ga0501082_0214504 3300060353 Bacteria 1674
178 2643889376 2643221576 Bacteria 5214352
179 2643958431 2643221590 Bacteria 5214697
180 2644229421 2643221641 Bacteria 4490190
181 2812333055 2811994874 Bacteria 5367947
182 2816424946 2816332119 Bacteria 8120218
183 Ga0501043_0238195
184 JGI24737J22298_10005848
185 JGI24743J22301_10000461
186 rootH1_10035215
187 Ga0070658_10502788
188 Ga0070683_100309208
189 Ga0070683_100517827
190 Ga0070682_100046094
191 Ga0070692_10313403
192 Ga0070659_100020194
193 Ga0070713_100125827
194 Ga0070710_10235436
195 Ga0070679_100214428
196 Ga0070684_100069653
197 Ga0068853_101068053
198 Ga0070665_100000151
199 Ga0068855_101005448
200 Ga0068857_100017446
201 Ga0068854_100190361
202 Ga0081455_10204315
203 Ga0075365_10099526
204 Ga0075363_100000536
205 Ga0075364_10007240
206 Ga0075370_10005529
207 Ga0075428_100524441
208 Ga0111539_10114837
209 Ga0111539_11406566
210 Ga0105245_10282092
211 Ga0105245_11236952
212 Ga0105243_10178725
213 Ga0105246_10223861
214 Ga0157369_10378045
215 Ga0157372_10162781
216 Ga0157372_10387289
217 Ga0157375_10375432
218 Ga0157375_10467348
219 Ga0157380_10360783
220 Ga0157380_10502616
221 Ga0157380_10561598
222 Ga0157380_11001424
223 Ga0157377_10001248
224 Ga0207692_10392179
225 Ga0207647_10006214
226 Ga0207647_10036307
227 Ga0207705_10135906
228 Ga0207705_10504247
229 Ga0207652_10264499
230 Ga0207687_10141904
231 Ga0207690_10036921
232 Ga0207709_10088209
233 Ga0207709_10442877
234 Ga0207704_10205050
235 Ga0207667_10772563
236 Ga0207668_10188612
237 Ga0207640_10080934
238 Ga0207639_10083215
239 Ga0207678_10216221
240 Ga0207674_10216777
241 Ga0207674_10288014
242 Ga0268266_10003412
243 Ga0316181_1204320
244 Ga0307405_10117756
245 Ga0307405_10769096
246 Ga0307410_10159394
247 Ga0307410_10761325
248 Ga0307407_10375191
249 Ga0307409_100064370
250 Ga0307409_100096338
251 Ga0307409_100500674
252 Ga0307409_100548773
253 Ga0307409_101155192
254 Ga0307416_101059184
255 Ga0307414_10502679
256 Ga0307411_10115426
257 Ga0395900_0142360
258 Ga0395898_0002239
259 Ga0395898_0851181
260 Ga0395901_0032777
261 Ga0395901_0092235
262 Ga0451791_0603636
263 Ga0451802_0572019
264 Ga0451837_1393737
265 Ga0451853_3999189
266 Ga0466967_0132402
267 Ga0495582_0236856
268 Ga0495585_0197640
269 Ga0495647_0225260
270 Ga0496100_0046541
271 Ga0496100_0065608
272 Ga0496101_0160556
273 Ga0496102_0009423
274 Ga0496102_0025065
275 Ga0496102_0929282
276 Ga0496103_0012738
277 Ga0496104_0003571
278 Ga0496106_0035642
279 Ga0496107_0013069
280 Ga0496107_0039569
281 Ga0496108_0078936
282 Ga0496108_0122396
283 Ga0496108_0167339
284 Ga0496109_0124155
285 Ga0496109_0176761
286 Ga0496109_0251007
287 Ga0496109_0874401
288 Ga0496110_0041350
289 Ga0496110_0145417
290 Ga0496111_0098897
291 Ga0496111_0359868
292 Ga0496112_0304847
293 Ga0496112_0672546
294 Ga0496114_0018841
295 Ga0496114_0031148
296 Ga0496114_0079431
297 Ga0496114_0122603
298 Ga0496114_0207589
299 Ga0496114_0377704
300 Ga0496115_0005267
301 Ga0501031_0003388
302 Ga0501031_0375300
303 Ga0501032_0058243
304 Ga0501033_0036388
305 Ga0501034_0166072
306 Ga0501036_0226908
307 Ga0501037_0096210
308 Ga0501038_0012405
309 Ga0501039_0045891
310 Ga0501039_0452567
311 Ga0501040_0093533
312 Ga0501040_0440929
313 Ga0501041_0018436
314 Ga0501041_0306325
315 Ga0501042_0019965
316 Ga0501042_0156097
317 Ga0501043_0044626
318 Ga0501043_0466905
319 Ga0501043_0480100
320 Ga0501046_0003372
321 Ga0501046_0068833
322 Ga0501047_0014870
323 Ga0501048_0027266
324 Ga0501067_0018414
325 Ga0501068_0052054
326 Ga0501068_0078233
327 Ga0501068_0362617
328 Ga0501070_0018506
329 Ga0501070_0192857
330 Ga0501070_0197021
331 Ga0501070_0575744
332 Ga0501070_0678617
333 Ga0501071_0017089
334 Ga0501071_0071863
335 Ga0501072_0053582
336 Ga0501072_0475150
337 Ga0501073_0034163
338 Ga0501073_0214985
339 Ga0501074_0010913
340 Ga0501074_0183120
341 Ga0501076_0013168
342 Ga0501076_0299337
343 Ga0501077_0082274
344 Ga0501077_0375872
345 Ga0501080_0263378
346 Ga0501035_0004267
347 Ga0501035_0042488
348 Ga0501044_0004663
349 Ga0501045_0048062
350 nmdc:mga03n38_9357_c1
351 nmdc:mga00v17_5249_c1
352 nmdc:mga00v17_57986_c1
353 nmdc:mga0yw44_49570_c1
354 nmdc:mga07m45_3517_c1
355 nmdc:mga08y16_22454_c1
356 Ga0495655_0138343
357 Ga0501084_0043685
358 Ga0501084_0407094
359 Ga0501082_0214504
360 2643889376
361 2643958431
362 2644229421
363 2812333055
364 2816424946

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02613

Nitrate_red_del

Nitrate reductase delta subunit

44

174

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o9x-assembly1.cif.gz_A crystal structure of a putative redox enzyme maturation protein from archaeoglobus fulgidus 0.748 14 173
2o9x-assembly1.cif.gz_A crystal structure of a putative redox enzyme maturation protein from archaeoglobus fulgidus 0.6953 14 173
2yjm-assembly1.cif.gz_A structure of ttrd from archaeoglobus fulgidus 0.3976 13 191
2yjm-assembly1.cif.gz_A structure of ttrd from archaeoglobus fulgidus 0.3702 13 191
2idg-assembly4.cif.gz_C crystal structure of hypothetical protein af0160 from archaeoglobus fulgidus 0.3281 47 191
ID Description Score Start End Superfamily
af_P9WJQ1_274_409_1.10.3480.10 Mainly Alpha;Orthogonal Bundle;TorD-like;TorD-like 0.9366 40 168 1.10.3480.10
af_O06561_3_176_1.10.3480.10 Mainly Alpha;Orthogonal Bundle;TorD-like;TorD-like 0.9275 19 190 1.10.3480.10
af_O06561_3_176_1.10.3480.10 Mainly Alpha;Orthogonal Bundle;TorD-like;TorD-like 0.9123 19 190 1.10.3480.10
af_P0AF26_5_149_1.10.3480.10 Mainly Alpha;Orthogonal Bundle;TorD-like;TorD-like 0.8902 19 158 1.10.3480.10
af_P9WJQ1_274_409_1.10.3480.10 Mainly Alpha;Orthogonal Bundle;TorD-like;TorD-like 0.8841 40 168 1.10.3480.10
ID Description Score Start End GO Terms
AF-A0A654TA08-F1-model_v4 Nitrate reductase NarX (EC 1.7.99.4) 0.9539 42 171 GO:0005886
GO:0008940
GO:0009055
GO:0009325
GO:0019645
GO:0020037
GO:0042128
GO:0046872
GO:0051082
GO:0051131
AF-A0A4R3CKM4-F1-model_v4 deleted 0.9513 12 175
AF-A0A655A1B6-F1-model_v4 Nitrate reductase NarX (EC 1.7.99.4) 0.9471 12 174 GO:0005886
GO:0008940
GO:0009055
GO:0009325
GO:0019645
GO:0020037
GO:0042128
GO:0046872
GO:0051082
GO:0051131
AF-A0A655I5J4-F1-model_v4 deleted 0.9468 12 174
AF-A0A7U8UIJ3-F1-model_v4 deleted 0.9449 11 174

Map