F279749

General Info

Members Datasets Scaffolds Average Seq Length
182 159 364 394

Family's Representative Sequence

Representative Sequence 3300047444|Ga0495675_0051548|Ga0495675_0051548_18_1595
Length 478
Sequence MTRKAAPVSRTQRTRPPGPPEATAGAGHPAVPGNTGAAVASVPAERSRXXGPIGASRLFRRTGLSFRTATADRVGRLGAAPVFRGPRLSRRSGALAAVLAASLALVPSTAAHADGIRAQQWGLDAMHTQQAWRTTKGRGITVAVLDTGVDSRHPDLAGNVLAEKDMVGFGASRGDRAWARHGTAMAGIIAGHGHGAGHADGVMGIAPQAKILPVRVILEDGDPARSKARNTRGNALADGIRWATDHGADVINLSLGDDSKSAHPEPAEDEAVQYALKKGVVVVASAGNGGEKGDHISYPAAYPGVIAATAVDRYGTHASFSTRRWYATVSAPGVDVVIADPDDRYYEGWGTSAASAFVSGAVALIEAAHPGLSPAQIKQLLEDTARNVPSGGRDDSRGFGFIDPAAAITAAGKLKAEGLKPAAYGQKYFGTGPDTHGDDSGPADWAGPLAGVLGLALLGAAVFLWRGRRSPHPFDRRP

Samples

Sample ID Description Type Environment
1 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
6 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
7 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
8 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
9 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
10 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
11 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
12 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
13 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
14 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
15 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
16 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
17 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
18 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
19 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
20 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
21 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
22 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
23 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
24 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
25 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
26 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
27 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
28 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
29 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
30 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
31 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
32 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
33 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
34 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
35 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
36 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
37 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
38 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
39 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
40 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
41 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
42 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
43 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
44 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
45 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
46 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
47 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
48 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
49 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
50 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
51 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
52 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
53 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
54 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
55 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
56 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
57 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
58 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
59 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
60 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
61 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
62 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
63 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
64 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
65 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
66 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
67 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
68 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
69 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
70 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
71 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
72 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
73 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
74 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
75 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
76 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
77 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
78 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
79 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
80 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
81 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
82 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
83 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
84 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
85 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
86 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
87 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
88 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
89 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
90 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
91 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
93 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
94 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
95 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
96 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
97 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
98 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
99 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
100 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
101 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
102 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
103 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
104 2643221548 Streptomyces sp. Root55 Isolate Unclassified
105 2643221578 Streptomyces sp. Root63 Isolate Unclassified
106 2643221647 Streptomyces sp. Root369 Isolate Unclassified
107 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
108 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
109 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
110 2643221714 Streptomyces sp. Root264 Isolate Unclassified
111 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
112 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
113 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
114 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
115 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
116 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
117 2808606448 Streptomyces sp. 193411 Isolate Unclassified
118 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
119 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
120 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
121 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
122 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
123 2862574272 Streptomyces sp. AcE210 Isolate Nodule
124 2867428634 Streptomyces sp. RP5T Isolate Unclassified
125 2867475112 Streptomyces sp. TM32 Isolate Unclassified
126 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
127 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
128 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
129 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
130 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
131 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
132 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
133 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
134 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
135 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
136 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
137 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
138 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
139 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
140 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
141 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
142 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
143 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
144 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
145 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
146 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
147 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
148 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
149 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
150 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
151 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
152 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
153 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
154 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
155 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
156 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
157 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
158 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
159 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 67.03
Metatranscriptomes 0
Isolates 32.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.85
Nodule 0.55
Rhizoplane 0
Rhizosphere 71.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495675_0051548 3300047444 Bacteria 2613
2 JGI24737J22298_10023738 3300001990 Bacteria 1944
3 rootL2_10111192 3300003322 Bacteria 2393
4 rootH1_10069651 3300003323 Bacteria 1639
5 Ga0068856_100175693 3300005614 Bacteria 2154
6 Ga0075368_10024981 3300006042 Bacteria 2291
7 Ga0075367_10004553 3300006178 Bacteria 6785
8 Ga0157369_10462705 3300013105 Bacteria 1313
9 Ga0182008_10003190 3300014497 Bacteria 10023
10 Ga0182007_10003107 3300015262 Bacteria 7990
11 Ga0183367_1010 3300015688 Bacteria 416164
12 Ga0207426_1007294 3300025302 Bacteria 4648
13 Ga0307517_10023864 3300028786 Bacteria 7574
14 Ga0307515_10000845 3300028794 Bacteria 70367
15 Ga0307515_10103841 3300028794 Bacteria 3403
16 Ga0307512_10000948 3300030522 Bacteria 42647
17 Ga0307512_10036500 3300030522 Bacteria 4166
18 Ga0307512_10096950 3300030522 Bacteria 2020
19 Ga0307513_10071222 3300031456 Bacteria 3629
20 Ga0307513_10081702 3300031456 Bacteria 3329
21 Ga0307509_10038163 3300031507 Bacteria 5243
22 Ga0307509_10095629 3300031507 Bacteria 3025
23 Ga0307508_10054953 3300031616 Bacteria 3528
24 Ga0307508_10107268 3300031616 Bacteria 2391
25 Ga0307508_10145759 3300031616 Bacteria 1971
26 Ga0307514_10143768 3300031649 Bacteria 1616
27 Ga0307516_10002739 3300031730 Bacteria 23246
28 Ga0307518_10009679 3300031838 Bacteria 6881
29 Ga0307518_10028549 3300031838 Bacteria 4028
30 Ga0307507_10015327 3300033179 Bacteria 9026
31 Ga0307510_10040908 3300033180 Bacteria 5078
32 Ga0395898_0060733 3300037466 Bacteria 3673
33 Ga0439439_0004089 3300041406 Bacteria 3261
34 Ga0451837_0178013 3300041494 Bacteria 2167
35 Ga0439433_0007120 3300041999 Bacteria 2414
36 Ga0439448_0012422 3300042005 Bacteria 2549
37 Ga0439449_0030700 3300042007 Bacteria 2003
38 Ga0439462_0009353 3300042015 Bacteria 2478
39 Ga0450903_001271 3300042138 Bacteria 4723
40 Ga0439458_0000435 3300042157 Bacteria 10546
41 Ga0439458_0027490 3300042157 Bacteria 1342
42 Ga0466969_0019065 3300044656 Bacteria 3569
43 Ga0466972_0007319 3300044658 Bacteria 5541
44 Ga0466972_0022797 3300044658 Bacteria 3115
45 Ga0466965_0000971 3300044683 Bacteria 11091
46 Ga0466966_0001954 3300044684 Bacteria 13345
47 Ga0466963_0001021 3300044694 Bacteria 14505
48 Ga0466964_0002720 3300044706 Bacteria 6346
49 Ga0466971_0000777 3300044719 Bacteria 12816
50 Ga0466970_0000651 3300044765 Bacteria 17075
51 Ga0466970_0003370 3300044765 Bacteria 7776
52 Ga0466957_0001364 3300044842 Bacteria 12746
53 Ga0466959_0008830 3300045049 Bacteria 7141
54 Ga0466958_0008009 3300045836 Bacteria 5843
55 Ga0466967_0005581 3300045976 Bacteria 8745
56 Ga0495592_0059452 3300046454 Bacteria 2815
57 Ga0495603_0009008 3300046455 Bacteria 6037
58 Ga0495603_0062736 3300046455 Bacteria 2193
59 Ga0495603_0077876 3300046455 Bacteria 1944
60 Ga0495651_0028002 3300046462 Bacteria 4392
61 Ga0495662_0003272 3300046476 Bacteria 8195
62 Ga0495664_0004069 3300046477 Bacteria 7973
63 Ga0495585_0061309 3300046492 Bacteria 2068
64 Ga0495594_0017545 3300046499 Bacteria 3783
65 Ga0495594_0026643 3300046499 Bacteria 3111
66 Ga0495607_0042289 3300046501 Bacteria 2701
67 Ga0495606_0004225 3300046507 Bacteria 14537
68 Ga0495610_0013892 3300046512 Bacteria 4759
69 Ga0495618_0034983 3300046514 Bacteria 3152
70 Ga0495628_0028177 3300046516 Bacteria 4566
71 Ga0495631_0002943 3300046518 Bacteria 9435
72 Ga0495642_0017897 3300046528 Bacteria 2770
73 Ga0495652_0163465 3300046529 Bacteria 1725
74 Ga0495640_0056527 3300046533 Bacteria 2681
75 Ga0495587_0004483 3300046536 Bacteria 9185
76 Ga0495609_0046947 3300046538 Bacteria 1933
77 Ga0495597_0004370 3300046542 Bacteria 7795
78 Ga0495645_0054940 3300046543 Bacteria 2892
79 Ga0495645_0113960 3300046543 Bacteria 1911
80 Ga0495622_0010088 3300046557 Bacteria 4370
81 Ga0495633_0042177 3300046558 Bacteria 2168
82 Ga0495634_0002715 3300046642 Bacteria 14554
83 Ga0495611_0073565 3300046648 Bacteria 1564
84 Ga0495625_0009180 3300046660 Bacteria 8309
85 Ga0495625_0013490 3300046660 Bacteria 6563
86 Ga0495635_0000610 3300046663 Bacteria 23008
87 Ga0495588_0131815 3300046674 Bacteria 1318
88 Ga0495657_0032375 3300046675 Bacteria 3648
89 Ga0495646_0003575 3300046680 Bacteria 9700
90 Ga0495658_0009324 3300046683 Bacteria 4889
91 Ga0495613_0013326 3300046689 Bacteria 6107
92 Ga0495613_0175642 3300046689 Bacteria 1518
93 Ga0495624_0020538 3300046690 Bacteria 4392
94 Ga0495671_0006511 3300046692 Bacteria 6743
95 Ga0495589_0007905 3300046794 Bacteria 5569
96 Ga0495589_0019466 3300046794 Bacteria 3479
97 Ga0495589_0029497 3300046794 Bacteria 2765
98 Ga0495600_0017786 3300046809 Bacteria 4524
99 Ga0495581_0012278 3300047315 Bacteria 4961
100 Ga0495581_0100235 3300047315 Bacteria 1683
101 Ga0495604_0006334 3300047317 Bacteria 9386
102 Ga0495636_0031362 3300047318 Bacteria 2178
103 Ga0495674_0164314 3300047319 Bacteria 1856
104 Ga0495676_0006209 3300047321 Bacteria 10989
105 Ga0495676_0019505 3300047321 Bacteria 5962
106 Ga0495676_0021910 3300047321 Bacteria 5570
107 Ga0495687_006965 3300047443 Bacteria 6791
108 Ga0495675_0118525 3300047444 Bacteria 1649
109 Ga0495685_009117 3300047447 Bacteria 3309
110 Ga0495681_0007681 3300047470 Bacteria 6844
111 Ga0495686_0024196 3300047472 Bacteria 3994
112 Ga0495602_0012382 3300048088 Bacteria 8772
113 Ga0495682_0035662 3300049460 Bacteria 1832
114 Ga0501047_0077971 3300049581 Bacteria 3186
115 Ga0501080_0056947 3300049742 Bacteria 3640
116 Ga0501035_0074794 3300049822 Bacteria 2996
117 nmdc:mga06z11_2935_c1 3300050494 Bacteria 6564
118 nmdc:mga04h51_22558_c1 3300050495 Bacteria 1906
119 Ga0500610_0030980 3300053079 Bacteria 2714
120 Ga0495619_0145471 3300053085 Bacteria 1634
121 Ga0500572_006190 3300053111 Bacteria 2735
122 Ga0466962_0000270 3300061719 Bacteria 21922
123 2547406640 2547132111 Bacteria 8013147
124 2585303664 2582581313 Bacteria 10042643
125 2585321117 2582581314 Bacteria 11452267
126 2616900724 2616644941 Bacteria 8510691
127 2643760094 2643221548 Bacteria 8053412
128 2643904596 2643221578 Bacteria 9213798
129 2644268137 2643221647 Bacteria 10741251
130 2644406138 2643221673 Bacteria 9196637
131 2644443808 2643221678 Bacteria 9540101
132 2644460207 2643221682 Bacteria 6743283
133 2644629728 2643221714 Bacteria 9015452
134 2784586852 2784132148 Bacteria 8627943
135 2785367270 2784746768 Bacteria 10036182
136 2786668316 2786546132 Bacteria 10419719
137 2804843898 2802429296 Bacteria 7227771
138 2808847771 2808606359 Bacteria 9866990
139 2808918510 2808606375 Bacteria 9466072
140 2809230419 2808606448 Bacteria 8656184
141 2812360198 2811994879 Bacteria 9313447
142 2819696505 2818991463 Bacteria 7948711
143 2852637831 2852635781 Bacteria 8251373
144 2862186154 2862178590 Bacteria 8583590
145 2862289543 2862281513 Bacteria 9621493
146 2862583615 2862574272 Bacteria 10567477
147 2867432134 2867428634 Bacteria 9590268
148 2867476952 2867475112 Bacteria 6909112
149 2873157580 2873151551 Bacteria 8625867
150 2875392795 2875391855 Bacteria 7600475
151 2877683278 2877676314 Bacteria 9512378
152 2912722289 2912715099 Bacteria 9460473
153 2919472083 2919468124 Bacteria 9133025
154 2946051913 2946045630 Bacteria 8527308
155 2946065691 2946064051 Bacteria 8957905
156 2946074036 2946072368 Bacteria 8999607
157 2947231708 2947224130 Bacteria 9938529
158 2954010940 2954002825 Bacteria 9173742
159 2954388525 2954380949 Bacteria 10050426
160 2954674600 2954673503 Bacteria 9685905
161 2954689533 2954682443 Bacteria 9862841
162 2954699314 2954691527 Bacteria 10720516
163 2954702905 2954701450 Bacteria 10834262
164 2954718256 2954711539 Bacteria 10867210
165 2954728226 2954721474 Bacteria 10456478
166 2954733583 2954731030 Bacteria 10243860
167 2954747120 2954740390 Bacteria 10229294
168 2954752467 2954749733 Bacteria 10366972
169 2954766233 2954759201 Bacteria 9358192
170 2966604284 2966598605 Bacteria 7676064
171 2990061382 2990059506 Bacteria 9321252
172 3006499855 3006493962 Bacteria 8825450
173 8008486460 8008485437 Bacteria 7198341
174 8008580634 8008574985 Bacteria 7815457
175 8023628485 8023623736 Bacteria 8593882
176 8025419192 8025413630 Bacteria 7014048
177 8025483292 8025478263 Bacteria 8209203
178 8025525529 8025524527 Bacteria 7197316
179 8025530977 8025530807 Bacteria 8495698
180 8054160652 8054160619 Bacteria 7783213
181 8056454619 8056447290 Bacteria 7680491
182 8056670209 8056667051 Bacteria 6953971
183 Ga0495675_0051548
184 JGI24737J22298_10023738
185 rootL2_10111192
186 rootH1_10069651
187 Ga0068856_100175693
188 Ga0075368_10024981
189 Ga0075367_10004553
190 Ga0157369_10462705
191 Ga0182008_10003190
192 Ga0182007_10003107
193 Ga0183367_1010
194 Ga0207426_1007294
195 Ga0307517_10023864
196 Ga0307515_10000845
197 Ga0307515_10103841
198 Ga0307512_10000948
199 Ga0307512_10036500
200 Ga0307512_10096950
201 Ga0307513_10071222
202 Ga0307513_10081702
203 Ga0307509_10038163
204 Ga0307509_10095629
205 Ga0307508_10054953
206 Ga0307508_10107268
207 Ga0307508_10145759
208 Ga0307514_10143768
209 Ga0307516_10002739
210 Ga0307518_10009679
211 Ga0307518_10028549
212 Ga0307507_10015327
213 Ga0307510_10040908
214 Ga0395898_0060733
215 Ga0439439_0004089
216 Ga0451837_0178013
217 Ga0439433_0007120
218 Ga0439448_0012422
219 Ga0439449_0030700
220 Ga0439462_0009353
221 Ga0450903_001271
222 Ga0439458_0000435
223 Ga0439458_0027490
224 Ga0466969_0019065
225 Ga0466972_0007319
226 Ga0466972_0022797
227 Ga0466965_0000971
228 Ga0466966_0001954
229 Ga0466963_0001021
230 Ga0466964_0002720
231 Ga0466971_0000777
232 Ga0466970_0000651
233 Ga0466970_0003370
234 Ga0466957_0001364
235 Ga0466959_0008830
236 Ga0466958_0008009
237 Ga0466967_0005581
238 Ga0495592_0059452
239 Ga0495603_0009008
240 Ga0495603_0062736
241 Ga0495603_0077876
242 Ga0495651_0028002
243 Ga0495662_0003272
244 Ga0495664_0004069
245 Ga0495585_0061309
246 Ga0495594_0017545
247 Ga0495594_0026643
248 Ga0495607_0042289
249 Ga0495606_0004225
250 Ga0495610_0013892
251 Ga0495618_0034983
252 Ga0495628_0028177
253 Ga0495631_0002943
254 Ga0495642_0017897
255 Ga0495652_0163465
256 Ga0495640_0056527
257 Ga0495587_0004483
258 Ga0495609_0046947
259 Ga0495597_0004370
260 Ga0495645_0054940
261 Ga0495645_0113960
262 Ga0495622_0010088
263 Ga0495633_0042177
264 Ga0495634_0002715
265 Ga0495611_0073565
266 Ga0495625_0009180
267 Ga0495625_0013490
268 Ga0495635_0000610
269 Ga0495588_0131815
270 Ga0495657_0032375
271 Ga0495646_0003575
272 Ga0495658_0009324
273 Ga0495613_0013326
274 Ga0495613_0175642
275 Ga0495624_0020538
276 Ga0495671_0006511
277 Ga0495589_0007905
278 Ga0495589_0019466
279 Ga0495589_0029497
280 Ga0495600_0017786
281 Ga0495581_0012278
282 Ga0495581_0100235
283 Ga0495604_0006334
284 Ga0495636_0031362
285 Ga0495674_0164314
286 Ga0495676_0006209
287 Ga0495676_0019505
288 Ga0495676_0021910
289 Ga0495687_006965
290 Ga0495675_0118525
291 Ga0495685_009117
292 Ga0495681_0007681
293 Ga0495686_0024196
294 Ga0495602_0012382
295 Ga0495682_0035662
296 Ga0501047_0077971
297 Ga0501080_0056947
298 Ga0501035_0074794
299 nmdc:mga06z11_2935_c1
300 nmdc:mga04h51_22558_c1
301 Ga0500610_0030980
302 Ga0495619_0145471
303 Ga0500572_006190
304 Ga0466962_0000270
305 2547406640
306 2585303664
307 2585321117
308 2616900724
309 2643760094
310 2643904596
311 2644268137
312 2644406138
313 2644443808
314 2644460207
315 2644629728
316 2784586852
317 2785367270
318 2786668316
319 2804843898
320 2808847771
321 2808918510
322 2809230419
323 2812360198
324 2819696505
325 2852637831
326 2862186154
327 2862289543
328 2862583615
329 2867432134
330 2867476952
331 2873157580
332 2875392795
333 2877683278
334 2912722289
335 2919472083
336 2946051913
337 2946065691
338 2946074036
339 2947231708
340 2954010940
341 2954388525
342 2954674600
343 2954689533
344 2954699314
345 2954702905
346 2954718256
347 2954728226
348 2954733583
349 2954747120
350 2954752467
351 2954766233
352 2966604284
353 2990061382
354 3006499855
355 8008486460
356 8008580634
357 8023628485
358 8025419192
359 8025483292
360 8025525529
361 8025530977
362 8054160652
363 8056454619
364 8056670209

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00082

Peptidase_S8

Subtilase family

137

400

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qtl-assembly2.cif.gz_A structural basis for dual-inhibition mechanism of a non-classical kazal-type serine protease inhibitor from horseshoe crab in complex with subtilisin 0.906 34 315
5ard-assembly1.cif.gz_A cooperative bio-metallic selectivity in a tailored protease enables creation of a c-c cross-coupling heckase 0.9027 34 315
1suc-assembly1.cif.gz_A calcium-independent subtilisin by design 0.9015 34 315
7am7-assembly1.cif.gz_A crystal structure of peptiligase mutant - m222p/l217h/a225n/f189w/n218d 0.8998 35 316
1avt-assembly1.cif.gz_A subtilisin carlsberg d-para-chlorophenyl-1-acetamido boronic acid inhibitor complex 0.8989 34 315
ID Description Score Start End Superfamily
1ah2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidase S8/S53 domain 0.8582 34 314 3.40.50.200
1dbiA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidase S8/S53 domain 0.8564 34 316 3.40.50.200
1r6vA03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidase S8/S53 domain 0.8534 34 316 3.40.50.200
af_Q55C28_254_552_3.40.50.200 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidase S8/S53 domain 0.8533 34 316 3.40.50.200
3afgA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidase S8/S53 domain 0.8509 48 318 3.40.50.200
ID Description Score Start End GO Terms
AF-A0A6B3I4I7-F1-model_v4 Type VII secretion-associated serine protease mycosin 0.9437 18 321 GO:0004252
GO:0005886
GO:0006508
AF-A0A6G2VRM3-F1-model_v4 Type VII secretion-associated serine protease mycosin 0.9408 18 326 GO:0004252
GO:0005886
GO:0006508
AF-A0A7K3S069-F1-model_v4 Type VII secretion-associated serine protease mycosin 0.9397 18 320 GO:0004252
GO:0005886
GO:0006508
AF-A0A1G0KWB7-F1-model_v4 Peptidase S8/S53 domain-containing protein 0.9372 32 317 GO:0004252
GO:0006508
AF-A0A0X7JAQ6-F1-model_v4 deleted 0.9358 18 329

Map