F279585

General Info

Members Datasets Scaffolds Average Seq Length
182 143 181 125

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0039801|Ga0451577_0039801_1610_2050
Length 146
Sequence LKLTSSSRLARRQEENVAIVHVTETNFDETVKEGIVLLDFWAEWCGPCRAFAPVFEAAAERHPDVTFGKVDTEAEQRLAAEFRIQAIPTLMLIRDGVLLFSQPGMLPAAALDEIVVKAKELDMDEVRRNVEEQKRAAAGEPTGGTD

Samples

Sample ID Description Type Environment
1 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
36 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
39 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
63 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
64 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
65 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
66 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
67 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
68 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
70 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
71 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
72 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
73 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
74 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
75 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
76 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
77 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
78 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
79 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
80 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
81 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
82 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
83 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
84 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
85 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
86 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
87 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
88 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
89 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
90 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
95 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
96 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
97 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
98 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
99 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
100 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
101 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
102 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
103 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
104 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
105 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
106 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
107 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
108 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
109 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
110 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
111 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
112 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
113 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
114 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
115 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
116 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
117 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
121 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
122 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
123 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
124 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
127 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
128 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
129 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
130 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
136 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
137 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
142 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.31
Metatranscriptomes 7.14
Isolates 0.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 9.89
Rhizosphere 86.26
Stem 0
Stem Tuber 0
Unclassified 3.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10011913 3300005327 Bacteria 6982
2 Ga0070683_100804775 3300005329 Bacteria 901
3 Ga0070670_100237830 3300005331 Bacteria 1585
4 Ga0070680_100038259 3300005336 Bacteria 3880
5 Ga0070682_100203477 3300005337 Bacteria 1398
6 Ga0068868_100097739 3300005338 Bacteria 2373
7 Ga0070659_100007764 3300005366 Bacteria 7803
8 Ga0070714_100009471 3300005435 Bacteria 7658
9 Ga0070714_100205309 3300005435 Bacteria 1804
10 Ga0070713_100102075 3300005436 Bacteria 2486
11 Ga0070710_10207418 3300005437 Bacteria 1240
12 Ga0070710_10374188 3300005437 Bacteria 949
13 Ga0070710_10426130 3300005437 Bacteria 894
14 Ga0070711_100043993 3300005439 Bacteria 3028
15 Ga0070663_100057754 3300005455 Bacteria 2785
16 Ga0070678_100765629 3300005456 Bacteria 874
17 Ga0070678_101148294 3300005456 Bacteria 719
18 Ga0070679_100056348 3300005530 Bacteria 3916
19 Ga0070684_100442877 3300005535 Bacteria 1200
20 Ga0070665_100907144 3300005548 Bacteria 894
21 Ga0068856_100320986 3300005614 Bacteria 1566
22 Ga0068851_10747238 3300005834 Bacteria 605
23 Ga0070717_10007929 3300006028 Bacteria 7910
24 Ga0070715_10093974 3300006163 Bacteria 1385
25 Ga0070712_100886982 3300006175 Bacteria 768
26 Ga0111539_13202865 3300009094 Bacteria 528
27 Ga0105245_10170923 3300009098 Bacteria 2070
28 Ga0105247_10455026 3300009101 Bacteria 924
29 Ga0105243_11447047 3300009148 Bacteria 709
30 Ga0105237_12287474 3300009545 Bacteria 550
31 Ga0157371_10283026 3300013102 Bacteria 1198
32 Ga0157370_10280291 3300013104 Bacteria 1540
33 Ga0157369_10011858 3300013105 Bacteria 9899
34 Ga0157369_11548884 3300013105 Bacteria 674
35 Ga0157374_10132321 3300013296 Bacteria 2415
36 Ga0157374_10643175 3300013296 Bacteria 1072
37 Ga0157372_10048547 3300013307 Bacteria 4719
38 Ga0157372_12364910 3300013307 Bacteria 610
39 Ga0163163_10234476 3300014325 Bacteria 1885
40 Ga0197907_10004834 3300020069 Bacteria 554
41 Ga0206355_1358759 3300020076 Bacteria 577
42 Ga0206354_10605776 3300020081 Bacteria 3190
43 Ga0206353_11058068 3300020082 Bacteria 2529
44 Ga0154015_1036918 3300020610 Bacteria 599
45 Ga0154015_1139165 3300020610 Bacteria 636
46 Ga0224712_10058935 3300022467 Bacteria 1523
47 Ga0224712_10080018 3300022467 Bacteria 1346
48 Ga0224712_10278439 3300022467 Bacteria 778
49 Ga0207692_10130583 3300025898 Bacteria 1418
50 Ga0207692_10284772 3300025898 Bacteria 1001
51 Ga0207710_10434792 3300025900 Bacteria 676
52 Ga0207688_10187299 3300025901 Bacteria 1236
53 Ga0207647_10045422 3300025904 Bacteria 2741
54 Ga0207699_10013462 3300025906 Bacteria 4188
55 Ga0207705_10013774 3300025909 Bacteria 5831
56 Ga0207684_10122575 3300025910 Bacteria 2229
57 Ga0207693_10009828 3300025915 Bacteria 7785
58 Ga0207663_10144950 3300025916 Bacteria 1659
59 Ga0207660_10016416 3300025917 Bacteria 4901
60 Ga0207650_10518753 3300025925 Bacteria 997
61 Ga0207687_11293751 3300025927 Bacteria 627
62 Ga0207700_10617780 3300025928 Bacteria 965
63 Ga0207664_10291430 3300025929 Bacteria 1434
64 Ga0207664_10389554 3300025929 Bacteria 1238
65 Ga0207690_10050392 3300025932 Bacteria 2780
66 Ga0207661_10085290 3300025944 Bacteria 2617
67 Ga0207679_10272486 3300025945 Bacteria 1448
68 Ga0207678_10522216 3300026067 Bacteria 1036
69 Ga0207702_10130704 3300026078 Bacteria 2259
70 Ga0268266_10020067 3300028379 Bacteria 5697
71 Ga0265338_10006397 3300028800 Bacteria 15016
72 Ga0265773_1000384 3300031018 Bacteria 1716
73 Ga0307410_10037851 3300031852 Bacteria 3155
74 Ga0307407_10484624 3300031903 Bacteria 904
75 Ga0307412_10370080 3300031911 Bacteria 1157
76 Ga0307409_100057730 3300031995 Bacteria 3009
77 Ga0307416_100536184 3300032002 Bacteria 1241
78 Ga0316583_10128646 3300032133 Bacteria 883
79 Ga0316593_10282764 3300032168 Bacteria 625
80 Ga0373953_0094744 3300035117 Bacteria 1252
81 Ga0373955_0226271 3300035172 Bacteria 1118
82 Ga0316574_0084824 3300035398 Bacteria 2015
83 Ga0316584_0305100 3300036712 Bacteria 1152
84 Ga0373925_0000678 3300037068 Bacteria 32007
85 Ga0436364_0160220 3300037853 Bacteria 732
86 Ga0436365_1788116 3300039437 Bacteria 2059
87 Ga0436363_1352022 3300039450 Bacteria 825
88 Ga0451853_1642531 3300041512 Bacteria 1296
89 Ga0450901_022375 3300042533 Bacteria 681
90 Ga0451577_0039801 3300042876 Bacteria 4223
91 Ga0451577_0343718 3300042876 Bacteria 1353
92 Ga0466972_0033878 3300044658 Bacteria 2505
93 Ga0466972_0177909 3300044658 Bacteria 998
94 Ga0453683_0419836 3300044673 Bacteria 863
95 Ga0466965_0122689 3300044683 Bacteria 1343
96 Ga0466966_0495763 3300044684 Bacteria 734
97 Ga0466961_0224038 3300044693 Bacteria 1158
98 Ga0466961_0792039 3300044693 Bacteria 566
99 Ga0466963_0131278 3300044694 Bacteria 1730
100 Ga0466964_0901475 3300044706 Bacteria 506
101 Ga0466971_0040472 3300044719 Bacteria 2093
102 Ga0466968_0054181 3300044735 Bacteria 1719
103 Ga0466970_0015879 3300044765 Bacteria 3877
104 Ga0466970_0107214 3300044765 Bacteria 1524
105 Ga0466957_0008736 3300044842 Bacteria 5768
106 Ga0466959_0364493 3300045049 Bacteria 984
107 Ga0466958_0129560 3300045836 Bacteria 1583
108 Ga0466958_0719632 3300045836 Bacteria 650
109 Ga0466958_0745494 3300045836 Bacteria 638
110 Ga0466967_0010571 3300045976 Bacteria 6932
111 Ga0466967_0036963 3300045976 Bacteria 4174
112 Ga0466967_1021321 3300045976 Bacteria 823
113 Ga0495592_0126910 3300046454 Bacteria 1788
114 Ga0495592_0132296 3300046454 Bacteria 1744
115 Ga0495592_0671489 3300046454 Bacteria 626
116 Ga0495641_0263859 3300046461 Bacteria 775
117 Ga0495653_0010662 3300046463 Bacteria 7525
118 Ga0495582_0701916 3300046473 Bacteria 585
119 Ga0495639_0056250 3300046475 Bacteria 1796
120 Ga0495608_0210602 3300046511 Bacteria 1222
121 Ga0495608_0276842 3300046511 Bacteria 1042
122 Ga0495628_0003000 3300046516 Bacteria 15129
123 Ga0495630_0009721 3300046517 Bacteria 6918
124 Ga0495630_0058529 3300046517 Bacteria 2889
125 Ga0495666_0003975 3300046526 Bacteria 7477
126 Ga0495587_0094841 3300046536 Bacteria 1722
127 Ga0495645_0147169 3300046543 Bacteria 1640
128 Ga0495667_0043685 3300046559 Bacteria 2969
129 Ga0495634_0559868 3300046642 Bacteria 666
130 Ga0495634_0747053 3300046642 Bacteria 560
131 Ga0495657_0256201 3300046675 Bacteria 1052
132 Ga0495658_0010439 3300046683 Bacteria 4647
133 Ga0495624_0175923 3300046690 Bacteria 1305
134 Ga0495604_0396331 3300047317 Bacteria 910
135 Ga0495674_0185108 3300047319 Bacteria 1733
136 Ga0495674_0189024 3300047319 Bacteria 1712
137 Ga0495680_0036535 3300047322 Bacteria 3943
138 Ga0495680_0222246 3300047322 Bacteria 1348
139 Ga0495680_0770151 3300047322 Bacteria 631
140 Ga0495675_0254578 3300047444 Bacteria 1053
141 Ga0495684_0002892 3300047471 Bacteria 13524
142 Ga0495602_0135799 3300048088 Bacteria 1954
143 Ga0496100_1304133 3300048903 Bacteria 573
144 Ga0496101_0569769 3300048904 Bacteria 895
145 Ga0496102_0406283 3300048905 Bacteria 1280
146 Ga0496102_0462779 3300048905 Bacteria 1189
147 Ga0496104_0270511 3300048907 Bacteria 1612
148 Ga0496104_0362037 3300048907 Bacteria 1363
149 Ga0496105_1334693 3300048908 Bacteria 522
150 Ga0496108_0138322 3300048911 Bacteria 2097
151 Ga0496109_0045761 3300048912 Bacteria 3972
152 Ga0496110_0009981 3300048913 Bacteria 7703
153 Ga0496110_0027588 3300048913 Bacteria 4869
154 Ga0496110_1177916 3300048913 Bacteria 675
155 Ga0496111_0050748 3300048914 Bacteria 2994
156 Ga0496112_0108765 3300048915 Bacteria 2743
157 Ga0496113_0128817 3300048916 Bacteria 1984
158 Ga0496114_0453572 3300048917 Bacteria 1135
159 Ga0496114_0519967 3300048917 Bacteria 1053
160 Ga0496115_0204744 3300048918 Bacteria 1630
161 Ga0496126_0476876 3300048929 Bacteria 1000
162 Ga0501311_046176 3300049527 Bacteria 672
163 Ga0501034_0000421 3300049571 Bacteria 71070
164 Ga0501034_0178035 3300049571 Bacteria 2092
165 Ga0501042_0738557 3300049578 Bacteria 716
166 Ga0501046_1133572 3300049580 Bacteria 539
167 Ga0501047_0037220 3300049581 Bacteria 4705
168 Ga0501047_0876590 3300049581 Bacteria 711
169 Ga0501071_0924682 3300049587 Bacteria 673
170 Ga0501072_0200308 3300049588 Bacteria 1592
171 Ga0501079_0815245 3300049741 Bacteria 735
172 Ga0501044_0047510 3300049823 Bacteria 4439
173 Ga0501044_0223456 3300049823 Bacteria 1833
174 nmdc:mga00v17_374943_c1 3300050491 Bacteria 925
175 Ga0495619_0042550 3300053085 Bacteria 2975
176 Ga0495619_0409372 3300053085 Bacteria 936
177 Ga0495619_0793543 3300053085 Bacteria 641
178 Ga0501084_0167459 3300054114 Bacteria 1855
179 Ga0587107_137562 3300059652 Bacteria 519
180 Ga0466962_0036204 3300061719 Bacteria 2361
181 Ga0466962_0188546 3300061719 Bacteria 1006

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2811994880 2812362864 116
2 3300009094 Ga0111539_13202865 Ga0111539_132028651 118
3 3300005456 Ga0070678_101148294 Ga0070678_1011482941 119
4 3300042876 Ga0451577_0039801 Ga0451577_0039801_1610_2050 119
5 3300042876 Ga0451577_0343718 Ga0451577_0343718_871_1263 119
6 3300044673 Ga0453683_0419836 Ga0453683_0419836_309_749 119
7 3300049571 Ga0501034_0000421 Ga0501034_0000421_26228_26587 119
8 3300005327 Ga0070658_10011913 Ga0070658_100119133 120
9 3300005329 Ga0070683_100804775 Ga0070683_1008047751 120
10 3300005331 Ga0070670_100237830 Ga0070670_1002378302 120
11 3300005336 Ga0070680_100038259 Ga0070680_1000382594 120
12 3300005337 Ga0070682_100203477 Ga0070682_1002034771 120
13 3300005338 Ga0068868_100097739 Ga0068868_1000977393 120
14 3300005366 Ga0070659_100007764 Ga0070659_1000077644 120
15 3300005435 Ga0070714_100009471 Ga0070714_1000094719 120
16 3300005435 Ga0070714_100205309 Ga0070714_1002053093 120
17 3300005436 Ga0070713_100102075 Ga0070713_1001020755 120
18 3300005437 Ga0070710_10207418 Ga0070710_102074182 120
19 3300005437 Ga0070710_10374188 Ga0070710_103741882 120
20 3300005437 Ga0070710_10426130 Ga0070710_104261301 120
21 3300005439 Ga0070711_100043993 Ga0070711_1000439935 120
22 3300005455 Ga0070663_100057754 Ga0070663_1000577543 120
23 3300005456 Ga0070678_100765629 Ga0070678_1007656292 120
24 3300005530 Ga0070679_100056348 Ga0070679_1000563483 120
25 3300005535 Ga0070684_100442877 Ga0070684_1004428772 120
26 3300005548 Ga0070665_100907144 Ga0070665_1009071442 120
27 3300005614 Ga0068856_100320986 Ga0068856_1003209863 120
28 3300005834 Ga0068851_10747238 Ga0068851_107472381 120
29 3300006028 Ga0070717_10007929 Ga0070717_100079297 120
30 3300006163 Ga0070715_10093974 Ga0070715_100939741 120
31 3300006175 Ga0070712_100886982 Ga0070712_1008869822 120
32 3300009098 Ga0105245_10170923 Ga0105245_101709232 120
33 3300009101 Ga0105247_10455026 Ga0105247_104550261 120
34 3300009148 Ga0105243_11447047 Ga0105243_114470472 120
35 3300009545 Ga0105237_12287474 Ga0105237_122874742 120
36 3300013102 Ga0157371_10283026 Ga0157371_102830262 120
37 3300013104 Ga0157370_10280291 Ga0157370_102802912 120
38 3300013105 Ga0157369_10011858 Ga0157369_100118585 120
39 3300013105 Ga0157369_11548884 Ga0157369_115488842 120
40 3300013296 Ga0157374_10132321 Ga0157374_101323212 120
41 3300013296 Ga0157374_10643175 Ga0157374_106431752 120
42 3300013307 Ga0157372_10048547 Ga0157372_100485475 120
43 3300013307 Ga0157372_12364910 Ga0157372_123649101 120
44 3300014325 Ga0163163_10234476 Ga0163163_102344764 120
45 3300020069 Ga0197907_10004834 Ga0197907_100048342 120
46 3300020076 Ga0206355_1358759 Ga0206355_13587591 120
47 3300020081 Ga0206354_10605776 Ga0206354_106057763 120
48 3300020082 Ga0206353_11058068 Ga0206353_110580683 120
49 3300020610 Ga0154015_1036918 Ga0154015_10369182 120
50 3300020610 Ga0154015_1139165 Ga0154015_11391652 120
51 3300022467 Ga0224712_10058935 Ga0224712_100589351 120
52 3300022467 Ga0224712_10080018 Ga0224712_100800183 120
53 3300022467 Ga0224712_10278439 Ga0224712_102784391 120
54 3300025898 Ga0207692_10130583 Ga0207692_101305833 120
55 3300025898 Ga0207692_10284772 Ga0207692_102847721 120
56 3300025900 Ga0207710_10434792 Ga0207710_104347922 120
57 3300025901 Ga0207688_10187299 Ga0207688_101872992 120
58 3300025904 Ga0207647_10045422 Ga0207647_100454222 120
59 3300025906 Ga0207699_10013462 Ga0207699_100134625 120
60 3300025909 Ga0207705_10013774 Ga0207705_100137742 120
61 3300025910 Ga0207684_10122575 Ga0207684_101225752 120
62 3300025915 Ga0207693_10009828 Ga0207693_100098283 120
63 3300025916 Ga0207663_10144950 Ga0207663_101449502 120
64 3300025917 Ga0207660_10016416 Ga0207660_100164163 120
65 3300025925 Ga0207650_10518753 Ga0207650_105187531 120
66 3300025927 Ga0207687_11293751 Ga0207687_112937512 120
67 3300025928 Ga0207700_10617780 Ga0207700_106177802 120
68 3300025929 Ga0207664_10291430 Ga0207664_102914302 120
69 3300025929 Ga0207664_10389554 Ga0207664_103895543 120
70 3300025932 Ga0207690_10050392 Ga0207690_100503923 120
71 3300025944 Ga0207661_10085290 Ga0207661_100852902 120
72 3300025945 Ga0207679_10272486 Ga0207679_102724862 120
73 3300026067 Ga0207678_10522216 Ga0207678_105222161 120
74 3300026078 Ga0207702_10130704 Ga0207702_101307043 120
75 3300028379 Ga0268266_10020067 Ga0268266_100200677 120
76 3300028800 Ga0265338_10006397 Ga0265338_100063978 120
77 3300031018 Ga0265773_1000384 Ga0265773_10003841 120
78 3300031852 Ga0307410_10037851 Ga0307410_100378511 120
79 3300031903 Ga0307407_10484624 Ga0307407_104846241 120
80 3300031911 Ga0307412_10370080 Ga0307412_103700802 120
81 3300031995 Ga0307409_100057730 Ga0307409_1000577304 120
82 3300032002 Ga0307416_100536184 Ga0307416_1005361843 120
83 3300032133 Ga0316583_10128646 Ga0316583_101286462 120
84 3300032168 Ga0316593_10282764 Ga0316593_102827642 120
85 3300035117 Ga0373953_0094744 Ga0373953_0094744_664_1038 120
86 3300035172 Ga0373955_0226271 Ga0373955_0226271_488_862 120
87 3300035398 Ga0316574_0084824 Ga0316574_0084824_669_1112 120
88 3300036712 Ga0316584_0305100 Ga0316584_0305100_485_928 120
89 3300037068 Ga0373925_0000678 Ga0373925_0000678_30145_30516 120
90 3300037853 Ga0436364_0160220 Ga0436364_0160220_77_484 120
91 3300039437 Ga0436365_1788116 Ga0436365_1788116_890_1288 120
92 3300039450 Ga0436363_1352022 Ga0436363_1352022_105_482 120
93 3300041512 Ga0451853_1642531 Ga0451853_1642531_759_1166 120
94 3300042533 Ga0450901_022375 Ga0450901_022375_131_502 120
95 3300044658 Ga0466972_0033878 Ga0466972_0033878_604_987 120
96 3300044658 Ga0466972_0177909 Ga0466972_0177909_318_692 120
97 3300044683 Ga0466965_0122689 Ga0466965_0122689_226_609 120
98 3300044684 Ga0466966_0495763 Ga0466966_0495763_97_471 120
99 3300044693 Ga0466961_0224038 Ga0466961_0224038_277_660 120
100 3300044693 Ga0466961_0792039 Ga0466961_0792039_129_503 120
101 3300044694 Ga0466963_0131278 Ga0466963_0131278_888_1271 120
102 3300044706 Ga0466964_0901475 Ga0466964_0901475_79_441 120
103 3300044719 Ga0466971_0040472 Ga0466971_0040472_998_1381 120
104 3300044735 Ga0466968_0054181 Ga0466968_0054181_319_702 120
105 3300044765 Ga0466970_0015879 Ga0466970_0015879_3022_3396 120
106 3300044765 Ga0466970_0107214 Ga0466970_0107214_810_1193 120
107 3300044842 Ga0466957_0008736 Ga0466957_0008736_5054_5437 120
108 3300045049 Ga0466959_0364493 Ga0466959_0364493_401_763 120
109 3300045836 Ga0466958_0129560 Ga0466958_0129560_510_893 120
110 3300045836 Ga0466958_0719632 Ga0466958_0719632_124_498 120
111 3300045836 Ga0466958_0745494 Ga0466958_0745494_146_508 120
112 3300045976 Ga0466967_0010571 Ga0466967_0010571_6082_6450 120
113 3300045976 Ga0466967_0036963 Ga0466967_0036963_2894_3256 120
114 3300045976 Ga0466967_1021321 Ga0466967_1021321_324_704 120
115 3300046454 Ga0495592_0126910 Ga0495592_0126910_298_669 120
116 3300046454 Ga0495592_0132296 Ga0495592_0132296_80_523 120
117 3300046454 Ga0495592_0671489 Ga0495592_0671489_77_454 120
118 3300046461 Ga0495641_0263859 Ga0495641_0263859_297_668 120
119 3300046463 Ga0495653_0010662 Ga0495653_0010662_4582_4953 120
120 3300046473 Ga0495582_0701916 Ga0495582_0701916_123_494 120
121 3300046475 Ga0495639_0056250 Ga0495639_0056250_1026_1412 120
122 3300046511 Ga0495608_0210602 Ga0495608_0210602_780_1151 120
123 3300046511 Ga0495608_0276842 Ga0495608_0276842_212_604 120
124 3300046516 Ga0495628_0003000 Ga0495628_0003000_12627_12998 120
125 3300046517 Ga0495630_0009721 Ga0495630_0009721_1471_1842 120
126 3300046517 Ga0495630_0058529 Ga0495630_0058529_243_611 120
127 3300046526 Ga0495666_0003975 Ga0495666_0003975_1195_1566 120
128 3300046536 Ga0495587_0094841 Ga0495587_0094841_254_697 120
129 3300046543 Ga0495645_0147169 Ga0495645_0147169_299_673 120
130 3300046559 Ga0495667_0043685 Ga0495667_0043685_1239_1610 120
131 3300046642 Ga0495634_0559868 Ga0495634_0559868_174_545 120
132 3300046642 Ga0495634_0747053 Ga0495634_0747053_130_522 120
133 3300046675 Ga0495657_0256201 Ga0495657_0256201_191_562 120
134 3300046683 Ga0495658_0010439 Ga0495658_0010439_746_1117 120
135 3300046690 Ga0495624_0175923 Ga0495624_0175923_537_908 120
136 3300047317 Ga0495604_0396331 Ga0495604_0396331_370_762 120
137 3300047319 Ga0495674_0185108 Ga0495674_0185108_322_714 120
138 3300047319 Ga0495674_0189024 Ga0495674_0189024_754_1125 120
139 3300047322 Ga0495680_0036535 Ga0495680_0036535_3086_3457 120
140 3300047322 Ga0495680_0222246 Ga0495680_0222246_773_1165 120
141 3300047322 Ga0495680_0770151 Ga0495680_0770151_225_596 120
142 3300047444 Ga0495675_0254578 Ga0495675_0254578_577_948 120
143 3300047471 Ga0495684_0002892 Ga0495684_0002892_12623_12994 120
144 3300048088 Ga0495602_0135799 Ga0495602_0135799_978_1421 120
145 3300048903 Ga0496100_1304133 Ga0496100_1304133_95_463 120
146 3300048904 Ga0496101_0569769 Ga0496101_0569769_451_816 120
147 3300048905 Ga0496102_0406283 Ga0496102_0406283_722_1093 120
148 3300048905 Ga0496102_0462779 Ga0496102_0462779_495_860 120
149 3300048907 Ga0496104_0270511 Ga0496104_0270511_63_431 120
150 3300048907 Ga0496104_0362037 Ga0496104_0362037_947_1318 120
151 3300048908 Ga0496105_1334693 Ga0496105_1334693_96_473 120
152 3300048911 Ga0496108_0138322 Ga0496108_0138322_1147_1512 120
153 3300048912 Ga0496109_0045761 Ga0496109_0045761_1299_1664 120
154 3300048913 Ga0496110_0009981 Ga0496110_0009981_5392_5763 120
155 3300048913 Ga0496110_0027588 Ga0496110_0027588_3503_3868 120
156 3300048913 Ga0496110_1177916 Ga0496110_1177916_113_499 120
157 3300048914 Ga0496111_0050748 Ga0496111_0050748_2459_2824 120
158 3300048915 Ga0496112_0108765 Ga0496112_0108765_972_1337 120
159 3300048916 Ga0496113_0128817 Ga0496113_0128817_1095_1460 120
160 3300048917 Ga0496114_0453572 Ga0496114_0453572_620_988 120
161 3300048917 Ga0496114_0519967 Ga0496114_0519967_470_835 120
162 3300048918 Ga0496115_0204744 Ga0496115_0204744_1037_1405 120
163 3300048929 Ga0496126_0476876 Ga0496126_0476876_159_530 120
164 3300049527 Ga0501311_046176 Ga0501311_046176_261_653 120
165 3300049571 Ga0501034_0178035 Ga0501034_0178035_1642_2034 120
166 3300049578 Ga0501042_0738557 Ga0501042_0738557_294_683 120
167 3300049580 Ga0501046_1133572 Ga0501046_1133572_93_482 120
168 3300049581 Ga0501047_0037220 Ga0501047_0037220_1975_2367 120
169 3300049581 Ga0501047_0876590 Ga0501047_0876590_187_579 120
170 3300049587 Ga0501071_0924682 Ga0501071_0924682_99_488 120
171 3300049588 Ga0501072_0200308 Ga0501072_0200308_695_1084 120
172 3300049741 Ga0501079_0815245 Ga0501079_0815245_36_407 120
173 3300049823 Ga0501044_0047510 Ga0501044_0047510_1730_2122 120
174 3300049823 Ga0501044_0223456 Ga0501044_0223456_895_1263 120
175 3300050491 nmdc:mga00v17_374943_c1 nmdc:mga00v17_374943_c1_226_597 120
176 3300053085 Ga0495619_0042550 Ga0495619_0042550_1222_1593 120
177 3300053085 Ga0495619_0409372 Ga0495619_0409372_194_559 120
178 3300053085 Ga0495619_0793543 Ga0495619_0793543_218_592 120
179 3300054114 Ga0501084_0167459 Ga0501084_0167459_1216_1584 120
180 3300059652 Ga0587107_137562 Ga0587107_137562_89_451 120
181 3300061719 Ga0466962_0036204 Ga0466962_0036204_1480_1863 120
182 3300061719 Ga0466962_0188546 Ga0466962_0188546_403_795 120

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00085

Thioredoxin

Thioredoxin

18

118

0.94

PF14595

Thioredoxin_9

Thioredoxin

4

132

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p2a-assembly2.cif.gz_B crystal structure of thioredoxin 2 from yersinia pestis 0.9679 2 107
2ynx-assembly2.cif.gz_B crystal structure of ancestral thioredoxin relative to last archaea common ancestor (laca) from the precambrian period 0.967 2 102
3hhv-assembly1.cif.gz_A-2 the crystal structure of the thioredoxin a2 from sulfolobus solfataricus 0.966 3 103
4ba7-assembly2.cif.gz_B crystal structure of ancestral thioredoxin relative to last bacteria common ancestor (lbca) from the precambrian period 0.9626 2 102
2puk-assembly2.cif.gz_G crystal structure of the binary complex between ferredoxin: thioredoxin reductase and thioredoxin m 0.9612 3 102
ID Description Score Start End Superfamily
af_O53161_2_108_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9849 2 107 3.40.30.10
af_O53161_2_108_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9669 2 107 3.40.30.10
3ul3B01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9659 20 102 3.40.30.10
3tcoC00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9573 2 102 3.40.30.10
af_A0A0R0K134_277_390_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9552 8 102 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A6I6TPW9-F1-model_v4 deleted 1.003 1 120
AF-A0A1H9TWV0-F1-model_v4 Thioredoxin 1.003 1 107 GO:0005829
GO:0015035
AF-D6Y8N8-F1-model_v4 Thioredoxin 1.001 4 117 GO:0005829
GO:0015035
AF-A0A7V9LSP3-F1-model_v4 Thioredoxin family protein 1 5 119 GO:0005829
GO:0015035
AF-A0A6H9XSB5-F1-model_v4 Thioredoxin 0.9997 1 119 GO:0005829
GO:0015035

Feature Viewer

pLDDT pTM Quality
95.51 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map