F279524

General Info

Members Datasets Scaffolds Average Seq Length
182 112 364 324

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0443187|Ga0436361_0443187_237_1286
Length 349
Sequence VHAVSSNPNNVAATIDLIGATAPLRDTFNRPITYLRISVTDRCNLRCVYCMPEGGLPWIPKPEILTYEEIAQIVRAGASVGLQSVRLTGGEPLIRRDLARLVEMLARIPGIEDIALSTNGLLLADRACELRDAGLRRVNVSLDTLHEERFFAIARRPGLDRVLAGIDAAIDAGLAPIKLNCVVMRGQNDDELVAFAALTRDRPIYVRFIELMPVEENLEMQPGAYISADEILERLRAEDDLQIAAGPGGNGPARYFSFPGSQGALGVISPLSHDYCERCNRVRLSADGRLRLCLFGDHHIDLRTPVRAGATREEIAAILSGAMLIKPERHHLELGKTASAMRAFSEIGG

Samples

Sample ID Description Type Environment
1 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
42 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
46 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
47 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
50 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
51 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
79 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
82 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
83 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
84 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
85 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
86 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
93 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
94 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
95 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
96 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
97 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
98 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
101 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
104 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
105 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
106 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
107 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
112 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.8
Metatranscriptomes 2.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.85
Rhizosphere 85.71
Stem 0
Stem Tuber 0
Unclassified 2.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436361_0443187 3300039447 Unclassified 1382
2 Ga0070658_10003315 3300005327 Bacteria 13288
3 Ga0070658_10137379 3300005327 Bacteria 2040
4 Ga0070683_100008618 3300005329 Bacteria 8665
5 Ga0070683_100027105 3300005329 Bacteria 5165
6 Ga0070670_100035854 3300005331 Bacteria 4270
7 Ga0070680_100151372 3300005336 Bacteria 1948
8 Ga0070660_100007429 3300005339 Bacteria 7637
9 Ga0070660_100162247 3300005339 Bacteria 1801
10 Ga0070691_10001314 3300005341 Bacteria 10559
11 Ga0070661_100057471 3300005344 Bacteria 2851
12 Ga0070661_100126461 3300005344 Bacteria 1918
13 Ga0070661_100289881 3300005344 Bacteria 1272
14 Ga0070668_100331928 3300005347 Bacteria 1283
15 Ga0070669_100029096 3300005353 Bacteria 3981
16 Ga0070675_100074889 3300005354 Bacteria 2813
17 Ga0070671_100032977 3300005355 Bacteria 4281
18 Ga0070674_100269716 3300005356 Bacteria 1344
19 Ga0070688_100009037 3300005365 Bacteria 5432
20 Ga0070659_100097079 3300005366 Bacteria 2368
21 Ga0070714_100004419 3300005435 Bacteria 10583
22 Ga0070714_100065396 3300005435 Bacteria 3132
23 Ga0070714_100367265 3300005435 Bacteria 1354
24 Ga0070663_100150910 3300005455 Bacteria 1782
25 Ga0070699_100511772 3300005518 Bacteria 1091
26 Ga0070679_100106634 3300005530 Bacteria 2788
27 Ga0070679_100217223 3300005530 Bacteria 1874
28 Ga0070684_100057101 3300005535 Bacteria 3407
29 Ga0070684_100075754 3300005535 Bacteria 2968
30 Ga0070684_100305573 3300005535 Bacteria 1460
31 Ga0068853_100065047 3300005539 Bacteria 3164
32 Ga0068853_100318626 3300005539 Bacteria 1441
33 Ga0070672_100043806 3300005543 Bacteria 3454
34 Ga0068855_100002927 3300005563 Bacteria 20892
35 Ga0068855_100054863 3300005563 Bacteria 4683
36 Ga0068855_100226208 3300005563 Bacteria 2096
37 Ga0070664_100072728 3300005564 Bacteria 2949
38 Ga0068857_100010305 3300005577 Bacteria 8120
39 Ga0068854_100000040 3300005578 Bacteria 94111
40 Ga0068856_100009828 3300005614 Bacteria 9292
41 Ga0068852_100042168 3300005616 Bacteria 3862
42 Ga0068859_100005447 3300005617 Bacteria 12941
43 Ga0068861_100193900 3300005719 Bacteria 1701
44 Ga0068851_10008899 3300005834 Bacteria 4656
45 Ga0068870_10015984 3300005840 Bacteria 3575
46 Ga0097620_100005447 3300006931 Bacteria 12941
47 Ga0111539_10598418 3300009094 Bacteria 1284
48 Ga0105248_10178588 3300009177 Bacteria 2393
49 Ga0105248_10484803 3300009177 Bacteria 1394
50 Ga0157373_10157624 3300013100 Bacteria 1597
51 Ga0157369_10011508 3300013105 Bacteria 10050
52 Ga0157369_10252810 3300013105 Bacteria 1839
53 Ga0157374_10027289 3300013296 Bacteria 5148
54 Ga0157372_10003298 3300013307 Bacteria 17437
55 Ga0157372_10019480 3300013307 Bacteria 7315
56 Ga0157372_10025024 3300013307 Bacteria 6486
57 Ga0157372_10543948 3300013307 Bacteria 1354
58 Ga0157375_10279159 3300013308 Bacteria 1833
59 Ga0157377_10026718 3300014745 Bacteria 3092
60 Ga0197907_11176683 3300020069 Bacteria 3364
61 Ga0206356_11146903 3300020070 Bacteria 10069
62 Ga0206354_10032140 3300020081 Bacteria 1814
63 Ga0213873_10032821 3300021358 Bacteria 1299
64 Ga0213872_10045681 3300021361 Bacteria 1993
65 Ga0213874_10000295 3300021377 Bacteria 9784
66 Ga0213876_10004559 3300021384 Bacteria 7729
67 Ga0213876_10016167 3300021384 Bacteria 3943
68 Ga0213875_10000001 3300021388 Bacteria 2793540
69 Ga0213875_10027091 3300021388 Bacteria 2726
70 Ga0213871_10005140 3300021441 Unclassified 2676
71 Ga0207656_10012853 3300025321 Bacteria 3188
72 Ga0207682_10031005 3300025893 Bacteria 2144
73 Ga0207645_10211156 3300025907 Bacteria 1278
74 Ga0207645_10273722 3300025907 Bacteria 1120
75 Ga0207643_10020176 3300025908 Bacteria 3656
76 Ga0207705_10001197 3300025909 Bacteria 21028
77 Ga0207705_10009692 3300025909 Bacteria 7005
78 Ga0207705_10275101 3300025909 Bacteria 1288
79 Ga0207660_10116396 3300025917 Bacteria 2019
80 Ga0207660_10172725 3300025917 Bacteria 1674
81 Ga0207662_10122247 3300025918 Bacteria 1634
82 Ga0207657_10012430 3300025919 Bacteria 8409
83 Ga0207657_10146744 3300025919 Bacteria 1924
84 Ga0207649_10011850 3300025920 Bacteria 4823
85 Ga0207649_10021677 3300025920 Bacteria 3703
86 Ga0207649_10041792 3300025920 Bacteria 2793
87 Ga0207681_10023234 3300025923 Bacteria 3963
88 Ga0207690_10099069 3300025932 Bacteria 2077
89 Ga0207691_10004754 3300025940 Bacteria 13127
90 Ga0207691_10113293 3300025940 Bacteria 2410
91 Ga0207711_10423880 3300025941 Bacteria 1238
92 Ga0207661_10023445 3300025944 Bacteria 4662
93 Ga0207679_10132504 3300025945 Bacteria 2002
94 Ga0207667_10000101 3300025949 Bacteria 137935
95 Ga0207667_10006385 3300025949 Bacteria 14293
96 Ga0207667_10066076 3300025949 Bacteria 3771
97 Ga0207667_10109280 3300025949 Bacteria 2852
98 Ga0207667_10475948 3300025949 Bacteria 1268
99 Ga0207668_10147388 3300025972 Bacteria 1818
100 Ga0207640_10000039 3300025981 Bacteria 107982
101 Ga0207703_10376816 3300026035 Bacteria 1312
102 Ga0207639_10050217 3300026041 Bacteria 3167
103 Ga0207639_10081663 3300026041 Bacteria 2561
104 Ga0207639_10096904 3300026041 Bacteria 2374
105 Ga0207678_10036074 3300026067 Bacteria 4304
106 Ga0207702_10016887 3300026078 Bacteria 6041
107 Ga0207674_10011748 3300026116 Bacteria 9825
108 Ga0207674_10012406 3300026116 Bacteria 9526
109 Ga0207698_10201857 3300026142 Bacteria 1781
110 Ga0265356_1000955 3300028017 Bacteria 4639
111 Ga0265338_10000170 3300028800 Bacteria 120070
112 Ga0265760_10000348 3300031090 Bacteria 12957
113 Ga0265325_10000069 3300031241 Bacteria 71127
114 Ga0265325_10008019 3300031241 Bacteria 6264
115 Ga0265339_10011266 3300031249 Bacteria 5517
116 Ga0265316_10022438 3300031344 Bacteria 5322
117 Ga0265313_10000065 3300031595 Bacteria 103210
118 Ga0316579_10033094 3300031691 Bacteria 2372
119 Ga0316579_10054887 3300031691 Bacteria 1868
120 Ga0265342_10006318 3300031712 Bacteria 8838
121 Ga0316577_10000471 3300031733 Bacteria 15839
122 Ga0316582_0017579 3300036647 Bacteria 4141
123 Ga0316582_0054784 3300036647 Bacteria 2540
124 Ga0316584_0016323 3300036712 Bacteria 5323
125 Ga0316584_0038928 3300036712 Bacteria 3539
126 Ga0395899_0002886 3300037312 Bacteria 13808
127 Ga0395898_0006153 3300037466 Bacteria 12851
128 Ga0436364_0273345 3300037853 Bacteria 2794207
129 Ga0436364_0942733 3300037853 Bacteria 16989
130 Ga0436364_1123345 3300037853 Bacteria 1504
131 Ga0436364_1376159 3300037853 Bacteria 6114
132 Ga0395901_0007973 3300038443 Bacteria 10688
133 Ga0436365_0988130 3300039437 Bacteria 2625
134 Ga0436365_1140493 3300039437 Bacteria 1485
135 Ga0436365_1192893 3300039437 Bacteria 6696
136 Ga0436365_1641211 3300039437 Bacteria 2494
137 Ga0436365_1650147 3300039437 Bacteria 30175
138 Ga0436360_0211894 3300039438 Bacteria 6633
139 Ga0436360_0265761 3300039438 Bacteria 6669
140 Ga0436360_0352805 3300039438 Bacteria 1426
141 Ga0436360_0418730 3300039438 Unclassified 3199
142 Ga0436360_0620985 3300039438 Bacteria 1107
143 Ga0436360_0785853 3300039438 Bacteria 3375
144 Ga0436361_0086089 3300039447 Bacteria 6234
145 Ga0436361_0262283 3300039447 Bacteria 27567
146 Ga0436361_0703102 3300039447 Bacteria 2400
147 Ga0436363_0019426 3300039450 Bacteria 48435
148 Ga0436363_0683401 3300039450 Bacteria 3716
149 Ga0436363_0776538 3300039450 Bacteria 1817
150 Ga0436363_0930199 3300039450 Bacteria 1744
151 Ga0436363_1578239 3300039450 Bacteria 1336
152 Ga0436362_0136272 3300039453 Bacteria 2334
153 Ga0436362_0290744 3300039453 Bacteria 1609
154 Ga0436362_0470449 3300039453 Bacteria 6311
155 Ga0436362_0487331 3300039453 Unclassified 1529
156 Ga0436362_0731517 3300039453 Bacteria 3173
157 Ga0436362_0750279 3300039453 Unclassified 1677
158 Ga0436362_0986466 3300039453 Bacteria 14404
159 Ga0436362_1132883 3300039453 Bacteria 5307
160 Ga0436362_1250429 3300039453 Bacteria 1138
161 Ga0436362_1303168 3300039453 Bacteria 1419
162 Ga0466966_0005417 3300044684 Bacteria 8388
163 Ga0466963_0002942 3300044694 Bacteria 9628
164 Ga0466959_0082778 3300045049 Bacteria 2312
165 Ga0466958_0001704 3300045836 Bacteria 10605
166 Ga0466967_0004046 3300045976 Bacteria 9780
167 Ga0466967_0220247 3300045976 Bacteria 1803
168 Ga0495606_0040167 3300046507 Bacteria 3146
169 Ga0496101_0140392 3300048904 Bacteria 1841
170 Ga0496104_0197272 3300048907 Bacteria 1925
171 Ga0496104_0439816 3300048907 Bacteria 1216
172 Ga0496106_0321372 3300048909 Bacteria 1242
173 Ga0496110_0229536 3300048913 Bacteria 1688
174 Ga0496112_0131087 3300048915 Bacteria 2478
175 Ga0496114_0078158 3300048917 Bacteria 2792
176 Ga0501034_0001613 3300049571 Bacteria 29293
177 Ga0501034_0049471 3300049571 Bacteria 4241
178 Ga0501038_0076288 3300049574 Bacteria 2832
179 Ga0501043_0181812 3300049579 Bacteria 1638
180 Ga0501047_0178524 3300049581 Bacteria 1990
181 Ga0501070_0066271 3300049586 Bacteria 2990
182 Ga0501035_0144205 3300049822 Bacteria 2069
183 Ga0436361_0443187
184 Ga0070658_10003315
185 Ga0070658_10137379
186 Ga0070683_100008618
187 Ga0070683_100027105
188 Ga0070670_100035854
189 Ga0070680_100151372
190 Ga0070660_100007429
191 Ga0070660_100162247
192 Ga0070691_10001314
193 Ga0070661_100057471
194 Ga0070661_100126461
195 Ga0070661_100289881
196 Ga0070668_100331928
197 Ga0070669_100029096
198 Ga0070675_100074889
199 Ga0070671_100032977
200 Ga0070674_100269716
201 Ga0070688_100009037
202 Ga0070659_100097079
203 Ga0070714_100004419
204 Ga0070714_100065396
205 Ga0070714_100367265
206 Ga0070663_100150910
207 Ga0070699_100511772
208 Ga0070679_100106634
209 Ga0070679_100217223
210 Ga0070684_100057101
211 Ga0070684_100075754
212 Ga0070684_100305573
213 Ga0068853_100065047
214 Ga0068853_100318626
215 Ga0070672_100043806
216 Ga0068855_100002927
217 Ga0068855_100054863
218 Ga0068855_100226208
219 Ga0070664_100072728
220 Ga0068857_100010305
221 Ga0068854_100000040
222 Ga0068856_100009828
223 Ga0068852_100042168
224 Ga0068859_100005447
225 Ga0068861_100193900
226 Ga0068851_10008899
227 Ga0068870_10015984
228 Ga0097620_100005447
229 Ga0111539_10598418
230 Ga0105248_10178588
231 Ga0105248_10484803
232 Ga0157373_10157624
233 Ga0157369_10011508
234 Ga0157369_10252810
235 Ga0157374_10027289
236 Ga0157372_10003298
237 Ga0157372_10019480
238 Ga0157372_10025024
239 Ga0157372_10543948
240 Ga0157375_10279159
241 Ga0157377_10026718
242 Ga0197907_11176683
243 Ga0206356_11146903
244 Ga0206354_10032140
245 Ga0213873_10032821
246 Ga0213872_10045681
247 Ga0213874_10000295
248 Ga0213876_10004559
249 Ga0213876_10016167
250 Ga0213875_10000001
251 Ga0213875_10027091
252 Ga0213871_10005140
253 Ga0207656_10012853
254 Ga0207682_10031005
255 Ga0207645_10211156
256 Ga0207645_10273722
257 Ga0207643_10020176
258 Ga0207705_10001197
259 Ga0207705_10009692
260 Ga0207705_10275101
261 Ga0207660_10116396
262 Ga0207660_10172725
263 Ga0207662_10122247
264 Ga0207657_10012430
265 Ga0207657_10146744
266 Ga0207649_10011850
267 Ga0207649_10021677
268 Ga0207649_10041792
269 Ga0207681_10023234
270 Ga0207690_10099069
271 Ga0207691_10004754
272 Ga0207691_10113293
273 Ga0207711_10423880
274 Ga0207661_10023445
275 Ga0207679_10132504
276 Ga0207667_10000101
277 Ga0207667_10006385
278 Ga0207667_10066076
279 Ga0207667_10109280
280 Ga0207667_10475948
281 Ga0207668_10147388
282 Ga0207640_10000039
283 Ga0207703_10376816
284 Ga0207639_10050217
285 Ga0207639_10081663
286 Ga0207639_10096904
287 Ga0207678_10036074
288 Ga0207702_10016887
289 Ga0207674_10011748
290 Ga0207674_10012406
291 Ga0207698_10201857
292 Ga0265356_1000955
293 Ga0265338_10000170
294 Ga0265760_10000348
295 Ga0265325_10000069
296 Ga0265325_10008019
297 Ga0265339_10011266
298 Ga0265316_10022438
299 Ga0265313_10000065
300 Ga0316579_10033094
301 Ga0316579_10054887
302 Ga0265342_10006318
303 Ga0316577_10000471
304 Ga0316582_0017579
305 Ga0316582_0054784
306 Ga0316584_0016323
307 Ga0316584_0038928
308 Ga0395899_0002886
309 Ga0395898_0006153
310 Ga0436364_0273345
311 Ga0436364_0942733
312 Ga0436364_1123345
313 Ga0436364_1376159
314 Ga0395901_0007973
315 Ga0436365_0988130
316 Ga0436365_1140493
317 Ga0436365_1192893
318 Ga0436365_1641211
319 Ga0436365_1650147
320 Ga0436360_0211894
321 Ga0436360_0265761
322 Ga0436360_0352805
323 Ga0436360_0418730
324 Ga0436360_0620985
325 Ga0436360_0785853
326 Ga0436361_0086089
327 Ga0436361_0262283
328 Ga0436361_0703102
329 Ga0436363_0019426
330 Ga0436363_0683401
331 Ga0436363_0776538
332 Ga0436363_0930199
333 Ga0436363_1578239
334 Ga0436362_0136272
335 Ga0436362_0290744
336 Ga0436362_0470449
337 Ga0436362_0487331
338 Ga0436362_0731517
339 Ga0436362_0750279
340 Ga0436362_0986466
341 Ga0436362_1132883
342 Ga0436362_1250429
343 Ga0436362_1303168
344 Ga0466966_0005417
345 Ga0466963_0002942
346 Ga0466959_0082778
347 Ga0466958_0001704
348 Ga0466967_0004046
349 Ga0466967_0220247
350 Ga0495606_0040167
351 Ga0496101_0140392
352 Ga0496104_0197272
353 Ga0496104_0439816
354 Ga0496106_0321372
355 Ga0496110_0229536
356 Ga0496112_0131087
357 Ga0496114_0078158
358 Ga0501034_0001613
359 Ga0501034_0049471
360 Ga0501038_0076288
361 Ga0501043_0181812
362 Ga0501047_0178524
363 Ga0501070_0066271
364 Ga0501035_0144205

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

37

199

0.97

PF06463

Mob_synth_C

Molybdenum Cofactor Synthesis C

204

332

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tv8-assembly1.cif.gz_A structure of moaa in complex with s-adenosylmethionine 0.8343 3 324
2fb2-assembly1.cif.gz_B structure of the moaa arg17/266/268/ala triple mutant 0.8308 4 324
2fb2-assembly1.cif.gz_B structure of the moaa arg17/266/268/ala triple mutant 0.7996 4 324
7tol-assembly1.cif.gz_A x-ray crystal structure of glycerol dibiphytanyl glycerol tetraether - macrocyclic archaeol synthase (gdgt-mas) from methanocaldococcus jannaschii with archaeal lipid, 5'deoxyadenosine, and methionine bound 0.7937 9 220
7tom-assembly1.cif.gz_A x-ray crystal structure of glycerol dibiphytanyl glycerol tetraether - macrocyclic archaeol synthase (gdgt-mas) from methanocaldococcus jannaschii with bacterial lipid substrate analog, 5'deoxyadenosine, and methionine bound 0.7858 9 220
ID Description Score Start End Superfamily
af_I1KTQ5_72_400_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9077 4 327 3.20.20.70
af_P9WJS1_27_360_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9063 1 313 3.20.20.70
af_P9WJS3_16_359_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8981 3 319 3.20.20.70
af_I1KTQ5_72_400_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8971 4 327 3.20.20.70
af_P30745_1_329_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8912 2 327 3.20.20.70
ID Description Score Start End GO Terms
AF-X4ZQK9-F1-model_v4 GTP 3',8-cyclase (EC 4.1.99.22) (Molybdenum cofactor biosynthesis protein A) 0.9468 1 312 GO:0005525
GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
GO:1904047
AF-A0A1G3AX28-F1-model_v4 GTP 3',8-cyclase (EC 4.1.99.22) 0.9456 4 276 GO:0005525
GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
AF-A0A7X6WYY9-F1-model_v4 Radical SAM protein 0.945 2 119 GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
AF-A0A7M5X260-F1-model_v4 Radical SAM core domain-containing protein 0.9442 3 178 GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
AF-X1I9U9-F1-model_v4 Radical SAM core domain-containing protein 0.9438 31 135 GO:0006777
GO:0046872
GO:0051536
GO:0061798
GO:0061799

Map