F279398

General Info

Members Datasets Scaffolds Average Seq Length
182 113 364 218

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100512592|Ga0307416_1005125921
Length 240
Sequence MPLPSGLHDKAVKSCPLVRCPLSPSSMQIFYLHGFASSARSSKATFFAAKLREQGIELHTPDFNEPDFSTLTITRMVEQVGRAVEAVAPEPVVLIGSSLGAFVAVQAALKHPGRVARMVLLAPALDFGGNRMKSLGDTGLDEWKRRDRLDIFHHGYGRMMPVHYELYADARRYDCVEAALTMPIQVFQGRRDDAVDPDVVERWSRARPNVELHMLDDDHQLTASVGYVWEEMKKFLERDG

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
62 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
63 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
65 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
66 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
67 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
70 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
71 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
75 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
76 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
77 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
78 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
79 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
80 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
90 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
91 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
92 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
93 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
94 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
95 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
96 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
98 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
99 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
100 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
101 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
102 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
103 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
104 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
105 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
106 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
107 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
108 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
109 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
110 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
111 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
112 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
113 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.19
Nodule 0
Rhizoplane 0.55
Rhizosphere 86.26
Stem 0
Stem Tuber 0
Unclassified 18.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_100512592 3300032002 Bacteria 1266
2 Ga0065712_10089787 3300005290 Bacteria 2453
3 Ga0070658_10123961 3300005327 Bacteria 2149
4 Ga0070683_100195623 3300005329 Bacteria 1920
5 Ga0068869_100044099 3300005334 Bacteria 3207
6 Ga0070660_100113189 3300005339 Unclassified 2160
7 Ga0070692_10252837 3300005345 Unclassified 1056
8 Ga0070675_100265918 3300005354 Bacteria 1504
9 Ga0070675_100872288 3300005354 Unclassified 824
10 Ga0070674_100266503 3300005356 Bacteria 1352
11 Ga0070688_100041113 3300005365 Unclassified 2836
12 Ga0070659_100056027 3300005366 Unclassified 3108
13 Ga0070709_10425595 3300005434 Unclassified 996
14 Ga0070706_100212408 3300005467 Unclassified 1807
15 Ga0070707_100653484 3300005468 Bacteria 1014
16 Ga0070698_100204844 3300005471 Bacteria 1908
17 Ga0070699_100019500 3300005518 Bacteria 5841
18 Ga0070679_100983616 3300005530 Unclassified 788
19 Ga0070684_100095333 3300005535 Bacteria 2651
20 Ga0068853_100082887 3300005539 Unclassified 2809
21 Ga0070672_100528965 3300005543 Bacteria 1022
22 Ga0070686_100127739 3300005544 Bacteria 1754
23 Ga0070696_100130340 3300005546 Bacteria 1829
24 Ga0068855_100111238 3300005563 Unclassified 3144
25 Ga0068856_100176476 3300005614 Unclassified 2149
26 Ga0070702_100593820 3300005615 Unclassified 829
27 Ga0068861_100013371 3300005719 Bacteria 5745
28 Ga0068861_100447933 3300005719 Bacteria 1156
29 Ga0068858_101402276 3300005842 Bacteria 688
30 Ga0081455_10333314 3300005937 Unclassified 1076
31 Ga0075365_10009267 3300006038 Bacteria 5648
32 Ga0075365_10038980 3300006038 Bacteria 3091
33 Ga0075368_10050921 3300006042 Bacteria 1646
34 Ga0075368_10059747 3300006042 Unclassified 1525
35 Ga0075364_10001821 3300006051 Bacteria 11809
36 Ga0075364_10091282 3300006051 Bacteria 2021
37 Ga0075364_10105925 3300006051 Bacteria 1873
38 Ga0075364_10187876 3300006051 Bacteria 1399
39 Ga0075362_10007227 3300006177 Bacteria 4191
40 Ga0075366_10001893 3300006195 Bacteria 10574
41 Ga0075366_10002510 3300006195 Bacteria 9421
42 Ga0075366_10003348 3300006195 Bacteria 8440
43 Ga0075370_10011386 3300006353 Bacteria 4670
44 Ga0075428_100000748 3300006844 Bacteria 33775
45 Ga0075428_100008118 3300006844 Bacteria 11656
46 Ga0075428_100117817 3300006844 Unclassified 2893
47 Ga0075430_100007858 3300006846 Bacteria 9017
48 Ga0075430_100020665 3300006846 Bacteria 5600
49 Ga0075430_100135034 3300006846 Bacteria 2056
50 Ga0075430_100157496 3300006846 Bacteria 1890
51 Ga0075431_100008228 3300006847 Bacteria 10425
52 Ga0075431_100009656 3300006847 Bacteria 9688
53 Ga0075431_100024623 3300006847 Bacteria 6170
54 Ga0075431_100505661 3300006847 Bacteria 1199
55 Ga0075433_10001522 3300006852 Bacteria 17130
56 Ga0075434_100194060 3300006871 Bacteria 2051
57 Ga0075429_100015787 3300006880 Bacteria 6541
58 Ga0075429_100139859 3300006880 Unclassified 2119
59 Ga0075429_100223397 3300006880 Bacteria 1650
60 Ga0105240_10288439 3300009093 Bacteria 1882
61 Ga0105240_10951590 3300009093 Unclassified 921
62 Ga0111539_10000860 3300009094 Bacteria 39623
63 Ga0111539_10007556 3300009094 Bacteria 13897
64 Ga0111539_10031880 3300009094 Bacteria 6402
65 Ga0111539_10272964 3300009094 Bacteria 1968
66 Ga0111539_10436242 3300009094 Bacteria 1525
67 Ga0111539_10565862 3300009094 Unclassified 1324
68 Ga0111539_10780874 3300009094 Unclassified 1112
69 Ga0114129_10000684 3300009147 Bacteria 42801
70 Ga0114129_10004215 3300009147 Bacteria 20311
71 Ga0114129_10018125 3300009147 Bacteria 10027
72 Ga0114129_10060133 3300009147 Bacteria 5312
73 Ga0114129_10158937 3300009147 Bacteria 3089
74 Ga0105242_10188244 3300009176 Bacteria 1825
75 Ga0105248_10152383 3300009177 Bacteria 2609
76 Ga0105238_10172685 3300009551 Bacteria 2138
77 Ga0105249_10934304 3300009553 Unclassified 935
78 Ga0157380_10468519 3300014326 Bacteria 1215
79 Ga0157380_10574491 3300014326 Unclassified 1110
80 Ga0207699_10322348 3300025906 Bacteria 1084
81 Ga0207705_10194296 3300025909 Bacteria 1536
82 Ga0207684_10179200 3300025910 Unclassified 1827
83 Ga0207695_10652788 3300025913 Unclassified 933
84 Ga0207657_10017694 3300025919 Bacteria 6825
85 Ga0207652_10101434 3300025921 Unclassified 2542
86 Ga0207646_10593667 3300025922 Bacteria 994
87 Ga0207659_10783969 3300025926 Bacteria 818
88 Ga0207711_10403638 3300025941 Bacteria 1270
89 Ga0207661_10117595 3300025944 Bacteria 2258
90 Ga0207667_10654356 3300025949 Bacteria 1056
91 Ga0207648_10557667 3300026089 Bacteria 1053
92 Ga0209813_10064320 3300027866 Bacteria 1178
93 Ga0207428_10063645 3300027907 Unclassified 2913
94 Ga0207428_10065183 3300027907 Unclassified 2874
95 Ga0207428_10074894 3300027907 Bacteria 2654
96 Ga0268265_10372690 3300028380 Unclassified 1311
97 Ga0307408_100007755 3300031548 Bacteria 7097
98 Ga0307408_100016127 3300031548 Bacteria 4983
99 Ga0307408_100096407 3300031548 Bacteria 2244
100 Ga0307408_100135253 3300031548 Bacteria 1928
101 Ga0307405_10284078 3300031731 Bacteria 1247
102 Ga0307413_10159965 3300031824 Bacteria 1581
103 Ga0307406_10343679 3300031901 Bacteria 1163
104 Ga0307409_100769207 3300031995 Bacteria 968
105 Ga0307409_100815042 3300031995 Bacteria 942
106 Ga0307409_101239813 3300031995 Bacteria 770
107 Ga0307416_100013362 3300032002 Bacteria 5577
108 Ga0307416_100141546 3300032002 Bacteria 2187
109 Ga0307416_100570008 3300032002 Bacteria 1208
110 Ga0373943_0055074 3300035170 Bacteria 1969
111 Ga0373943_0269329 3300035170 Bacteria 960
112 Ga0373947_0017222 3300035725 Bacteria 4156
113 Ga0373937_0300582 3300036401 Bacteria 1517
114 Ga0373937_1005484 3300036401 Bacteria 783
115 Ga0373925_0013054 3300037068 Bacteria 6014
116 Ga0395900_0309364 3300037418 Bacteria 1564
117 Ga0439433_0058986 3300041999 Bacteria 913
118 Ga0439435_0008224 3300042436 Bacteria 2415
119 Ga0439435_0021795 3300042436 Bacteria 1667
120 Ga0439435_0053767 3300042436 Bacteria 1158
121 Ga0439460_0009000 3300042461 Unclassified 2527
122 Ga0439460_0022790 3300042461 Bacteria 1721
123 Ga0495600_0048146 3300046809 Bacteria 2781
124 Ga0495600_0251480 3300046809 Bacteria 1124
125 Ga0495680_0262604 3300047322 Bacteria 1221
126 Ga0496112_0814459 3300048915 Bacteria 858
127 Ga0501033_0304143 3300049570 Unclassified 1122
128 Ga0501033_0613325 3300049570 Bacteria 745
129 Ga0501034_0003988 3300049571 Bacteria 16583
130 Ga0501036_0056715 3300049572 Bacteria 3319
131 Ga0501038_0450451 3300049574 Bacteria 990
132 Ga0501040_0050493 3300049576 Bacteria 2845
133 Ga0501040_0108881 3300049576 Bacteria 1937
134 Ga0501041_0168503 3300049577 Bacteria 1370
135 Ga0501042_0043176 3300049578 Bacteria 3210
136 Ga0501042_0394831 3300049578 Unclassified 1002
137 Ga0501046_0081688 3300049580 Bacteria 2496
138 Ga0501048_0120612 3300049582 Bacteria 1853
139 Ga0501071_0025026 3300049587 Bacteria 4179
140 Ga0501071_0208707 3300049587 Bacteria 1468
141 Ga0501072_0078044 3300049588 Bacteria 2622
142 Ga0501072_0153206 3300049588 Bacteria 1838
143 Ga0501074_0152188 3300049590 Bacteria 1654
144 Ga0501075_0012943 3300049591 Bacteria 5943
145 Ga0501076_0497468 3300049592 Unclassified 1005
146 Ga0501079_0049569 3300049741 Bacteria 3241
147 Ga0501081_0141700 3300049743 Bacteria 1723
148 Ga0501035_0340312 3300049822 Bacteria 1257
149 Ga0501045_0001414 3300049824 Bacteria 16015
150 nmdc:mga03683_9302_c1 3300050489 Bacteria 3487
151 nmdc:mga00v17_1892_c1 3300050491 Bacteria 10835
152 nmdc:mga00v17_63433_c1 3300050491 Bacteria 2276
153 nmdc:mga00v17_87123_c1 3300050491 Bacteria 1957
154 nmdc:mga0yw44_193626_c1 3300050492 Bacteria 1341
155 nmdc:mga0yw44_38180_c1 3300050492 Bacteria 2840
156 nmdc:mga0k408_2025_c1 3300050493 Bacteria 10855
157 nmdc:mga0k408_4427_c1 3300050493 Bacteria 7454
158 nmdc:mga0k408_7406_c1 3300050493 Bacteria 5860
159 nmdc:mga06z11_5593_c1 3300050494 Bacteria 5054
160 nmdc:mga05p37_145466_c1 3300050507 Unclassified 2903
161 nmdc:mga05p37_2598_c1 3300050507 Bacteria 5880
162 nmdc:mga05p37_58032_c1 3300050507 Bacteria 4767
163 nmdc:mga05p37_59138_c1 3300050507 Bacteria 4721
164 nmdc:mga09592_100762_c1 3300050508 Bacteria 2474
165 nmdc:mga09592_81539_c1 3300050508 Bacteria 2756
166 nmdc:mga0qj67_116978_c1 3300050509 Bacteria 2155
167 nmdc:mga0qj67_30851_c1 3300050509 Unclassified 4174
168 nmdc:mga0qj67_48819_c1 3300050509 Bacteria 3344
169 nmdc:mga0qj67_50277_c1 3300050509 Bacteria 3296
170 nmdc:mga06r32_146336_c1 3300050510 Bacteria 2340
171 nmdc:mga06r32_76387_c1 3300050510 Bacteria 3253
172 nmdc:mga08y16_171578_c1 3300050511 Bacteria 2253
173 nmdc:mga08y16_18036_c1 3300050511 Bacteria 7434
174 nmdc:mga08y16_247129_c1 3300050511 Bacteria 1844
175 nmdc:mga08y16_411055_c1 3300050511 Bacteria 1384
176 nmdc:mga0a205_75854_c1 3300050515 Bacteria 3249
177 Ga0501084_0061844 3300054114 Bacteria 3135
178 Ga0590071_000489 3300059421 Bacteria 11569
179 Ga0590074_000227 3300059423 Bacteria 7416
180 Ga0501082_0082405 3300060353 Bacteria 2776
181 Ga0501082_0099825 3300060353 Bacteria 2510
182 Ga0530510_0014855 3300061734 Bacteria 5498
183 Ga0307416_100512592
184 Ga0065712_10089787
185 Ga0070658_10123961
186 Ga0070683_100195623
187 Ga0068869_100044099
188 Ga0070660_100113189
189 Ga0070692_10252837
190 Ga0070675_100265918
191 Ga0070675_100872288
192 Ga0070674_100266503
193 Ga0070688_100041113
194 Ga0070659_100056027
195 Ga0070709_10425595
196 Ga0070706_100212408
197 Ga0070707_100653484
198 Ga0070698_100204844
199 Ga0070699_100019500
200 Ga0070679_100983616
201 Ga0070684_100095333
202 Ga0068853_100082887
203 Ga0070672_100528965
204 Ga0070686_100127739
205 Ga0070696_100130340
206 Ga0068855_100111238
207 Ga0068856_100176476
208 Ga0070702_100593820
209 Ga0068861_100013371
210 Ga0068861_100447933
211 Ga0068858_101402276
212 Ga0081455_10333314
213 Ga0075365_10009267
214 Ga0075365_10038980
215 Ga0075368_10050921
216 Ga0075368_10059747
217 Ga0075364_10001821
218 Ga0075364_10091282
219 Ga0075364_10105925
220 Ga0075364_10187876
221 Ga0075362_10007227
222 Ga0075366_10001893
223 Ga0075366_10002510
224 Ga0075366_10003348
225 Ga0075370_10011386
226 Ga0075428_100000748
227 Ga0075428_100008118
228 Ga0075428_100117817
229 Ga0075430_100007858
230 Ga0075430_100020665
231 Ga0075430_100135034
232 Ga0075430_100157496
233 Ga0075431_100008228
234 Ga0075431_100009656
235 Ga0075431_100024623
236 Ga0075431_100505661
237 Ga0075433_10001522
238 Ga0075434_100194060
239 Ga0075429_100015787
240 Ga0075429_100139859
241 Ga0075429_100223397
242 Ga0105240_10288439
243 Ga0105240_10951590
244 Ga0111539_10000860
245 Ga0111539_10007556
246 Ga0111539_10031880
247 Ga0111539_10272964
248 Ga0111539_10436242
249 Ga0111539_10565862
250 Ga0111539_10780874
251 Ga0114129_10000684
252 Ga0114129_10004215
253 Ga0114129_10018125
254 Ga0114129_10060133
255 Ga0114129_10158937
256 Ga0105242_10188244
257 Ga0105248_10152383
258 Ga0105238_10172685
259 Ga0105249_10934304
260 Ga0157380_10468519
261 Ga0157380_10574491
262 Ga0207699_10322348
263 Ga0207705_10194296
264 Ga0207684_10179200
265 Ga0207695_10652788
266 Ga0207657_10017694
267 Ga0207652_10101434
268 Ga0207646_10593667
269 Ga0207659_10783969
270 Ga0207711_10403638
271 Ga0207661_10117595
272 Ga0207667_10654356
273 Ga0207648_10557667
274 Ga0209813_10064320
275 Ga0207428_10063645
276 Ga0207428_10065183
277 Ga0207428_10074894
278 Ga0268265_10372690
279 Ga0307408_100007755
280 Ga0307408_100016127
281 Ga0307408_100096407
282 Ga0307408_100135253
283 Ga0307405_10284078
284 Ga0307413_10159965
285 Ga0307406_10343679
286 Ga0307409_100769207
287 Ga0307409_100815042
288 Ga0307409_101239813
289 Ga0307416_100013362
290 Ga0307416_100141546
291 Ga0307416_100570008
292 Ga0373943_0055074
293 Ga0373943_0269329
294 Ga0373947_0017222
295 Ga0373937_0300582
296 Ga0373937_1005484
297 Ga0373925_0013054
298 Ga0395900_0309364
299 Ga0439433_0058986
300 Ga0439435_0008224
301 Ga0439435_0021795
302 Ga0439435_0053767
303 Ga0439460_0009000
304 Ga0439460_0022790
305 Ga0495600_0048146
306 Ga0495600_0251480
307 Ga0495680_0262604
308 Ga0496112_0814459
309 Ga0501033_0304143
310 Ga0501033_0613325
311 Ga0501034_0003988
312 Ga0501036_0056715
313 Ga0501038_0450451
314 Ga0501040_0050493
315 Ga0501040_0108881
316 Ga0501041_0168503
317 Ga0501042_0043176
318 Ga0501042_0394831
319 Ga0501046_0081688
320 Ga0501048_0120612
321 Ga0501071_0025026
322 Ga0501071_0208707
323 Ga0501072_0078044
324 Ga0501072_0153206
325 Ga0501074_0152188
326 Ga0501075_0012943
327 Ga0501076_0497468
328 Ga0501079_0049569
329 Ga0501081_0141700
330 Ga0501035_0340312
331 Ga0501045_0001414
332 nmdc:mga03683_9302_c1
333 nmdc:mga00v17_1892_c1
334 nmdc:mga00v17_63433_c1
335 nmdc:mga00v17_87123_c1
336 nmdc:mga0yw44_193626_c1
337 nmdc:mga0yw44_38180_c1
338 nmdc:mga0k408_2025_c1
339 nmdc:mga0k408_4427_c1
340 nmdc:mga0k408_7406_c1
341 nmdc:mga06z11_5593_c1
342 nmdc:mga05p37_145466_c1
343 nmdc:mga05p37_2598_c1
344 nmdc:mga05p37_58032_c1
345 nmdc:mga05p37_59138_c1
346 nmdc:mga09592_100762_c1
347 nmdc:mga09592_81539_c1
348 nmdc:mga0qj67_116978_c1
349 nmdc:mga0qj67_30851_c1
350 nmdc:mga0qj67_48819_c1
351 nmdc:mga0qj67_50277_c1
352 nmdc:mga06r32_146336_c1
353 nmdc:mga06r32_76387_c1
354 nmdc:mga08y16_171578_c1
355 nmdc:mga08y16_18036_c1
356 nmdc:mga08y16_247129_c1
357 nmdc:mga08y16_411055_c1
358 nmdc:mga0a205_75854_c1
359 Ga0501084_0061844
360 Ga0590071_000489
361 Ga0590074_000227
362 Ga0501082_0082405
363 Ga0501082_0099825
364 Ga0530510_0014855

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05728

UPF0227

Uncharacterised protein family (UPF0227)

28

237

0.86

PF00756

Esterase

Putative esterase

54

220

0.85

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

29

172

0.8

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

29

235

0.78

PF12146

Hydrolase_4

Serine aminopeptidase, S33

23

138

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wtn-assembly1.cif.gz_A ferulic acid bound to est1e from butyrivibrio proteoclasticus 0.8634 2 208
3llc-assembly1.cif.gz_A crystal structure of putative hydrolase (yp_002548124.1) from agrobacterium vitis s4 at 1.80 a resolution 0.8501 2 206
2qjw-assembly2.cif.gz_C crystal structure of a putative hydrolase of the alpha/beta superfamily (xcc1541) from xanthomonas campestris pv. campestris at 1.35 a resolution 0.8461 2 209
2wtn-assembly1.cif.gz_A ferulic acid bound to est1e from butyrivibrio proteoclasticus 0.8443 2 208
7xri-assembly1.cif.gz_B feruloyl esterase mutant -s106a 0.8423 2 204
ID Description Score Start End Superfamily
af_O17690_5_226_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8525 2 202 3.40.50.1820
af_A0A1D6K8I4_16_172_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8466 1 98 3.40.50.1820
af_A0A0R4IK35_1_258_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.845 50 92 3.40.50.1820
2qjwD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.842 2 209 3.40.50.1820
2wtnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8277 2 208 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A3N9N535-F1-model_v4 Esterase 0.973 2 99
AF-A0A2W4TPG8-F1-model_v4 Esterase 0.9643 2 206 GO:0004553
AF-A0A2V8EW06-F1-model_v4 Esterase 0.9606 2 211
AF-A0A1F2RB66-F1-model_v4 Esterase 0.9566 2 211 GO:0004553
GO:0008474
AF-A0A7X4HTU1-F1-model_v4 Alpha/beta fold hydrolase 0.9537 2 211 GO:0004553

Map