F279348

General Info

Members Datasets Scaffolds Average Seq Length
182 114 364 261

Family's Representative Sequence

Representative Sequence 3300031344|Ga0265316_10029696|Ga0265316_100296964
Length 275
Sequence MNRLADETVRDTSMETIDQVAEQREEAEKDGGTPVIALEDLHKSFGTQIVLNGISLSVRRGETLAVLGRSGTGKSVLLRIIIGLEKPDSGSVRIHDQDIAGLTLDKLGEIRIKMGFLFQHAALYDSLTVEQNVAFPLQHHKKEMPKSEQRDRVRALLAEVGMEGDFNKMPSDISGGMQKRVGLARALALEPDILLLDEPTAGLDPISSGEIDDLVLKLQAEHHMASIVVTHDLHSAKTIADRLALINEGDVVIEGNFEELQKSDVEFVREFLRYS

Samples

Sample ID Description Type Environment
1 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
51 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
52 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
53 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
54 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
77 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
80 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
84 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
85 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
86 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
87 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
88 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
89 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
90 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
91 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
92 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
93 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
94 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
95 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
96 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
97 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
99 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
100 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
103 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
104 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
105 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
106 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
107 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
108 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
109 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
110 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
111 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
112 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
113 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
114 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.41
Metatranscriptomes 6.59
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.45
Stem 0
Stem Tuber 0
Unclassified 8.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265316_10029696 3300031344 Bacteria 4490
2 Ga0070658_10000969 3300005327 Bacteria 24601
3 Ga0070683_100000422 3300005329 Bacteria 29297
4 Ga0070690_100110906 3300005330 Bacteria 1831
5 Ga0070680_100003840 3300005336 Bacteria 11230
6 Ga0070680_100041273 3300005336 Bacteria 3741
7 Ga0070660_100003240 3300005339 Bacteria 11173
8 Ga0070689_100127752 3300005340 Bacteria 2036
9 Ga0070687_100165973 3300005343 Bacteria 1310
10 Ga0070673_100414447 3300005364 Bacteria 1207
11 Ga0070703_10006518 3300005406 Bacteria 3272
12 Ga0070713_100026353 3300005436 Bacteria 4562
13 Ga0070705_100029760 3300005440 Bacteria 3008
14 Ga0070694_100005681 3300005444 Bacteria 7562
15 Ga0070694_100029667 3300005444 Unclassified 3571
16 Ga0070708_100005360 3300005445 Bacteria 10175
17 Ga0070708_100017024 3300005445 Bacteria 6051
18 Ga0070681_10000673 3300005458 Bacteria 28298
19 Ga0070681_10087857 3300005458 Bacteria 3061
20 Ga0070681_10090180 3300005458 Bacteria 3016
21 Ga0070685_10105466 3300005466 Bacteria 1727
22 Ga0070706_100056443 3300005467 Bacteria 3624
23 Ga0070707_100031812 3300005468 Bacteria 5025
24 Ga0070699_100010641 3300005518 Bacteria 7964
25 Ga0070679_100003648 3300005530 Bacteria 14088
26 Ga0070679_100404764 3300005530 Bacteria 1310
27 Ga0070684_100000235 3300005535 Bacteria 38276
28 Ga0070697_100000263 3300005536 Bacteria 42582
29 Ga0070695_100040540 3300005545 Bacteria 2948
30 Ga0070696_100005666 3300005546 Bacteria 8342
31 Ga0070693_100000019 3300005547 Bacteria 60801
32 Ga0070704_100003511 3300005549 Bacteria 9005
33 Ga0068855_100016334 3300005563 Bacteria 8926
34 Ga0068855_100037411 3300005563 Bacteria 5771
35 Ga0068854_100422152 3300005578 Bacteria 1108
36 Ga0068856_100004286 3300005614 Bacteria 14230
37 Ga0068858_100456773 3300005842 Bacteria 1231
38 Ga0068860_100084532 3300005843 Unclassified 3019
39 Ga0081539_10023833 3300005985 Unclassified 3993
40 Ga0097621_100000556 3300006237 Bacteria 26206
41 Ga0097621_100384612 3300006237 Bacteria 1254
42 Ga0068871_100001881 3300006358 Bacteria 14196
43 Ga0068865_100204743 3300006881 Bacteria 1534
44 Ga0099794_10000941 3300007265 Bacteria 9814
45 Ga0099794_10031046 3300007265 Bacteria 2498
46 Ga0105240_10007941 3300009093 Bacteria 15310
47 Ga0105240_10230036 3300009093 Bacteria 2155
48 Ga0105247_10060294 3300009101 Bacteria 2351
49 Ga0114129_10069886 3300009147 Bacteria 4896
50 Ga0105248_10000019 3300009177 Bacteria 285766
51 Ga0105238_10000975 3300009551 Bacteria 29315
52 Ga0105249_10151951 3300009553 Bacteria 2230
53 Ga0157370_10001961 3300013104 Bacteria 25347
54 Ga0157370_10094397 3300013104 Bacteria 2806
55 Ga0157369_10001583 3300013105 Bacteria 27866
56 Ga0157369_10004894 3300013105 Bacteria 15708
57 Ga0163162_10482617 3300013306 Bacteria 1371
58 Ga0157372_10001392 3300013307 Bacteria 26073
59 Ga0157372_10004494 3300013307 Bacteria 14875
60 Ga0157372_10021440 3300013307 Bacteria 6981
61 Ga0157379_10125031 3300014968 Bacteria 2314
62 Ga0157376_10035748 3300014969 Bacteria 4020
63 Ga0184599_142809 3300019188 Bacteria 1088
64 Ga0224570_100918 3300022730 Bacteria 2346
65 Ga0224569_100068 3300022732 Bacteria 6651
66 Ga0224569_106416 3300022732 Unclassified 862
67 Ga0224572_1011798 3300024225 Bacteria 1654
68 Ga0224572_1015787 3300024225 Bacteria 1448
69 Ga0228598_1002749 3300024227 Bacteria 3809
70 Ga0207653_10004376 3300025885 Bacteria 4429
71 Ga0207710_10121575 3300025900 Bacteria 1247
72 Ga0207705_10001322 3300025909 Bacteria 19850
73 Ga0207705_10198656 3300025909 Bacteria 1519
74 Ga0207684_10044478 3300025910 Bacteria 3766
75 Ga0207707_10017424 3300025912 Bacteria 6262
76 Ga0207707_10042707 3300025912 Bacteria 3956
77 Ga0207707_10068636 3300025912 Bacteria 3089
78 Ga0207695_10008161 3300025913 Bacteria 13161
79 Ga0207695_10161357 3300025913 Bacteria 2173
80 Ga0207660_10102278 3300025917 Bacteria 2142
81 Ga0207662_10089941 3300025918 Bacteria 1887
82 Ga0207657_10007846 3300025919 Bacteria 10894
83 Ga0207652_10006332 3300025921 Bacteria 9561
84 Ga0207652_10452709 3300025921 Bacteria 1157
85 Ga0207646_10003690 3300025922 Bacteria 17098
86 Ga0207646_10070251 3300025922 Bacteria 3127
87 Ga0207694_10042816 3300025924 Bacteria 3493
88 Ga0207700_10037319 3300025928 Bacteria 3518
89 Ga0207670_10051801 3300025936 Bacteria 2758
90 Ga0207665_10136921 3300025939 Bacteria 1743
91 Ga0207711_10000109 3300025941 Bacteria 85958
92 Ga0207711_10048930 3300025941 Bacteria 3618
93 Ga0207661_10000362 3300025944 Bacteria 29143
94 Ga0207667_10000888 3300025949 Bacteria 38094
95 Ga0207667_10012961 3300025949 Bacteria 9574
96 Ga0207712_10137368 3300025961 Bacteria 1871
97 Ga0207702_10001330 3300026078 Bacteria 24720
98 Ga0207698_10004348 3300026142 Bacteria 8629
99 Ga0209588_1003405 3300027671 Bacteria 4410
100 Ga0209588_1036075 3300027671 Bacteria 1590
101 Ga0265323_10033831 3300028653 Bacteria 1890
102 Ga0265336_10002165 3300028666 Bacteria 8300
103 Ga0265338_10002423 3300028800 Bacteria 28050
104 Ga0265338_10023680 3300028800 Bacteria 6300
105 Ga0265338_10049111 3300028800 Bacteria 3829
106 Ga0265338_10054960 3300028800 Unclassified 3546
107 Ga0265338_10104046 3300028800 Bacteria 2305
108 Ga0265338_10114088 3300028800 Bacteria 2169
109 Ga0265338_10131890 3300028800 Bacteria 1971
110 Ga0265324_10019446 3300029957 Bacteria 2446
111 Ga0265762_1000581 3300030760 Bacteria 6454
112 Ga0265762_1002187 3300030760 Unclassified 3540
113 Ga0265762_1002572 3300030760 Bacteria 3264
114 Ga0265775_100029 3300030762 Bacteria 4330
115 Ga0265775_100638 3300030762 Unclassified 1471
116 Ga0265760_10001838 3300031090 Bacteria 6233
117 Ga0265760_10002724 3300031090 Bacteria 5170
118 Ga0265760_10047569 3300031090 Bacteria 1288
119 Ga0265760_10057056 3300031090 Bacteria 1182
120 Ga0265330_10000162 3300031235 Bacteria 53432
121 Ga0265330_10003631 3300031235 Bacteria 8029
122 Ga0265330_10003940 3300031235 Bacteria 7629
123 Ga0265330_10040704 3300031235 Bacteria 2063
124 Ga0265330_10046552 3300031235 Bacteria 1911
125 Ga0265330_10114222 3300031235 Bacteria 1152
126 Ga0265328_10006597 3300031239 Bacteria 4887
127 Ga0265320_10014895 3300031240 Bacteria 4409
128 Ga0265325_10000115 3300031241 Bacteria 54808
129 Ga0265325_10009851 3300031241 Bacteria 5563
130 Ga0265325_10010322 3300031241 Bacteria 5414
131 Ga0265325_10011576 3300031241 Bacteria 5068
132 Ga0265325_10063397 3300031241 Bacteria 1870
133 Ga0265329_10014297 3300031242 Bacteria 2805
134 Ga0265340_10011663 3300031247 Bacteria 4665
135 Ga0265340_10048369 3300031247 Bacteria 2068
136 Ga0265340_10062744 3300031247 Unclassified 1774
137 Ga0265339_10000031 3300031249 Bacteria 133838
138 Ga0265339_10000303 3300031249 Bacteria 40159
139 Ga0265339_10001552 3300031249 Bacteria 16982
140 Ga0265339_10027791 3300031249 Unclassified 3223
141 Ga0265339_10057201 3300031249 Bacteria 2109
142 Ga0265339_10067290 3300031249 Unclassified 1916
143 Ga0265316_10000358 3300031344 Bacteria 51502
144 Ga0265316_10010167 3300031344 Bacteria 8595
145 Ga0265316_10011615 3300031344 Bacteria 7931
146 Ga0265316_10026062 3300031344 Bacteria 4871
147 Ga0265316_10065934 3300031344 Unclassified 2803
148 Ga0265316_10109127 3300031344 Bacteria 2097
149 Ga0265316_10155564 3300031344 Bacteria 1711
150 Ga0265313_10003543 3300031595 Bacteria 12584
151 Ga0265313_10017684 3300031595 Bacteria 4035
152 Ga0265314_10001343 3300031711 Bacteria 27813
153 Ga0265314_10005943 3300031711 Bacteria 10906
154 Ga0265314_10029442 3300031711 Unclassified 4081
155 Ga0265314_10096922 3300031711 Bacteria 1907
156 Ga0265314_10135373 3300031711 Bacteria 1531
157 Ga0265342_10000236 3300031712 Bacteria 61931
158 Ga0265342_10061808 3300031712 Bacteria 2206
159 Ga0316215_1002217 3300033544 Bacteria 1835
160 Ga0373949_0025785 3300035090 Bacteria 1374
161 Ga0373941_0009016 3300035115 Bacteria 2501
162 Ga0373927_0003962 3300035695 Bacteria 10477
163 Ga0265778_000028 3300036457 Bacteria 8157
164 Ga0265778_000238 3300036457 Bacteria 3994
165 Ga0451577_0250043 3300042876 Bacteria 1605
166 Ga0453683_0080838 3300044673 Bacteria 2036
167 Ga0453684_0021544 3300044712 Bacteria 9622
168 Ga0451576_0619060 3300045051 Bacteria 1138
169 Ga0495651_0000074 3300046462 Bacteria 73436
170 Ga0495580_0208568 3300046472 Bacteria 1345
171 Ga0495639_0093381 3300046475 Bacteria 1414
172 Ga0495608_0216155 3300046511 Bacteria 1204
173 Ga0495645_0046772 3300046543 Unclassified 3154
174 Ga0495667_0008338 3300046559 Bacteria 7029
175 Ga0495600_0054047 3300046809 Unclassified 2623
176 Ga0495604_0267234 3300047317 Unclassified 1160
177 Ga0495636_0036428 3300047318 Bacteria 2029
178 Ga0495680_0000184 3300047322 Bacteria 66329
179 Ga0495675_0094321 3300047444 Bacteria 1877
180 nmdc:mga05p37_1123995_c1 3300050507 Bacteria 820
181 nmdc:mga05p37_162556_c1 3300050507 Bacteria 2726
182 nmdc:mga08x19_41805_c1 3300050514 Bacteria 2919
183 Ga0265316_10029696
184 Ga0070658_10000969
185 Ga0070683_100000422
186 Ga0070690_100110906
187 Ga0070680_100003840
188 Ga0070680_100041273
189 Ga0070660_100003240
190 Ga0070689_100127752
191 Ga0070687_100165973
192 Ga0070673_100414447
193 Ga0070703_10006518
194 Ga0070713_100026353
195 Ga0070705_100029760
196 Ga0070694_100005681
197 Ga0070694_100029667
198 Ga0070708_100005360
199 Ga0070708_100017024
200 Ga0070681_10000673
201 Ga0070681_10087857
202 Ga0070681_10090180
203 Ga0070685_10105466
204 Ga0070706_100056443
205 Ga0070707_100031812
206 Ga0070699_100010641
207 Ga0070679_100003648
208 Ga0070679_100404764
209 Ga0070684_100000235
210 Ga0070697_100000263
211 Ga0070695_100040540
212 Ga0070696_100005666
213 Ga0070693_100000019
214 Ga0070704_100003511
215 Ga0068855_100016334
216 Ga0068855_100037411
217 Ga0068854_100422152
218 Ga0068856_100004286
219 Ga0068858_100456773
220 Ga0068860_100084532
221 Ga0081539_10023833
222 Ga0097621_100000556
223 Ga0097621_100384612
224 Ga0068871_100001881
225 Ga0068865_100204743
226 Ga0099794_10000941
227 Ga0099794_10031046
228 Ga0105240_10007941
229 Ga0105240_10230036
230 Ga0105247_10060294
231 Ga0114129_10069886
232 Ga0105248_10000019
233 Ga0105238_10000975
234 Ga0105249_10151951
235 Ga0157370_10001961
236 Ga0157370_10094397
237 Ga0157369_10001583
238 Ga0157369_10004894
239 Ga0163162_10482617
240 Ga0157372_10001392
241 Ga0157372_10004494
242 Ga0157372_10021440
243 Ga0157379_10125031
244 Ga0157376_10035748
245 Ga0184599_142809
246 Ga0224570_100918
247 Ga0224569_100068
248 Ga0224569_106416
249 Ga0224572_1011798
250 Ga0224572_1015787
251 Ga0228598_1002749
252 Ga0207653_10004376
253 Ga0207710_10121575
254 Ga0207705_10001322
255 Ga0207705_10198656
256 Ga0207684_10044478
257 Ga0207707_10017424
258 Ga0207707_10042707
259 Ga0207707_10068636
260 Ga0207695_10008161
261 Ga0207695_10161357
262 Ga0207660_10102278
263 Ga0207662_10089941
264 Ga0207657_10007846
265 Ga0207652_10006332
266 Ga0207652_10452709
267 Ga0207646_10003690
268 Ga0207646_10070251
269 Ga0207694_10042816
270 Ga0207700_10037319
271 Ga0207670_10051801
272 Ga0207665_10136921
273 Ga0207711_10000109
274 Ga0207711_10048930
275 Ga0207661_10000362
276 Ga0207667_10000888
277 Ga0207667_10012961
278 Ga0207712_10137368
279 Ga0207702_10001330
280 Ga0207698_10004348
281 Ga0209588_1003405
282 Ga0209588_1036075
283 Ga0265323_10033831
284 Ga0265336_10002165
285 Ga0265338_10002423
286 Ga0265338_10023680
287 Ga0265338_10049111
288 Ga0265338_10054960
289 Ga0265338_10104046
290 Ga0265338_10114088
291 Ga0265338_10131890
292 Ga0265324_10019446
293 Ga0265762_1000581
294 Ga0265762_1002187
295 Ga0265762_1002572
296 Ga0265775_100029
297 Ga0265775_100638
298 Ga0265760_10001838
299 Ga0265760_10002724
300 Ga0265760_10047569
301 Ga0265760_10057056
302 Ga0265330_10000162
303 Ga0265330_10003631
304 Ga0265330_10003940
305 Ga0265330_10040704
306 Ga0265330_10046552
307 Ga0265330_10114222
308 Ga0265328_10006597
309 Ga0265320_10014895
310 Ga0265325_10000115
311 Ga0265325_10009851
312 Ga0265325_10010322
313 Ga0265325_10011576
314 Ga0265325_10063397
315 Ga0265329_10014297
316 Ga0265340_10011663
317 Ga0265340_10048369
318 Ga0265340_10062744
319 Ga0265339_10000031
320 Ga0265339_10000303
321 Ga0265339_10001552
322 Ga0265339_10027791
323 Ga0265339_10057201
324 Ga0265339_10067290
325 Ga0265316_10000358
326 Ga0265316_10010167
327 Ga0265316_10011615
328 Ga0265316_10026062
329 Ga0265316_10065934
330 Ga0265316_10109127
331 Ga0265316_10155564
332 Ga0265313_10003543
333 Ga0265313_10017684
334 Ga0265314_10001343
335 Ga0265314_10005943
336 Ga0265314_10029442
337 Ga0265314_10096922
338 Ga0265314_10135373
339 Ga0265342_10000236
340 Ga0265342_10061808
341 Ga0316215_1002217
342 Ga0373949_0025785
343 Ga0373941_0009016
344 Ga0373927_0003962
345 Ga0265778_000028
346 Ga0265778_000238
347 Ga0451577_0250043
348 Ga0453683_0080838
349 Ga0453684_0021544
350 Ga0451576_0619060
351 Ga0495651_0000074
352 Ga0495580_0208568
353 Ga0495639_0093381
354 Ga0495608_0216155
355 Ga0495645_0046772
356 Ga0495667_0008338
357 Ga0495600_0054047
358 Ga0495604_0267234
359 Ga0495636_0036428
360 Ga0495680_0000184
361 Ga0495675_0094321
362 nmdc:mga05p37_1123995_c1
363 nmdc:mga05p37_162556_c1
364 nmdc:mga08x19_41805_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

51

201

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ch8-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9748 20 258
8fee-assembly1.cif.gz_H structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) 0.9731 22 259
7cha-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with amppnp 0.9678 20 258
7d06-assembly1.cif.gz_B cryo em structure of the nucleotide free acinetobacter mlafedb complex 0.9658 18 258
7ch8-assembly1.cif.gz_I cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9656 20 258
ID Description Score Start End Superfamily
af_P63386_5_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9838 20 259 3.40.50.300
af_P9WQL5_26_341_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9816 22 258 3.40.50.300
af_P14175_33_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9669 32 259 3.40.50.300
af_Q2FZR4_5_311_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9665 20 258 3.40.50.300
af_Q2G1F8_275_530_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9609 21 260 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3C0VK17-F1-model_v4 ABC transporter ATP-binding protein 0.9905 20 259 GO:0005524
GO:0016887
AF-A0A4Q3QM40-F1-model_v4 deleted 0.9855 20 220
AF-A0A6B2U183-F1-model_v4 deleted 0.9828 22 259
AF-A0A355FUD0-F1-model_v4 ABC transporter ATP-binding protein 0.9828 22 246 GO:0005524
GO:0016887
AF-A0A3A4NAN0-F1-model_v4 ATP-binding cassette domain-containing protein 0.9818 68 259 GO:0005524
GO:0016887

Map