F279154

General Info

Members Datasets Scaffolds Average Seq Length
182 146 182 161

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10000284|Ga0157372_1000028449
Length 176
Sequence MPLLLIVLFIVVPIAELYVIIQVGQLIGVWPTLFLLLADALLGSWLVKHQGRGAWRRFNEALAARRFPGKEVADGVLIVIGGTLLLTPGFITDIFGFFLLIPPTRAISRGLLKRFTIGRFAVVGVGGPGPFTRPSGGPRPNGGGSRPSRDYDFDATAEEVPSDGNGGPQLPRTERD

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
77 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
82 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
83 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
84 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
85 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
88 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
89 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
90 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
91 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
92 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
93 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
94 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
95 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
96 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
99 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
100 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
101 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
102 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
103 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
104 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
105 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
106 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
107 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
108 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
109 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
110 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
111 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
112 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
113 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
114 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
115 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
116 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
117 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
118 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
124 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
125 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
128 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
129 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
130 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
134 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
135 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
136 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
137 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
138 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
141 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
142 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
143 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
144 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
145 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
146 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.1
Nodule 0
Rhizoplane 12.09
Rhizosphere 84.62
Stem 0
Stem Tuber 0
Unclassified 2.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10133728 3300005327 Bacteria 2068
2 Ga0070683_100000527 3300005329 Bacteria 26899
3 Ga0070683_100137180 3300005329 Bacteria 2317
4 Ga0070683_100298500 3300005329 Bacteria 1532
5 Ga0070682_100000061 3300005337 Bacteria 105134
6 Ga0070682_100089832 3300005337 Bacteria 2007
7 Ga0070682_101233037 3300005337 Bacteria 633
8 Ga0068868_100000104 3300005338 Bacteria 52249
9 Ga0068868_100000220 3300005338 Bacteria 38739
10 Ga0070689_100096126 3300005340 Bacteria 2341
11 Ga0070692_10591253 3300005345 Bacteria 733
12 Ga0070668_100011266 3300005347 Bacteria 6658
13 Ga0070668_100264304 3300005347 Bacteria 1432
14 Ga0070675_100000091 3300005354 Bacteria 52149
15 Ga0070671_100624490 3300005355 Bacteria 932
16 Ga0070688_100000053 3300005365 Bacteria 55064
17 Ga0070667_100009466 3300005367 Bacteria 8081
18 Ga0070667_100121518 3300005367 Bacteria 2272
19 Ga0070714_100039823 3300005435 Bacteria 3959
20 Ga0070714_100208866 3300005435 Bacteria 1789
21 Ga0070710_10392548 3300005437 Bacteria 928
22 Ga0070678_100022708 3300005456 Bacteria 4164
23 Ga0070685_10000086 3300005466 Bacteria 57017
24 Ga0070684_100023132 3300005535 Bacteria 5190
25 Ga0070684_100326731 3300005535 Bacteria 1409
26 Ga0070684_100479917 3300005535 Bacteria 1151
27 Ga0068853_100393578 3300005539 Unclassified 1296
28 Ga0068853_100478424 3300005539 Bacteria 1174
29 Ga0070665_100069127 3300005548 Bacteria 3540
30 Ga0070665_100194910 3300005548 Bacteria 2027
31 Ga0070664_100133513 3300005564 Bacteria 2181
32 Ga0070664_100151737 3300005564 Bacteria 2046
33 Ga0068854_100004036 3300005578 Bacteria 9217
34 Ga0068856_100617890 3300005614 Bacteria 1105
35 Ga0068866_10012512 3300005718 Bacteria 3698
36 Ga0068861_100245303 3300005719 Unclassified 1526
37 Ga0068851_10000372 3300005834 Bacteria 20278
38 Ga0068863_100017589 3300005841 Bacteria 6848
39 Ga0068860_101095592 3300005843 Bacteria 816
40 Ga0068860_101418307 3300005843 Bacteria 716
41 Ga0068862_100000366 3300005844 Bacteria 49032
42 Ga0081455_10009396 3300005937 Bacteria 10060
43 Ga0081540_1000994 3300005983 Bacteria 25500
44 Ga0068871_100346961 3300006358 Bacteria 1312
45 Ga0075433_10011222 3300006852 Bacteria 7211
46 Ga0068865_100000081 3300006881 Bacteria 51047
47 Ga0105240_10646731 3300009093 Bacteria 1159
48 Ga0105247_10000148 3300009101 Bacteria 68936
49 Ga0105241_11542531 3300009174 Bacteria 641
50 Ga0105248_10000017 3300009177 Bacteria 298089
51 Ga0105249_10000916 3300009553 Bacteria 26081
52 Ga0157371_10002739 3300013102 Bacteria 16585
53 Ga0157370_10012635 3300013104 Bacteria 8747
54 Ga0157374_10249640 3300013296 Bacteria 1746
55 Ga0157378_11546358 3300013297 Bacteria 709
56 Ga0163162_10389237 3300013306 Bacteria 1527
57 Ga0157372_10000284 3300013307 Bacteria 56386
58 Ga0157375_10039309 3300013308 Bacteria 4553
59 Ga0157380_10000186 3300014326 Bacteria 35981
60 Ga0157379_10038557 3300014968 Bacteria 4263
61 Ga0157379_10489235 3300014968 Bacteria 1139
62 Ga0206356_11230926 3300020070 Bacteria 2476
63 Ga0207656_10000244 3300025321 Bacteria 18974
64 Ga0207642_10095014 3300025899 Bacteria 1482
65 Ga0207710_10000336 3300025900 Bacteria 35206
66 Ga0207657_10356782 3300025919 Bacteria 1153
67 Ga0207652_10394469 3300025921 Bacteria 1249
68 Ga0207659_10000707 3300025926 Bacteria 19793
69 Ga0207687_10003279 3300025927 Bacteria 10946
70 Ga0207700_10000003 3300025928 Bacteria 500797
71 Ga0207700_10121420 3300025928 Bacteria 2119
72 Ga0207664_10065011 3300025929 Bacteria 2919
73 Ga0207664_10311952 3300025929 Bacteria 1386
74 Ga0207644_10766779 3300025931 Bacteria 806
75 Ga0207686_10000119 3300025934 Bacteria 64297
76 Ga0207711_10000011 3300025941 Bacteria 518817
77 Ga0207661_10000438 3300025944 Bacteria 26840
78 Ga0207679_10070203 3300025945 Bacteria 2639
79 Ga0207712_10000994 3300025961 Bacteria 20219
80 Ga0207668_10445007 3300025972 Bacteria 1104
81 Ga0207640_10000954 3300025981 Bacteria 16092
82 Ga0207658_10000465 3300025986 Bacteria 37863
83 Ga0207658_10054707 3300025986 Bacteria 2954
84 Ga0207677_10000639 3300026023 Bacteria 21111
85 Ga0207677_10025490 3300026023 Bacteria 3691
86 Ga0207703_10145901 3300026035 Bacteria 2058
87 Ga0207639_10093029 3300026041 Bacteria 2417
88 Ga0207639_10327006 3300026041 Unclassified 1363
89 Ga0207708_10107389 3300026075 Bacteria 2164
90 Ga0207641_10173657 3300026088 Bacteria 1969
91 Ga0207641_10228229 3300026088 Bacteria 1729
92 Ga0207675_100065530 3300026118 Bacteria 3395
93 Ga0207683_10031076 3300026121 Bacteria 4633
94 Ga0268266_10097379 3300028379 Bacteria 2587
95 Ga0268266_10130016 3300028379 Bacteria 2251
96 Ga0268265_10024694 3300028380 Bacteria 4256
97 Ga0268264_10047483 3300028381 Bacteria 3570
98 Ga0268264_10123972 3300028381 Bacteria 2281
99 Ga0265326_10168216 3300028558 Bacteria 627
100 Ga0265319_1000010 3300028563 Bacteria 188773
101 Ga0265338_10000051 3300028800 Bacteria 211202
102 Ga0307413_10449284 3300031824 Unclassified 1023
103 Ga0307409_101219315 3300031995 Unclassified 776
104 Ga0451807_0711285 3300041486 Bacteria 1462
105 Ga0451853_1712997 3300041512 Bacteria 1522
106 Ga0466957_0036064 3300044842 Bacteria 2971
107 Ga0466957_0065993 3300044842 Bacteria 2230
108 Ga0466960_0904364 3300044901 Unclassified 539
109 Ga0466958_0328051 3300045836 Bacteria 984
110 Ga0466967_0000012 3300045976 Bacteria 104270
111 Ga0495592_0104197 3300046454 Bacteria 2017
112 Ga0495603_0000194 3300046455 Bacteria 31819
113 Ga0495629_0008973 3300046459 Bacteria 7340
114 Ga0495638_0183964 3300046460 Bacteria 1190
115 Ga0495641_0066090 3300046461 Unclassified 1627
116 Ga0495653_0726321 3300046463 Bacteria 601
117 Ga0495662_0000909 3300046476 Bacteria 14466
118 Ga0495606_0000895 3300046507 Bacteria 44393
119 Ga0495608_0000013 3300046511 Bacteria 228481
120 Ga0495628_0004525 3300046516 Bacteria 12316
121 Ga0495628_0147224 3300046516 Bacteria 1795
122 Ga0495630_0485750 3300046517 Bacteria 947
123 Ga0495652_0000018 3300046529 Bacteria 201634
124 Ga0495640_0031827 3300046533 Bacteria 3763
125 Ga0495587_0010082 3300046536 Bacteria 6029
126 Ga0495625_0097058 3300046660 Bacteria 2029
127 Ga0495657_0000003 3300046675 Bacteria 279680
128 Ga0495657_0146342 3300046675 Bacteria 1469
129 Ga0495647_0000307 3300046681 Bacteria 13755
130 Ga0495658_0001961 3300046683 Bacteria 10521
131 Ga0495660_0073761 3300046810 Bacteria 1804
132 Ga0495674_0000039 3300047319 Bacteria 97645
133 Ga0495676_0005595 3300047321 Bacteria 11530
134 Ga0495676_0045466 3300047321 Bacteria 3573
135 Ga0495675_0000094 3300047444 Bacteria 63338
136 Ga0495593_0009500 3300047673 Bacteria 5643
137 Ga0495602_0007613 3300048088 Bacteria 11325
138 Ga0496100_0000001 3300048903 Bacteria 530179
139 Ga0496101_0000028 3300048904 Bacteria 198664
140 Ga0496102_0000129 3300048905 Bacteria 104478
141 Ga0496103_0000087 3300048906 Bacteria 104566
142 Ga0496104_0000010 3300048907 Bacteria 475255
143 Ga0496105_0000005 3300048908 Bacteria 475797
144 Ga0496106_0003626 3300048909 Bacteria 11519
145 Ga0496107_0002003 3300048910 Bacteria 12994
146 Ga0496108_0000005 3300048911 Bacteria 535059
147 Ga0496109_0000002 3300048912 Bacteria 443393
148 Ga0496109_0909394 3300048912 Bacteria 818
149 Ga0496110_0000185 3300048913 Bacteria 39094
150 Ga0496110_0774211 3300048913 Bacteria 863
151 Ga0496111_0000103 3300048914 Bacteria 36804
152 Ga0496112_0000718 3300048915 Bacteria 22995
153 Ga0496112_0498897 3300048915 Bacteria 1153
154 Ga0496113_0000017 3300048916 Bacteria 74327
155 Ga0496114_0000003 3300048917 Bacteria 630981
156 Ga0496114_0246657 3300048917 Bacteria 1571
157 Ga0496114_0312064 3300048917 Bacteria 1389
158 Ga0496115_0000027 3300048918 Bacteria 145505
159 Ga0496118_0217093 3300048921 Bacteria 1117
160 Ga0496119_0014545 3300048922 Bacteria 6143
161 Ga0496120_0209727 3300048923 Bacteria 937
162 Ga0501039_1126278 3300049575 Bacteria 608
163 Ga0501040_0608329 3300049576 Bacteria 790
164 Ga0501042_0044603 3300049578 Bacteria 3160
165 Ga0501042_0521451 3300049578 Bacteria 863
166 Ga0501069_0920866 3300049585 Bacteria 532
167 Ga0501069_1011332 3300049585 Bacteria 508
168 Ga0501074_0120443 3300049590 Bacteria 1877
169 Ga0501076_0397441 3300049592 Bacteria 1133
170 Ga0501081_0684317 3300049743 Bacteria 770
171 nmdc:mga0yw44_418895_c1 3300050492 Bacteria 906
172 nmdc:mga0qj67_38680_c1 3300050509 Bacteria 3743
173 nmdc:mga0a205_57264_c1 3300050515 Bacteria 3764
174 Ga0495601_0012101 3300053077 Bacteria 5172
175 Ga0495612_0010530 3300053078 Bacteria 3738
176 Ga0495655_0000010 3300053083 Bacteria 125615
177 Ga0495655_0001176 3300053083 Bacteria 4048
178 Ga0495595_0000007 3300053084 Bacteria 228504
179 Ga0495619_0000067 3300053085 Bacteria 83418
180 Ga0495619_0000851 3300053085 Bacteria 20034
181 Ga0500628_000024 3300053129 Bacteria 64538
182 Ga0530510_0926850 3300061734 Bacteria 666

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049585 Ga0501069_0920866 Ga0501069_0920866_110_511 132
2 3300005355 Ga0070671_100624490 Ga0070671_1006244902 138
3 3300005843 Ga0068860_101418307 Ga0068860_1014183071 138
4 3300014968 Ga0157379_10489235 Ga0157379_104892352 138
5 3300025931 Ga0207644_10766779 Ga0207644_107667792 138
6 3300026035 Ga0207703_10145901 Ga0207703_101459013 138
7 3300046675 Ga0495657_0146342 Ga0495657_0146342_600_1046 138
8 3300005437 Ga0070710_10392548 Ga0070710_103925482 141
9 3300005435 Ga0070714_100208866 Ga0070714_1002088662 142
10 3300025929 Ga0207664_10311952 Ga0207664_103119522 142
11 3300046463 Ga0495653_0726321 Ga0495653_0726321_54_554 142
12 3300005614 Ga0068856_100617890 Ga0068856_1006178902 143
13 3300005718 Ga0068866_10012512 Ga0068866_100125122 143
14 3300009174 Ga0105241_11542531 Ga0105241_115425311 143
15 3300025899 Ga0207642_10095014 Ga0207642_100950142 143
16 3300028558 Ga0265326_10168216 Ga0265326_101682161 143
17 3300028563 Ga0265319_1000010 Ga0265319_1000010137 143
18 3300028800 Ga0265338_10000051 Ga0265338_1000005130 143
19 3300005347 Ga0070668_100264304 Ga0070668_1002643042 146
20 3300041512 Ga0451853_1712997 Ga0451853_1712997_618_1154 146
21 3300048088 Ga0495602_0007613 Ga0495602_0007613_5589_6134 147
22 3300031824 Ga0307413_10449284 Ga0307413_104492842 148
23 3300031995 Ga0307409_101219315 Ga0307409_1012193152 148
24 3300044901 Ga0466960_0904364 Ga0466960_0904364_14_463 148
25 3300046536 Ga0495587_0010082 Ga0495587_0010082_1840_2358 148
26 3300049578 Ga0501042_0521451 Ga0501042_0521451_370_822 148
27 3300049585 Ga0501069_1011332 Ga0501069_1011332_22_474 148
28 3300049590 Ga0501074_0120443 Ga0501074_0120443_1281_1733 148
29 3300049592 Ga0501076_0397441 Ga0501076_0397441_486_938 148
30 3300049743 Ga0501081_0684317 Ga0501081_0684317_156_608 148
31 3300046516 Ga0495628_0004525 Ga0495628_0004525_5447_5992 149
32 3300047321 Ga0495676_0005595 Ga0495676_0005595_10611_11093 149
33 3300050492 nmdc:mga0yw44_418895_c1 nmdc:mga0yw44_418895_c1_402_881 149
34 3300053077 Ga0495601_0012101 Ga0495601_0012101_4255_4734 149
35 3300053083 Ga0495655_0001176 Ga0495655_0001176_1426_1932 149
36 3300048903 Ga0496100_0000001 Ga0496100_0000001_2301_2783 150
37 3300048904 Ga0496101_0000028 Ga0496101_0000028_2290_2772 150
38 3300048909 Ga0496106_0003626 Ga0496106_0003626_8740_9222 150
39 3300048910 Ga0496107_0002003 Ga0496107_0002003_8747_9229 150
40 3300005347 Ga0070668_100011266 Ga0070668_1000112668 151
41 3300005367 Ga0070667_100009466 Ga0070667_1000094662 151
42 3300005548 Ga0070665_100069127 Ga0070665_1000691273 151
43 3300005844 Ga0068862_100000366 Ga0068862_10000036621 151
44 3300009553 Ga0105249_10000916 Ga0105249_1000091615 151
45 3300013306 Ga0163162_10389237 Ga0163162_103892372 151
46 3300014968 Ga0157379_10038557 Ga0157379_100385574 151
47 3300025961 Ga0207712_10000994 Ga0207712_1000099413 151
48 3300025972 Ga0207668_10445007 Ga0207668_104450072 151
49 3300025986 Ga0207658_10000465 Ga0207658_1000046539 151
50 3300028379 Ga0268266_10097379 Ga0268266_100973793 151
51 3300028380 Ga0268265_10024694 Ga0268265_100246941 151
52 3300028381 Ga0268264_10047483 Ga0268264_100474833 151
53 3300046460 Ga0495638_0183964 Ga0495638_0183964_66_602 151
54 3300048921 Ga0496118_0217093 Ga0496118_0217093_100_654 151
55 3300005329 Ga0070683_100137180 Ga0070683_1001371802 152
56 3300005329 Ga0070683_100298500 Ga0070683_1002985003 152
57 3300005535 Ga0070684_100326731 Ga0070684_1003267312 152
58 3300005843 Ga0068860_101095592 Ga0068860_1010955921 152
59 3300005983 Ga0081540_1000994 Ga0081540_10009946 152
60 3300025921 Ga0207652_10394469 Ga0207652_103944692 152
61 3300028381 Ga0268264_10123972 Ga0268264_101239722 152
62 3300044842 Ga0466957_0036064 Ga0466957_0036064_88_627 152
63 3300048915 Ga0496112_0498897 Ga0496112_0498897_280_780 152
64 3300050509 nmdc:mga0qj67_38680_c1 nmdc:mga0qj67_38680_c1_2933_3466 152
65 3300006852 Ga0075433_10011222 Ga0075433_1001122210 153
66 3300025919 Ga0207657_10356782 Ga0207657_103567822 153
67 3300050515 nmdc:mga0a205_57264_c1 nmdc:mga0a205_57264_c1_1763_2245 153
68 3300005338 Ga0068868_100000104 Ga0068868_10000010417 154
69 3300026023 Ga0207677_10000639 Ga0207677_1000063910 154
70 3300041486 Ga0451807_0711285 Ga0451807_0711285_228_764 154
71 3300026088 Ga0207641_10228229 Ga0207641_102282292 155
72 3300061734 Ga0530510_0926850 Ga0530510_0926850_148_642 155
73 3300005535 Ga0070684_100479917 Ga0070684_1004799171 156
74 3300005564 Ga0070664_100151737 Ga0070664_1001517372 156
75 3300025928 Ga0207700_10000003 Ga0207700_1000000392 156
76 3300025945 Ga0207679_10070203 Ga0207679_100702034 156
77 3300045836 Ga0466958_0328051 Ga0466958_0328051_307_813 156
78 3300005337 Ga0070682_100089832 Ga0070682_1000898322 157
79 3300005340 Ga0070689_100096126 Ga0070689_1000961262 157
80 3300005345 Ga0070692_10591253 Ga0070692_105912531 157
81 3300005564 Ga0070664_100133513 Ga0070664_1001335134 157
82 3300005719 Ga0068861_100245303 Ga0068861_1002453032 157
83 3300009101 Ga0105247_10000148 Ga0105247_1000014843 157
84 3300025900 Ga0207710_10000336 Ga0207710_1000033615 157
85 3300025927 Ga0207687_10003279 Ga0207687_100032794 157
86 3300026075 Ga0207708_10107389 Ga0207708_101073894 157
87 3300026118 Ga0207675_100065530 Ga0207675_1000655303 157
88 3300046507 Ga0495606_0000895 Ga0495606_0000895_12885_13406 157
89 3300046511 Ga0495608_0000013 Ga0495608_0000013_183114_183623 157
90 3300046675 Ga0495657_0000003 Ga0495657_0000003_234313_234822 157
91 3300047444 Ga0495675_0000094 Ga0495675_0000094_44859_45368 157
92 3300048907 Ga0496104_0000010 Ga0496104_0000010_310210_310704 157
93 3300048908 Ga0496105_0000005 Ga0496105_0000005_310210_310704 157
94 3300048912 Ga0496109_0909394 Ga0496109_0909394_11_547 157
95 3300048913 Ga0496110_0774211 Ga0496110_0774211_137_658 157
96 3300048922 Ga0496119_0014545 Ga0496119_0014545_766_1260 157
97 3300048923 Ga0496120_0209727 Ga0496120_0209727_248_742 157
98 3300049575 Ga0501039_1126278 Ga0501039_1126278_62_550 157
99 3300049576 Ga0501040_0608329 Ga0501040_0608329_259_747 157
100 3300053084 Ga0495595_0000007 Ga0495595_0000007_183137_183646 157
101 3300053085 Ga0495619_0000851 Ga0495619_0000851_8849_9358 157
102 3300005435 Ga0070714_100039823 Ga0070714_1000398238 158
103 3300025929 Ga0207664_10065011 Ga0207664_100650111 158
104 3300046455 Ga0495603_0000194 Ga0495603_0000194_21_503 158
105 3300048917 Ga0496114_0312064 Ga0496114_0312064_217_738 158
106 3300053078 Ga0495612_0010530 Ga0495612_0010530_2634_3155 158
107 3300005337 Ga0070682_101233037 Ga0070682_1012330371 159
108 3300005539 Ga0068853_100393578 Ga0068853_1003935782 159
109 3300005834 Ga0068851_10000372 Ga0068851_1000037217 159
110 3300025321 Ga0207656_10000244 Ga0207656_1000024410 159
111 3300026041 Ga0207639_10327006 Ga0207639_103270062 159
112 3300046660 Ga0495625_0097058 Ga0495625_0097058_642_1190 159
113 3300005338 Ga0068868_100000220 Ga0068868_10000022035 160
114 3300009093 Ga0105240_10646731 Ga0105240_106467311 160
115 3300014326 Ga0157380_10000186 Ga0157380_1000018621 160
116 3300020070 Ga0206356_11230926 Ga0206356_112309262 160
117 3300026023 Ga0207677_10025490 Ga0207677_100254903 160
118 3300046454 Ga0495592_0104197 Ga0495592_0104197_409_921 160
119 3300048917 Ga0496114_0000003 Ga0496114_0000003_410831_411334 160
120 3300048918 Ga0496115_0000027 Ga0496115_0000027_137118_137621 160
121 3300005841 Ga0068863_100017589 Ga0068863_1000175892 161
122 3300026088 Ga0207641_10173657 Ga0207641_101736572 161
123 3300046461 Ga0495641_0066090 Ga0495641_0066090_366_890 161
124 3300046516 Ga0495628_0147224 Ga0495628_0147224_652_1158 161
125 3300005365 Ga0070688_100000053 Ga0070688_10000005311 162
126 3300005466 Ga0070685_10000086 Ga0070685_1000008649 162
127 3300005578 Ga0068854_100004036 Ga0068854_1000040366 162
128 3300005937 Ga0081455_10009396 Ga0081455_1000939611 162
129 3300025981 Ga0207640_10000954 Ga0207640_1000095417 162
130 3300045976 Ga0466967_0000012 Ga0466967_0000012_69253_69759 162
131 3300047321 Ga0495676_0045466 Ga0495676_0045466_595_1101 162
132 3300048911 Ga0496108_0000005 Ga0496108_0000005_519939_520463 162
133 3300048912 Ga0496109_0000002 Ga0496109_0000002_14629_15153 162
134 3300025928 Ga0207700_10121420 Ga0207700_101214204 163
135 3300046476 Ga0495662_0000909 Ga0495662_0000909_1818_2330 163
136 3300046529 Ga0495652_0000018 Ga0495652_0000018_169885_170397 163
137 3300005337 Ga0070682_100000061 Ga0070682_10000006155 164
138 3300006358 Ga0068871_100346961 Ga0068871_1003469612 164
139 3300046459 Ga0495629_0008973 Ga0495629_0008973_5262_5774 164
140 3300046517 Ga0495630_0485750 Ga0495630_0485750_136_648 164
141 3300046533 Ga0495640_0031827 Ga0495640_0031827_2447_2959 164
142 3300047319 Ga0495674_0000039 Ga0495674_0000039_4807_5319 164
143 3300005367 Ga0070667_100121518 Ga0070667_1001215182 165
144 3300005456 Ga0070678_100022708 Ga0070678_1000227083 165
145 3300013307 Ga0157372_10000284 Ga0157372_1000028449 165
146 3300013308 Ga0157375_10039309 Ga0157375_100393093 165
147 3300025934 Ga0207686_10000119 Ga0207686_1000011921 165
148 3300025986 Ga0207658_10054707 Ga0207658_100547072 165
149 3300026121 Ga0207683_10031076 Ga0207683_100310764 165
150 3300048905 Ga0496102_0000129 Ga0496102_0000129_40992_41510 165
151 3300048906 Ga0496103_0000087 Ga0496103_0000087_40990_41508 165
152 3300048913 Ga0496110_0000185 Ga0496110_0000185_27584_28114 165
153 3300048914 Ga0496111_0000103 Ga0496111_0000103_36239_36769 165
154 3300048915 Ga0496112_0000718 Ga0496112_0000718_14441_14971 165
155 3300048916 Ga0496113_0000017 Ga0496113_0000017_48400_48930 165
156 3300053083 Ga0495655_0000010 Ga0495655_0000010_61562_62080 165
157 3300053085 Ga0495619_0000067 Ga0495619_0000067_20170_20700 165
158 3300053129 Ga0500628_000024 Ga0500628_000024_47325_47843 165
159 3300005354 Ga0070675_100000091 Ga0070675_1000000917 166
160 3300005548 Ga0070665_100194910 Ga0070665_1001949103 166
161 3300013296 Ga0157374_10249640 Ga0157374_102496403 166
162 3300013297 Ga0157378_11546358 Ga0157378_115463581 166
163 3300025926 Ga0207659_10000707 Ga0207659_1000070710 166
164 3300028379 Ga0268266_10130016 Ga0268266_101300162 166
165 3300047673 Ga0495593_0009500 Ga0495593_0009500_3453_3971 166
166 3300049578 Ga0501042_0044603 Ga0501042_0044603_1674_2186 166
167 3300005327 Ga0070658_10133728 Ga0070658_101337282 167
168 3300005329 Ga0070683_100000527 Ga0070683_1000005277 167
169 3300005535 Ga0070684_100023132 Ga0070684_1000231323 167
170 3300005539 Ga0068853_100478424 Ga0068853_1004784241 167
171 3300006881 Ga0068865_100000081 Ga0068865_10000008144 167
172 3300009177 Ga0105248_10000017 Ga0105248_10000017238 167
173 3300013102 Ga0157371_10002739 Ga0157371_1000273913 167
174 3300013104 Ga0157370_10012635 Ga0157370_100126352 167
175 3300025941 Ga0207711_10000011 Ga0207711_10000011285 167
176 3300025944 Ga0207661_10000438 Ga0207661_100004386 167
177 3300026041 Ga0207639_10093029 Ga0207639_100930292 167
178 3300044842 Ga0466957_0065993 Ga0466957_0065993_81_602 167
179 3300046681 Ga0495647_0000307 Ga0495647_0000307_1427_1948 167
180 3300046683 Ga0495658_0001961 Ga0495658_0001961_5973_6494 167
181 3300046810 Ga0495660_0073761 Ga0495660_0073761_373_894 167
182 3300048917 Ga0496114_0246657 Ga0496114_0246657_97_618 167

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04186

FxsA

FxsA cytoplasmic membrane protein

7

115

0.98

Feature Viewer

pLDDT pTM Quality
59.82 0.33 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map