F278756

General Info

Members Datasets Scaffolds Average Seq Length
182 123 364 254

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100278033|Ga0070698_1002780332
Length 275
Sequence VVSTSSTTDHSPTAEATRAEVCAAAIADAFKDDGEIFASPMGVLPMLGVRLAKLTSNPDLVISDGESLFLAGVPPLFARSDVVEGWIPFRKVFDVVAYGKRHVMMGATQVDRHGNQNISAIGDFARPARQLLGSRGAPGNTVNNRTSYWVPKHSPRVFVEQVDVVCGVGPKRAKAAGPAAARYNDIHRIVSNLGVFDVLGADDTVRLLSVHPGVTVEEVQEATGFELAIPGDVPTTREPSYGELVLIRELLDPRGLRDREVPPALKAGAAERART

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
5 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
6 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
7 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
8 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
9 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
10 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
11 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
13 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
14 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
15 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
16 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
17 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
18 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
20 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
21 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
22 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
23 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
24 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
38 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
40 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
41 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
42 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
43 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
44 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
45 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
46 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
47 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
48 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
49 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
50 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
51 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
52 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
53 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
54 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
55 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
56 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
57 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
58 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
59 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
60 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
61 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
62 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
63 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
64 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
65 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
66 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
67 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
68 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
69 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
70 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
71 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
72 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
73 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
74 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
75 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
76 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
84 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
85 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
86 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
87 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
88 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
89 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
90 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
92 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
93 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
94 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
95 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
96 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
97 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
98 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
99 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
100 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
101 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
102 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
103 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
104 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
105 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
106 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
107 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
108 2643221561 Nocardioides sp. Root151 Isolate Unclassified
109 2643221576 Nocardioides sp. Root614 Isolate Unclassified
110 2643221590 Nocardioides sp. Root682 Isolate Unclassified
111 2643221604 Nocardioides sp. Root190 Isolate Unclassified
112 2643221615 Nocardioides sp. Root224 Isolate Unclassified
113 2643221617 Nocardioides sp. Root79 Isolate Unclassified
114 2643221620 Nocardioides sp. Root240 Isolate Unclassified
115 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
116 2643221696 Nocardioides sp. Root140 Isolate Unclassified
117 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
118 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
119 2738541305 Nocardioides sp. CF167 Isolate Unclassified
120 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
121 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
122 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
123 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.21
Metatranscriptomes 0
Isolates 8.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 31.87
Nodule 0
Rhizoplane 4.95
Rhizosphere 50
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100278033 3300005471 Bacteria 1606
2 Ga0070658_10306936 3300005327 Bacteria 1354
3 Ga0070660_100022662 3300005339 Bacteria 4648
4 Ga0070660_100110436 3300005339 Bacteria 2187
5 Ga0070667_100006659 3300005367 Bacteria 9603
6 Ga0070708_100551693 3300005445 Bacteria 1087
7 Ga0068855_100480131 3300005563 Bacteria 1353
8 Ga0070664_100027714 3300005564 Bacteria 4709
9 Ga0068856_100453594 3300005614 Bacteria 1303
10 Ga0068852_100332353 3300005616 Bacteria 1479
11 Ga0068860_100000410 3300005843 Bacteria 55852
12 Ga0081455_10000174 3300005937 Bacteria 80174
13 Ga0075365_10003105 3300006038 Bacteria 8448
14 Ga0075365_10006560 3300006038 Bacteria 6416
15 Ga0075365_10041825 3300006038 Bacteria 2995
16 Ga0075365_10081050 3300006038 Bacteria 2198
17 Ga0075365_10148612 3300006038 Bacteria 1629
18 Ga0075368_10000466 3300006042 Bacteria 12003
19 Ga0075368_10037727 3300006042 Bacteria 1890
20 Ga0075368_10063792 3300006042 Bacteria 1478
21 Ga0075363_100039002 3300006048 Bacteria 2499
22 Ga0075363_100043968 3300006048 Bacteria 2364
23 Ga0075363_100051952 3300006048 Bacteria 2187
24 Ga0075364_10038313 3300006051 Bacteria 3106
25 Ga0075364_10046169 3300006051 Bacteria 2836
26 Ga0075364_10052386 3300006051 Bacteria 2666
27 Ga0075364_10115589 3300006051 Bacteria 1793
28 Ga0075364_10143940 3300006051 Bacteria 1604
29 Ga0075364_10236545 3300006051 Bacteria 1240
30 Ga0075364_10249422 3300006051 Bacteria 1206
31 Ga0075367_10049443 3300006178 Bacteria 2478
32 Ga0075367_10113996 3300006178 Bacteria 1661
33 Ga0075367_10159875 3300006178 Bacteria 1401
34 Ga0075367_10334695 3300006178 Bacteria 955
35 Ga0075370_10007144 3300006353 Bacteria 5670
36 Ga0075370_10143635 3300006353 Bacteria 1396
37 Ga0111539_10841898 3300009094 Bacteria 1067
38 Ga0105238_10888804 3300009551 Bacteria 909
39 Ga0105246_10674737 3300011119 Bacteria 903
40 Ga0157375_11311643 3300013308 Bacteria 851
41 Ga0163163_10670675 3300014325 Bacteria 1100
42 Ga0163163_10729298 3300014325 Bacteria 1054
43 Ga0163163_10761657 3300014325 Bacteria 1031
44 Ga0213875_10066600 3300021388 Bacteria 1683
45 Ga0207647_10006673 3300025904 Bacteria 8387
46 Ga0207657_10102967 3300025919 Bacteria 2367
47 Ga0207649_10179742 3300025920 Bacteria 1480
48 Ga0207706_10067649 3300025933 Bacteria 3143
49 Ga0207661_10295908 3300025944 Bacteria 1450
50 Ga0207679_10018854 3300025945 Bacteria 4629
51 Ga0207667_10530889 3300025949 Bacteria 1191
52 Ga0207658_10015315 3300025986 Bacteria 5261
53 Ga0207678_10561145 3300026067 Bacteria 999
54 Ga0207708_10062996 3300026075 Bacteria 2833
55 Ga0207702_10404020 3300026078 Bacteria 1318
56 Ga0207675_100062176 3300026118 Bacteria 3486
57 Ga0207698_10421688 3300026142 Bacteria 1280
58 Ga0209813_10001283 3300027866 Bacteria 5609
59 Ga0209813_10035351 3300027866 Bacteria 1496
60 Ga0268264_10000155 3300028381 Bacteria 156029
61 Ga0307409_100050488 3300031995 Bacteria 3177
62 Ga0307416_100343860 3300032002 Bacteria 1506
63 Ga0307415_100299684 3300032126 Bacteria 1331
64 Ga0395899_0488585 3300037312 Bacteria 800
65 Ga0395900_0029203 3300037418 Bacteria 5656
66 Ga0395900_0176176 3300037418 Bacteria 2175
67 Ga0395898_0047254 3300037466 Bacteria 4225
68 Ga0395898_0191950 3300037466 Bacteria 1952
69 Ga0436364_0725327 3300037853 Bacteria 2980
70 Ga0439436_0034733 3300041404 Bacteria 1458
71 Ga0439447_042927 3300041407 Bacteria 1097
72 Ga0439465_0017440 3300041413 Bacteria 2241
73 Ga0451793_0157297 3300041452 Bacteria 1434
74 Ga0451833_1103885 3300041491 Bacteria 3115
75 Ga0451841_0300581 3300041498 Bacteria 1901
76 Ga0451843_0460183 3300041509 Bacteria 761
77 Ga0451853_2839261 3300041512 Bacteria 4733
78 Ga0439442_006173 3300042002 Bacteria 2402
79 Ga0439445_0006483 3300042004 Bacteria 2691
80 Ga0439446_0026732 3300042156 Bacteria 1654
81 Ga0439458_0025025 3300042157 Bacteria 1398
82 Ga0466972_0052615 3300044658 Bacteria 1962
83 Ga0466965_0005657 3300044683 Bacteria 5639
84 Ga0466965_0009164 3300044683 Bacteria 4597
85 Ga0466965_0025306 3300044683 Bacteria 2873
86 Ga0466961_0021350 3300044693 Bacteria 4168
87 Ga0466963_0010013 3300044694 Bacteria 5731
88 Ga0466963_0117751 3300044694 Bacteria 1826
89 Ga0466971_0024362 3300044719 Bacteria 2700
90 Ga0466968_0033821 3300044735 Bacteria 2131
91 Ga0466970_0016787 3300044765 Bacteria 3778
92 Ga0466970_0026935 3300044765 Bacteria 3014
93 Ga0466970_0043611 3300044765 Bacteria 2387
94 Ga0466960_0019461 3300044901 Bacteria 2992
95 Ga0466960_0102264 3300044901 Bacteria 1477
96 Ga0495620_0047587 3300046515 Bacteria 1845
97 Ga0495668_0275318 3300046616 Bacteria 922
98 Ga0496104_0229455 3300048907 Bacteria 1769
99 Ga0496105_0412974 3300048908 Bacteria 1070
100 Ga0496108_0089177 3300048911 Bacteria 2621
101 Ga0496108_0103144 3300048911 Bacteria 2434
102 Ga0496109_0398204 3300048912 Bacteria 1301
103 Ga0496110_0112891 3300048913 Bacteria 2443
104 Ga0496114_0018844 3300048917 Bacteria 5588
105 Ga0496114_0060893 3300048917 Bacteria 3156
106 Ga0496124_0034035 3300048927 Bacteria 4477
107 Ga0496126_0000040 3300048929 Bacteria 345144
108 Ga0501031_0031644 3300049568 Bacteria 3451
109 Ga0501031_0177877 3300049568 Bacteria 1390
110 Ga0501031_0343174 3300049568 Bacteria 967
111 Ga0501036_0661025 3300049572 Bacteria 865
112 Ga0501039_0192842 3300049575 Bacteria 1602
113 Ga0501040_0404169 3300049576 Bacteria 981
114 Ga0501040_0476563 3300049576 Bacteria 899
115 Ga0501042_0039778 3300049578 Bacteria 3343
116 Ga0501042_0242999 3300049578 Bacteria 1299
117 Ga0501046_0406378 3300049580 Bacteria 983
118 Ga0501048_0267263 3300049582 Bacteria 1215
119 Ga0501067_0043556 3300049583 Bacteria 2493
120 Ga0501067_0141842 3300049583 Bacteria 1338
121 Ga0501069_0068774 3300049585 Bacteria 1982
122 Ga0501069_0251859 3300049585 Bacteria 1030
123 Ga0501070_0488886 3300049586 Bacteria 989
124 Ga0501074_0153686 3300049590 Bacteria 1645
125 Ga0501076_0041540 3300049592 Bacteria 3619
126 Ga0501079_0147531 3300049741 Bacteria 1834
127 Ga0501080_0293242 3300049742 Bacteria 1477
128 Ga0501080_0345762 3300049742 Bacteria 1344
129 Ga0501035_0161241 3300049822 Bacteria 1941
130 Ga0501045_0132242 3300049824 Bacteria 1855
131 nmdc:mga03683_181629_c1 3300050489 Bacteria 960
132 nmdc:mga03n38_107094_c1 3300050490 Bacteria 1356
133 nmdc:mga03n38_24667_c1 3300050490 Bacteria 2461
134 nmdc:mga03n38_95496_c1 3300050490 Bacteria 1424
135 nmdc:mga00v17_104253_c1 3300050491 Bacteria 1793
136 nmdc:mga00v17_32942_c1 3300050491 Bacteria 3066
137 nmdc:mga00v17_356508_c1 3300050491 Bacteria 951
138 nmdc:mga00v17_45871_c1 3300050491 Bacteria 2642
139 nmdc:mga00v17_6799_c1 3300050491 Bacteria 6078
140 nmdc:mga0yw44_104936_c1 3300050492 Bacteria 1805
141 nmdc:mga0yw44_13821_c1 3300050492 Bacteria 4265
142 nmdc:mga0yw44_16923_c1 3300050492 Bacteria 3952
143 nmdc:mga0yw44_178465_c1 3300050492 Bacteria 1397
144 nmdc:mga0yw44_23061_c1 3300050492 Bacteria 3502
145 nmdc:mga0yw44_40863_c1 3300050492 Bacteria 2758
146 nmdc:mga0yw44_42714_c1 3300050492 Bacteria 2704
147 nmdc:mga0yw44_52079_c1 3300050492 Bacteria 2481
148 nmdc:mga0yw44_61479_c1 3300050492 Bacteria 2305
149 nmdc:mga06z11_22855_c1 3300050494 Bacteria 2928
150 nmdc:mga04h51_35940_c1 3300050495 Bacteria 1591
151 nmdc:mga04h51_39394_c1 3300050495 Bacteria 1535
152 nmdc:mga04h51_428_c1 3300050495 Bacteria 10124
153 nmdc:mga07m45_175616_c1 3300050496 Bacteria 1245
154 nmdc:mga07m45_365628_c1 3300050496 Bacteria 838
155 nmdc:mga07m45_4884_c1 3300050496 Bacteria 6604
156 nmdc:mga07m45_50513_c1 3300050496 Bacteria 2343
157 Ga0500644_0000067 3300053088 Bacteria 61703
158 Ga0500641_0002171 3300053096 Bacteria 6951
159 Ga0500554_022464 3300053102 Bacteria 1763
160 Ga0500556_0001941 3300053104 Bacteria 7316
161 Ga0500593_000238 3300053117 Bacteria 22609
162 Ga0500573_0040051 3300053140 Bacteria 2706
163 Ga0501084_0197270 3300054114 Bacteria 1698
164 Ga0501082_0044586 3300060353 Bacteria 3825
165 Ga0501082_0250081 3300060353 Bacteria 1543
166 Ga0466962_0099892 3300061719 Bacteria 1393
167 2643825963 2643221561 Bacteria 4984412
168 2643891733 2643221576 Bacteria 5214352
169 2643960781 2643221590 Bacteria 5214697
170 2644035710 2643221604 Bacteria 5014917
171 2644089240 2643221615 Bacteria 5487866
172 2644101577 2643221617 Bacteria 5139111
173 2644115640 2643221620 Bacteria 5134593
174 2644319085 2643221657 Bacteria 5490246
175 2644531954 2643221696 Bacteria 5431823
176 2645721778 2643221961 Bacteria 3919167
177 2645724275 2643221962 Bacteria 3874254
178 2738868192 2738541305 Bacteria 4910150
179 2812333079 2811994874 Bacteria 5367947
180 2842889806 2842888712 Bacteria 4279094
181 2855387043 2855386786 Bacteria 4752232
182 2866618452 2866612099 Bacteria 7543886
183 Ga0070698_100278033
184 Ga0070658_10306936
185 Ga0070660_100022662
186 Ga0070660_100110436
187 Ga0070667_100006659
188 Ga0070708_100551693
189 Ga0068855_100480131
190 Ga0070664_100027714
191 Ga0068856_100453594
192 Ga0068852_100332353
193 Ga0068860_100000410
194 Ga0081455_10000174
195 Ga0075365_10003105
196 Ga0075365_10006560
197 Ga0075365_10041825
198 Ga0075365_10081050
199 Ga0075365_10148612
200 Ga0075368_10000466
201 Ga0075368_10037727
202 Ga0075368_10063792
203 Ga0075363_100039002
204 Ga0075363_100043968
205 Ga0075363_100051952
206 Ga0075364_10038313
207 Ga0075364_10046169
208 Ga0075364_10052386
209 Ga0075364_10115589
210 Ga0075364_10143940
211 Ga0075364_10236545
212 Ga0075364_10249422
213 Ga0075367_10049443
214 Ga0075367_10113996
215 Ga0075367_10159875
216 Ga0075367_10334695
217 Ga0075370_10007144
218 Ga0075370_10143635
219 Ga0111539_10841898
220 Ga0105238_10888804
221 Ga0105246_10674737
222 Ga0157375_11311643
223 Ga0163163_10670675
224 Ga0163163_10729298
225 Ga0163163_10761657
226 Ga0213875_10066600
227 Ga0207647_10006673
228 Ga0207657_10102967
229 Ga0207649_10179742
230 Ga0207706_10067649
231 Ga0207661_10295908
232 Ga0207679_10018854
233 Ga0207667_10530889
234 Ga0207658_10015315
235 Ga0207678_10561145
236 Ga0207708_10062996
237 Ga0207702_10404020
238 Ga0207675_100062176
239 Ga0207698_10421688
240 Ga0209813_10001283
241 Ga0209813_10035351
242 Ga0268264_10000155
243 Ga0307409_100050488
244 Ga0307416_100343860
245 Ga0307415_100299684
246 Ga0395899_0488585
247 Ga0395900_0029203
248 Ga0395900_0176176
249 Ga0395898_0047254
250 Ga0395898_0191950
251 Ga0436364_0725327
252 Ga0439436_0034733
253 Ga0439447_042927
254 Ga0439465_0017440
255 Ga0451793_0157297
256 Ga0451833_1103885
257 Ga0451841_0300581
258 Ga0451843_0460183
259 Ga0451853_2839261
260 Ga0439442_006173
261 Ga0439445_0006483
262 Ga0439446_0026732
263 Ga0439458_0025025
264 Ga0466972_0052615
265 Ga0466965_0005657
266 Ga0466965_0009164
267 Ga0466965_0025306
268 Ga0466961_0021350
269 Ga0466963_0010013
270 Ga0466963_0117751
271 Ga0466971_0024362
272 Ga0466968_0033821
273 Ga0466970_0016787
274 Ga0466970_0026935
275 Ga0466970_0043611
276 Ga0466960_0019461
277 Ga0466960_0102264
278 Ga0495620_0047587
279 Ga0495668_0275318
280 Ga0496104_0229455
281 Ga0496105_0412974
282 Ga0496108_0089177
283 Ga0496108_0103144
284 Ga0496109_0398204
285 Ga0496110_0112891
286 Ga0496114_0018844
287 Ga0496114_0060893
288 Ga0496124_0034035
289 Ga0496126_0000040
290 Ga0501031_0031644
291 Ga0501031_0177877
292 Ga0501031_0343174
293 Ga0501036_0661025
294 Ga0501039_0192842
295 Ga0501040_0404169
296 Ga0501040_0476563
297 Ga0501042_0039778
298 Ga0501042_0242999
299 Ga0501046_0406378
300 Ga0501048_0267263
301 Ga0501067_0043556
302 Ga0501067_0141842
303 Ga0501069_0068774
304 Ga0501069_0251859
305 Ga0501070_0488886
306 Ga0501074_0153686
307 Ga0501076_0041540
308 Ga0501079_0147531
309 Ga0501080_0293242
310 Ga0501080_0345762
311 Ga0501035_0161241
312 Ga0501045_0132242
313 nmdc:mga03683_181629_c1
314 nmdc:mga03n38_107094_c1
315 nmdc:mga03n38_24667_c1
316 nmdc:mga03n38_95496_c1
317 nmdc:mga00v17_104253_c1
318 nmdc:mga00v17_32942_c1
319 nmdc:mga00v17_356508_c1
320 nmdc:mga00v17_45871_c1
321 nmdc:mga00v17_6799_c1
322 nmdc:mga0yw44_104936_c1
323 nmdc:mga0yw44_13821_c1
324 nmdc:mga0yw44_16923_c1
325 nmdc:mga0yw44_178465_c1
326 nmdc:mga0yw44_23061_c1
327 nmdc:mga0yw44_40863_c1
328 nmdc:mga0yw44_42714_c1
329 nmdc:mga0yw44_52079_c1
330 nmdc:mga0yw44_61479_c1
331 nmdc:mga06z11_22855_c1
332 nmdc:mga04h51_35940_c1
333 nmdc:mga04h51_39394_c1
334 nmdc:mga04h51_428_c1
335 nmdc:mga07m45_175616_c1
336 nmdc:mga07m45_365628_c1
337 nmdc:mga07m45_4884_c1
338 nmdc:mga07m45_50513_c1
339 Ga0500644_0000067
340 Ga0500641_0002171
341 Ga0500554_022464
342 Ga0500556_0001941
343 Ga0500593_000238
344 Ga0500573_0040051
345 Ga0501084_0197270
346 Ga0501082_0044586
347 Ga0501082_0250081
348 Ga0466962_0099892
349 2643825963
350 2643891733
351 2643960781
352 2644035710
353 2644089240
354 2644101577
355 2644115640
356 2644319085
357 2644531954
358 2645721778
359 2645724275
360 2738868192
361 2812333079
362 2842889806
363 2855387043
364 2866618452

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6co6-assembly1.cif.gz_B crystal structure of rhodococcus jostii rha1 ipdab 0.9119 2 253
6co6-assembly1.cif.gz_B crystal structure of rhodococcus jostii rha1 ipdab 0.9084 2 253
6con-assembly2.cif.gz_H crystal structure of mycobacterium tuberculosis ipdab 0.8978 4 253
6con-assembly2.cif.gz_H crystal structure of mycobacterium tuberculosis ipdab 0.8944 4 253
5n02-assembly1.cif.gz_D crystal structure of the decarboxylase aiba/aibb c56s variant 0.8309 3 249
ID Description Score Start End Superfamily
af_P9WPV9_2_244_3.40.1080.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9013 4 246 3.40.1080.10
af_P9WPV9_2_244_3.40.1080.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8942 4 246 3.40.1080.10
1poiD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.7745 1 245 3.40.1080.10
1poiD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.7499 1 245 3.40.1080.10
2nrcB02 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.7018 4 219 3.40.1080.10
ID Description Score Start End GO Terms
AF-A0A356VED6-F1-model_v4 deleted 0.9579 178 252
AF-A0A7X6ARJ6-F1-model_v4 CoA-transferase 0.955 171 228 GO:0016740
AF-A0A1V5VT02-F1-model_v4 Uncharacterized protein 0.9435 195 244
AF-A0A0X7JPT1-F1-model_v4 deleted 0.9362 2 252
AF-A0A2V8HZQ9-F1-model_v4 CoA-transferase 0.9326 176 244 GO:0016740

Map