F278727

General Info

Members Datasets Scaffolds Average Seq Length
182 128 173 417

Family's Representative Sequence

Representative Sequence 3300005459|Ga0068867_100014061|Ga0068867_1000140614
Length 446
Sequence MKHLTQYAMVHPAAGGASCTIGKIFLTMVRVSRTMAKKYIVIILILFVSTVLSAQKARKAVFVIADGIPADVIERLDPPSMKAIAIEGGYARAYVGGEKSGYSQTPTISAVGYNSLLTGTWVNKHNVWDNDIVAPNYNYYNIFRYFKVQYPQKKTAIFSTWLDNRTKLIGSDVAAAGKIQPDFHFDGMELDTIAYPHDTAGYFYHLIDEAVTDTAASNIRRIAPDLSWIYLEYTDEMGHRHGNSPQLDDAVMKLDLQLLRIYNAIQFRQLKFNEDWVIFITTDHGREASGYGHGGQSSRERTTWILTNAKDLNEKFRNDMPAIVDIMPTLARFLDITIPKEQLMEIDGIPLTGKISASHPNARWSKNEIVLNWKPVNKEGKAKIWMATANQFKSGKKDQYKLVKEINVADGKAIIPVKQPGNFYKIVLEMPGNYLNRWVMRQPQIN

Samples

Sample ID Description Type Environment
1 2818991444 Filimonas endophytica 3197 Isolate Unclassified
2 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
3 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
4 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
5 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
6 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
7 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
8 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
9 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
10 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
97 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
98 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
99 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
102 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
107 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
108 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
109 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
110 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
111 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
112 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
113 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
114 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
124 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
127 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
128 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.05
Metatranscriptomes 0
Isolates 4.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.75
Nodule 0
Rhizoplane 1.65
Rhizosphere 90.11
Stem 0
Stem Tuber 0
Unclassified 5.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000545 3300002459 Bacteria 10495
2 rootL2_10106769 3300003322 Unclassified 2230
3 rootL2_10113975 3300003322 Bacteria 3754
4 rootL2_10309132 3300003322 Bacteria 1582
5 rootH1_10014521 3300003323 Bacteria 14428
6 Ga0055531_10000102 3300003794 Bacteria 92703
7 Ga0065714_10070238 3300005288 Unclassified 3924
8 Ga0065704_10070668 3300005289 Bacteria 18004
9 Ga0065712_10089714 3300005290 Bacteria 2446
10 Ga0070683_100014007 3300005329 Bacteria 7003
11 Ga0070683_100114607 3300005329 Bacteria 2544
12 Ga0070670_100005791 3300005331 Bacteria 10443
13 Ga0070677_10055786 3300005333 Bacteria 1614
14 Ga0068869_100005323 3300005334 Bacteria 8089
15 Ga0068869_100022135 3300005334 Bacteria 4377
16 Ga0070666_10012021 3300005335 Bacteria 5449
17 Ga0068868_100007175 3300005338 Bacteria 7918
18 Ga0070661_100092136 3300005344 Unclassified 2245
19 Ga0070673_100096979 3300005364 Bacteria 2420
20 Ga0070673_100126457 3300005364 Unclassified 2139
21 Ga0070688_100015279 3300005365 Bacteria 4364
22 Ga0070659_100009091 3300005366 Bacteria 7290
23 Ga0070667_100022267 3300005367 Bacteria 5257
24 Ga0070667_100024589 3300005367 Bacteria 5004
25 Ga0070700_100168615 3300005441 Unclassified 1514
26 Ga0070662_100051276 3300005457 Bacteria 2979
27 Ga0070662_100080531 3300005457 Unclassified 2424
28 Ga0068867_100014061 3300005459 Bacteria 5669
29 Ga0068867_100167771 3300005459 Bacteria 1736
30 Ga0070685_10020650 3300005466 Bacteria 3565
31 Ga0070698_100003746 3300005471 Bacteria 16718
32 Ga0070698_100010827 3300005471 Bacteria 9706
33 Ga0070698_100131009 3300005471 Bacteria 2463
34 Ga0070698_100133369 3300005471 Bacteria 2438
35 Ga0070679_100196113 3300005530 Bacteria 1987
36 Ga0070684_100032380 3300005535 Bacteria 4455
37 Ga0068853_100017234 3300005539 Bacteria 5962
38 Ga0070665_100000034 3300005548 Bacteria 324289
39 Ga0068855_100007544 3300005563 Bacteria 13159
40 Ga0070664_100018432 3300005564 Bacteria 5735
41 Ga0070664_100060205 3300005564 Bacteria 3233
42 Ga0070664_100174881 3300005564 Bacteria 1906
43 Ga0068857_100025512 3300005577 Bacteria 5204
44 Ga0068859_100189321 3300005617 Bacteria 2142
45 Ga0068864_100042020 3300005618 Bacteria 3911
46 Ga0068864_100069627 3300005618 Bacteria 3060
47 Ga0068864_100099366 3300005618 Bacteria 2578
48 Ga0068861_100002756 3300005719 Bacteria 11524
49 Ga0068861_100177953 3300005719 Bacteria 1768
50 Ga0068860_100386016 3300005843 Unclassified 1383
51 Ga0068862_100096145 3300005844 Bacteria 2585
52 Ga0068862_100134366 3300005844 Bacteria 2191
53 Ga0075366_10013098 3300006195 Bacteria 4716
54 Ga0097621_100002997 3300006237 Bacteria 11601
55 Ga0068871_100014347 3300006358 Bacteria 5904
56 Ga0068871_100115375 3300006358 Bacteria 2264
57 Ga0075428_100048309 3300006844 Bacteria 4671
58 Ga0075428_100269109 3300006844 Bacteria 1833
59 Ga0097620_100189321 3300006931 Bacteria 2142
60 Ga0105240_10024455 3300009093 Bacteria 7958
61 Ga0111539_10010417 3300009094 Bacteria 11702
62 Ga0111539_10027742 3300009094 Bacteria 6917
63 Ga0114129_10364474 3300009147 Bacteria 1911
64 Ga0105237_10001181 3300009545 Bacteria 34916
65 Ga0105249_10000984 3300009553 Bacteria 25247
66 Ga0105249_10004046 3300009553 Bacteria 12644
67 Ga0105239_10069092 3300010375 Bacteria 3882
68 Ga0157370_10059040 3300013104 Bacteria 3646
69 Ga0157374_10303272 3300013296 Unclassified 1580
70 Ga0157378_10065080 3300013297 Bacteria 3262
71 Ga0157378_10072166 3300013297 Bacteria 3102
72 Ga0163162_10000018 3300013306 Bacteria 226257
73 Ga0163162_10000453 3300013306 Bacteria 37951
74 Ga0163162_10001345 3300013306 Bacteria 22882
75 Ga0163162_10001661 3300013306 Bacteria 20854
76 Ga0163162_10044392 3300013306 Bacteria 4452
77 Ga0157372_10015250 3300013307 Bacteria 8231
78 Ga0157375_10044364 3300013308 Unclassified 4320
79 Ga0157375_10071561 3300013308 Bacteria 3482
80 Ga0157375_10073197 3300013308 Bacteria 3445
81 Ga0157375_10135248 3300013308 Bacteria 2588
82 Ga0157375_10399348 3300013308 Bacteria 1541
83 Ga0157380_10000383 3300014326 Bacteria 26712
84 Ga0157380_10014356 3300014326 Bacteria 5795
85 Ga0157379_10085343 3300014968 Bacteria 2829
86 Ga0157376_10001402 3300014969 Bacteria 15840
87 Ga0157376_10033253 3300014969 Bacteria 4149
88 Ga0163161_10035899 3300017792 Unclassified 3549
89 Ga0163161_10130409 3300017792 Bacteria 1896
90 Ga0163161_10141307 3300017792 Unclassified 1823
91 Ga0163161_10158917 3300017792 Unclassified 1723
92 Ga0209257_1000004 3300025304 Bacteria 1678347
93 Ga0207680_10009724 3300025903 Bacteria 4782
94 Ga0207645_10019211 3300025907 Unclassified 4483
95 Ga0207643_10001378 3300025908 Bacteria 13994
96 Ga0207695_10005550 3300025913 Bacteria 16675
97 Ga0207671_10001986 3300025914 Bacteria 22556
98 Ga0207662_10028351 3300025918 Bacteria 3236
99 Ga0207649_10018232 3300025920 Bacteria 3988
100 Ga0207644_10052231 3300025931 Bacteria 2937
101 Ga0207706_10072597 3300025933 Unclassified 3027
102 Ga0207706_10102427 3300025933 Bacteria 2519
103 Ga0207670_10031041 3300025936 Bacteria 3418
104 Ga0207704_10066483 3300025938 Unclassified 2263
105 Ga0207691_10013076 3300025940 Bacteria 7946
106 Ga0207691_10182558 3300025940 Bacteria 1833
107 Ga0207691_10224897 3300025940 Bacteria 1626
108 Ga0207689_10015536 3300025942 Bacteria 6448
109 Ga0207689_10028504 3300025942 Bacteria 4672
110 Ga0207689_10043407 3300025942 Bacteria 3717
111 Ga0207689_10050668 3300025942 Bacteria 3423
112 Ga0207661_10002647 3300025944 Bacteria 12320
113 Ga0207679_10051468 3300025945 Bacteria 3015
114 Ga0207679_10153516 3300025945 Bacteria 1877
115 Ga0207667_10017838 3300025949 Bacteria 7980
116 Ga0207712_10000801 3300025961 Bacteria 23196
117 Ga0207712_10005672 3300025961 Bacteria 7877
118 Ga0207668_10131617 3300025972 Bacteria 1911
119 Ga0207658_10045588 3300025986 Bacteria 3197
120 Ga0207677_10070572 3300026023 Unclassified 2462
121 Ga0207703_10012181 3300026035 Bacteria 6704
122 Ga0207639_10028304 3300026041 Bacteria 4090
123 Ga0207648_10005920 3300026089 Bacteria 12235
124 Ga0207648_10007102 3300026089 Bacteria 11049
125 Ga0207648_10113307 3300026089 Unclassified 2382
126 Ga0207676_10037276 3300026095 Bacteria 3704
127 Ga0207676_10075400 3300026095 Bacteria 2721
128 Ga0207674_10053524 3300026116 Bacteria 4114
129 Ga0207674_10235412 3300026116 Bacteria 1779
130 Ga0207674_10318743 3300026116 Bacteria 1504
131 Ga0207675_100005762 3300026118 Bacteria 11850
132 Ga0207683_10001848 3300026121 Bacteria 18723
133 Ga0268266_10000111 3300028379 Bacteria 169743
134 Ga0268265_10040437 3300028380 Unclassified 3444
135 Ga0268265_10107517 3300028380 Bacteria 2269
136 Ga0316177_1052006 3300030731 Bacteria 12104
137 Ga0316176_1041743 3300030732 Bacteria 19091
138 Ga0316181_1111774 3300030744 Bacteria 13972
139 Ga0265327_10000115 3300031251 Bacteria 173854
140 Ga0307414_10132248 3300032004 Bacteria 1939
141 Ga0307510_10011033 3300033180 Bacteria 10739
142 Ga0373924_0058284 3300035410 Bacteria 1612
143 Ga0373937_0007495 3300036401 Bacteria 9445
144 Ga0373937_0032890 3300036401 Unclassified 4706
145 Ga0373925_0311897 3300037068 Bacteria 1271
146 Ga0395905_0004874 3300037471 Bacteria 13829
147 Ga0395905_0112972 3300037471 Unclassified 2552
148 Ga0439441_000624 3300042001 Bacteria 4006
149 Ga0466969_0105083 3300044656 Bacteria 1326
150 Ga0495627_001156 3300046453 Bacteria 16999
151 Ga0495644_0015791 3300046523 Bacteria 2893
152 Ga0495633_0000017 3300046558 Bacteria 249973
153 Ga0495680_0078837 3300047322 Bacteria 2492
154 Ga0495686_0002568 3300047472 Bacteria 16912
155 Ga0495686_0028103 3300047472 Bacteria 3664
156 Ga0496101_0078296 3300048904 Bacteria 2438
157 Ga0496105_0116031 3300048908 Bacteria 2209
158 Ga0496110_0037992 3300048913 Bacteria 4187
159 Ga0501031_0029554 3300049568 Bacteria 3575
160 Ga0501034_0008023 3300049571 Bacteria 11206
161 Ga0501036_0044736 3300049572 Unclassified 3751
162 Ga0501038_0069751 3300049574 Bacteria 2985
163 Ga0501039_0012927 3300049575 Bacteria 6382
164 Ga0501043_0116708 3300049579 Bacteria 2094
165 Ga0501043_0344618 3300049579 Unclassified 1133
166 Ga0501047_0045486 3300049581 Unclassified 4245
167 Ga0501068_0107352 3300049584 Bacteria 1734
168 Ga0501225_0001905 3300049705 Bacteria 6544
169 Ga0501044_0031321 3300049823 Bacteria 5599
170 nmdc:mga0k408_2309_c2 3300050493 Bacteria 3906
171 nmdc:mga08y16_15127_c1 3300050511 Bacteria 8110
172 nmdc:mga08y16_40154_c1 3300050511 Bacteria 4906
173 Ga0500622_0000059 3300053156 Bacteria 134223

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049579 Ga0501043_0344618 Ga0501043_0344618_32_1084 349
2 3300025940 Ga0207691_10182558 Ga0207691_101825582 359
3 3300030731 Ga0316177_1052006 Ga0316177_10520062 385
4 3300030732 Ga0316176_1041743 Ga0316176_104174315 385
5 3300032004 Ga0307414_10132248 Ga0307414_101322481 393
6 3300003794 Ga0055531_10000102 Ga0055531_1000010233 398
7 3300025304 Ga0209257_1000004 Ga0209257_10000041316 398
8 3300048904 Ga0496101_0078296 Ga0496101_0078296_175_1425 398
9 3300049584 Ga0501068_0107352 Ga0501068_0107352_442_1653 399
10 3300050493 nmdc:mga0k408_2309_c2 nmdc:mga0k408_2309_c2_934_2133 399
11 3300003322 rootL2_10309132 rootL2_103091322 400
12 3300005577 Ga0068857_100025512 Ga0068857_1000255122 400
13 3300026116 Ga0207674_10235412 Ga0207674_102354122 400
14 3300010375 Ga0105239_10069092 Ga0105239_100690922 401
15 3300025986 Ga0207658_10045588 Ga0207658_100455881 401
16 3300053156 Ga0500622_0000059 Ga0500622_0000059_131245_132495 402
17 3300005364 Ga0070673_100126457 Ga0070673_1001264572 404
18 3300013308 Ga0157375_10399348 Ga0157375_103993482 404
19 3300026116 Ga0207674_10318743 Ga0207674_103187432 404
20 iso_pu_bacteria 2883068021 2883069761 404
21 iso_pu_bacteria 2884791551 2884795020 404
22 iso_pu_bacteria 2896109856 2896114495 404
23 iso_pu_bacteria 2929177148 2929181855 404
24 iso_pu_bacteria 2945977869 2945984251 404
25 iso_pu_bacteria 2946013367 2946016356 404
26 3300025908 Ga0207643_10001378 Ga0207643_100013789 405
27 3300047472 Ga0495686_0002568 Ga0495686_0002568_5514_6746 405
28 iso_pu_bacteria 2818991444 2819590858 405
29 3300025936 Ga0207670_10031041 Ga0207670_100310412 406
30 3300025940 Ga0207691_10013076 Ga0207691_100130765 406
31 3300003322 rootL2_10106769 rootL2_101067692 407
32 3300005441 Ga0070700_100168615 Ga0070700_1001686151 407
33 3300009094 Ga0111539_10027742 Ga0111539_100277427 407
34 3300014326 Ga0157380_10000383 Ga0157380_1000038326 407
35 3300014326 Ga0157380_10014356 Ga0157380_100143563 407
36 3300017792 Ga0163161_10141307 Ga0163161_101413072 407
37 3300030744 Ga0316181_1111774 Ga0316181_11117747 407
38 3300050511 nmdc:mga08y16_40154_c1 nmdc:mga08y16_40154_c1_156_1418 407
39 iso_pu_bacteria 2818991460 2819680183 407
40 iso_pu_bacteria 2896085136 2896090102 407
41 3300005289 Ga0065704_10070668 Ga0065704_1007066810 408
42 3300005471 Ga0070698_100131009 Ga0070698_1001310092 408
43 3300005618 Ga0068864_100069627 Ga0068864_1000696272 408
44 3300026089 Ga0207648_10007102 Ga0207648_100071026 408
45 3300049705 Ga0501225_0001905 Ga0501225_0001905_5100_6329 408
46 3300003322 rootL2_10113975 rootL2_101139753 409
47 3300003323 rootH1_10014521 rootH1_100145213 409
48 3300005288 Ga0065714_10070238 Ga0065714_100702383 409
49 3300005329 Ga0070683_100114607 Ga0070683_1001146072 409
50 3300005334 Ga0068869_100005323 Ga0068869_1000053234 409
51 3300005338 Ga0068868_100007175 Ga0068868_1000071753 409
52 3300005344 Ga0070661_100092136 Ga0070661_1000921362 409
53 3300005364 Ga0070673_100096979 Ga0070673_1000969791 409
54 3300005367 Ga0070667_100022267 Ga0070667_1000222671 409
55 3300005367 Ga0070667_100024589 Ga0070667_1000245892 409
56 3300005457 Ga0070662_100080531 Ga0070662_1000805312 409
57 3300005564 Ga0070664_100060205 Ga0070664_1000602052 409
58 3300005844 Ga0068862_100096145 Ga0068862_1000961452 409
59 3300006237 Ga0097621_100002997 Ga0097621_1000029974 409
60 3300006358 Ga0068871_100014347 Ga0068871_1000143475 409
61 3300013296 Ga0157374_10303272 Ga0157374_103032722 409
62 3300013297 Ga0157378_10065080 Ga0157378_100650802 409
63 3300013306 Ga0163162_10001661 Ga0163162_1000166110 409
64 3300013308 Ga0157375_10044364 Ga0157375_100443642 409
65 3300013308 Ga0157375_10071561 Ga0157375_100715613 409
66 3300017792 Ga0163161_10035899 Ga0163161_100358992 409
67 3300017792 Ga0163161_10158917 Ga0163161_101589172 409
68 3300025907 Ga0207645_10019211 Ga0207645_100192112 409
69 3300025933 Ga0207706_10072597 Ga0207706_100725972 409
70 3300025938 Ga0207704_10066483 Ga0207704_100664832 409
71 3300025940 Ga0207691_10224897 Ga0207691_102248972 409
72 3300025942 Ga0207689_10015536 Ga0207689_100155363 409
73 3300025942 Ga0207689_10050668 Ga0207689_100506682 409
74 3300025972 Ga0207668_10131617 Ga0207668_101316172 409
75 3300026023 Ga0207677_10070572 Ga0207677_100705722 409
76 3300026089 Ga0207648_10113307 Ga0207648_101133072 409
77 3300026121 Ga0207683_10001848 Ga0207683_100018489 409
78 3300028380 Ga0268265_10040437 Ga0268265_100404372 409
79 3300035410 Ga0373924_0058284 Ga0373924_0058284_248_1477 409
80 3300036401 Ga0373937_0007495 Ga0373937_0007495_4293_5522 409
81 3300037068 Ga0373925_0311897 Ga0373925_0311897_14_1243 409
82 3300044656 Ga0466969_0105083 Ga0466969_0105083_59_1291 409
83 3300047322 Ga0495680_0078837 Ga0495680_0078837_730_1959 409
84 3300048908 Ga0496105_0116031 Ga0496105_0116031_300_1544 409
85 3300049568 Ga0501031_0029554 Ga0501031_0029554_279_1520 409
86 3300049571 Ga0501034_0008023 Ga0501034_0008023_218_1459 409
87 3300049572 Ga0501036_0044736 Ga0501036_0044736_1201_2442 409
88 3300049574 Ga0501038_0069751 Ga0501038_0069751_1349_2590 409
89 3300049575 Ga0501039_0012927 Ga0501039_0012927_704_1945 409
90 3300049579 Ga0501043_0116708 Ga0501043_0116708_182_1423 409
91 3300049581 Ga0501047_0045486 Ga0501047_0045486_1691_2932 409
92 3300049823 Ga0501044_0031321 Ga0501044_0031321_1397_2638 409
93 3300005618 Ga0068864_100042020 Ga0068864_1000420202 410
94 3300026095 Ga0207676_10037276 Ga0207676_100372762 410
95 3300031251 Ga0265327_10000115 Ga0265327_1000011547 410
96 3300033180 Ga0307510_10011033 Ga0307510_100110335 410
97 3300046453 Ga0495627_001156 Ga0495627_001156_12221_13474 410
98 3300046558 Ga0495633_0000017 Ga0495633_0000017_27535_28788 410
99 3300005329 Ga0070683_100014007 Ga0070683_1000140072 412
100 3300005366 Ga0070659_100009091 Ga0070659_1000090916 412
101 3300005530 Ga0070679_100196113 Ga0070679_1001961131 412
102 3300005535 Ga0070684_100032380 Ga0070684_1000323802 412
103 3300005539 Ga0068853_100017234 Ga0068853_1000172343 412
104 3300005548 Ga0070665_100000034 Ga0070665_100000034266 412
105 3300005563 Ga0068855_100007544 Ga0068855_1000075445 412
106 3300005564 Ga0070664_100018432 Ga0070664_1000184324 412
107 3300006844 Ga0075428_100048309 Ga0075428_1000483092 412
108 3300009093 Ga0105240_10024455 Ga0105240_100244555 412
109 3300009094 Ga0111539_10010417 Ga0111539_1001041713 412
110 3300009545 Ga0105237_10001181 Ga0105237_1000118119 412
111 3300013306 Ga0163162_10000018 Ga0163162_10000018233 412
112 3300025913 Ga0207695_10005550 Ga0207695_1000555011 412
113 3300025914 Ga0207671_10001986 Ga0207671_1000198614 412
114 3300025920 Ga0207649_10018232 Ga0207649_100182323 412
115 3300025944 Ga0207661_10002647 Ga0207661_100026472 412
116 3300025945 Ga0207679_10051468 Ga0207679_100514683 412
117 3300025949 Ga0207667_10017838 Ga0207667_100178386 412
118 3300026041 Ga0207639_10028304 Ga0207639_100283042 412
119 3300028379 Ga0268266_10000111 Ga0268266_1000011192 412
120 3300050511 nmdc:mga08y16_15127_c1 nmdc:mga08y16_15127_c1_5040_6326 412
121 3300005365 Ga0070688_100015279 Ga0070688_1000152792 413
122 3300005457 Ga0070662_100051276 Ga0070662_1000512763 413
123 3300005459 Ga0068867_100167771 Ga0068867_1001677712 413
124 3300005564 Ga0070664_100174881 Ga0070664_1001748812 413
125 3300013308 Ga0157375_10135248 Ga0157375_101352482 413
126 3300014968 Ga0157379_10085343 Ga0157379_100853433 413
127 3300025903 Ga0207680_10009724 Ga0207680_100097243 413
128 3300025933 Ga0207706_10102427 Ga0207706_101024272 413
129 3300026035 Ga0207703_10012181 Ga0207703_100121812 413
130 3300047472 Ga0495686_0028103 Ga0495686_0028103_1409_2704 413
131 3300005466 Ga0070685_10020650 Ga0070685_100206503 415
132 3300005719 Ga0068861_100002756 Ga0068861_1000027569 415
133 3300013306 Ga0163162_10001345 Ga0163162_100013453 415
134 3300025918 Ga0207662_10028351 Ga0207662_100283512 415
135 3300025945 Ga0207679_10153516 Ga0207679_101535162 415
136 3300026118 Ga0207675_100005762 Ga0207675_1000057623 415
137 3300036401 Ga0373937_0032890 Ga0373937_0032890_1518_2798 415
138 3300005334 Ga0068869_100022135 Ga0068869_1000221353 416
139 3300005471 Ga0070698_100133369 Ga0070698_1001333692 416
140 3300005618 Ga0068864_100099366 Ga0068864_1000993662 416
141 3300005844 Ga0068862_100134366 Ga0068862_1001343662 416
142 3300006195 Ga0075366_10013098 Ga0075366_100130984 416
143 3300025942 Ga0207689_10028504 Ga0207689_100285042 416
144 3300026095 Ga0207676_10075400 Ga0207676_100754002 416
145 3300028380 Ga0268265_10107517 Ga0268265_101075172 416
146 3300046523 Ga0495644_0015791 Ga0495644_0015791_793_2064 416
147 3300005290 Ga0065712_10089714 Ga0065712_100897141 417
148 3300005333 Ga0070677_10055786 Ga0070677_100557862 417
149 3300005335 Ga0070666_10012021 Ga0070666_100120212 417
150 3300048913 Ga0496110_0037992 Ga0496110_0037992_2308_3627 417
151 3300005471 Ga0070698_100003746 Ga0070698_1000037461 418
152 3300006844 Ga0075428_100269109 Ga0075428_1002691092 418
153 3300005719 Ga0068861_100177953 Ga0068861_1001779532 419
154 3300006358 Ga0068871_100115375 Ga0068871_1001153752 419
155 3300013104 Ga0157370_10059040 Ga0157370_100590402 419
156 3300013306 Ga0163162_10044392 Ga0163162_100443923 419
157 3300013307 Ga0157372_10015250 Ga0157372_100152504 419
158 3300014969 Ga0157376_10001402 Ga0157376_100014022 419
159 3300014969 Ga0157376_10033253 Ga0157376_100332533 419
160 3300005471 Ga0070698_100010827 Ga0070698_1000108273 420
161 3300009553 Ga0105249_10004046 Ga0105249_100040464 420
162 3300025961 Ga0207712_10000801 Ga0207712_100008016 420
163 3300037471 Ga0395905_0004874 Ga0395905_0004874_2849_4120 421
164 3300037471 Ga0395905_0112972 Ga0395905_0112972_56_1327 421
165 3300005459 Ga0068867_100014061 Ga0068867_1000140614 422
166 3300009147 Ga0114129_10364474 Ga0114129_103644742 422
167 3300013306 Ga0163162_10000453 Ga0163162_1000045313 422
168 3300025942 Ga0207689_10043407 Ga0207689_100434073 422
169 3300026089 Ga0207648_10005920 Ga0207648_100059204 422
170 3300042001 Ga0439441_000624 Ga0439441_000624_11_1285 422
171 3300005617 Ga0068859_100189321 Ga0068859_1001893212 423
172 3300005843 Ga0068860_100386016 Ga0068860_1003860161 423
173 3300006931 Ga0097620_100189321 Ga0097620_1001893212 423
174 3300013297 Ga0157378_10072166 Ga0157378_100721662 423
175 3300013308 Ga0157375_10073197 Ga0157375_100731972 423
176 3300017792 Ga0163161_10130409 Ga0163161_101304091 423
177 3300025931 Ga0207644_10052231 Ga0207644_100522313 423
178 3300026116 Ga0207674_10053524 Ga0207674_100535243 424
179 3300002459 JGI24751J29686_10000545 JGI24751J29686_100005456 430
180 3300005331 Ga0070670_100005791 Ga0070670_1000057919 430
181 3300009553 Ga0105249_10000984 Ga0105249_100009844 430
182 3300025961 Ga0207712_10005672 Ga0207712_100056722 430

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01663

Phosphodiest

Type I phosphodiesterase / nucleotide pyrophosphatase

60

299

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ezg-assembly1.cif.gz_B monobody 12d1 bound to kras(g12d) 0.7261 343 427
5ecj-assembly2.cif.gz_F crystal structure of monobody mb(s4) bound to prdm14 in complex with mtgr1 0.7193 343 427
8f0m-assembly1.cif.gz_B monobody 12d5 bound to kras(g12d) 0.7182 341 429
7tl8-assembly1.cif.gz_A 1.95a resolution structure of independent phosphoglycerate mutase from s. aureus in complex with a macrocyclic peptide inhibitor (sa-d3) 0.7174 119 340
7t0r-assembly1.cif.gz_G crystal structure of the anti-cd4 adnectin 6940_b01 as a complex with the extracellular domains of cd4 and ibalizumab fab 0.7091 343 429
ID Description Score Start End Superfamily
af_A1Z705_126_335_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.8014 122 336 3.40.720.10
af_Q3V0F0_975_1047_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7545 338 417 2.60.40.10
af_A0A0P0VQ96_203_383_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.7503 190 332 3.40.720.10
af_P33896_229_329_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7448 343 430 2.60.40.10
af_F1R9Y1_914_1010_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.741 341 428 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A813T7Z7-F1-model_v4 Nucleotide pyrophosphatase 0.9753 35 427 GO:0006796
GO:0016020
GO:0016787
AF-A0A819EHG3-F1-model_v4 Nucleotide pyrophosphatase 0.9753 35 427 GO:0006796
GO:0016787
AF-A0A4Q3QSK8-F1-model_v4 deleted 0.9748 35 427
AF-A0A820L435-F1-model_v4 Nucleotide pyrophosphatase 0.9741 120 337
AF-A0A520C730-F1-model_v4 Alkaline phosphatase family protein 0.9739 122 429

Feature Viewer

pLDDT pTM Quality
88.23 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map