F277992

General Info

Members Datasets Scaffolds Average Seq Length
181 125 181 341

Family's Representative Sequence

Representative Sequence 3300046679|Ga0495623_0062399|Ga0495623_0062399_932_2122
Length 396
Sequence MTNKIINKNDLRHTVNRHRQNRKNKCSLGLVSCIESHMTSGVPNPSISPGELLAAWGRILTGRVPMLSIEITRECPLSCPGCYAYGDTHLGGGITLSELSDLRGDQLVEGVLQLVRKHKPLHVSLVGGEPMVRHRELSRILPELSRMEVFSLVVTSGVLPVPAEWMSLPRVRIAISVDGLPEHHDIRRKPASYERILKNIEGREVNIHWVITRPMLERAGYLEEYVNFWNARAETNRIWVSVYSPQIGERSPETLAPEDREIVARELPSLAKKYPKLLFNEGIAKAFLRSPKNPDECLFAKMSANYSADFETRVEPCVFGGTPDCTQCGCAASTGLHWIRGIKMAGPVKVDHFIGSSVKIGLMMNRLRSHAARPSRWTPSDESRNAKGDKLLQIQS

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
5 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
21 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
28 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
48 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
69 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
74 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
75 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
76 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
77 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
78 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
79 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
80 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
81 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
85 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
86 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
87 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
88 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
89 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
90 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
91 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
92 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
93 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
94 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
95 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
96 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
99 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
100 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
101 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
102 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
103 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
104 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
105 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
106 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
107 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
108 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
109 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
110 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
111 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
112 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
113 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
114 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
115 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
116 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
117 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
118 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
120 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
121 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
122 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
123 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
124 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
125 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.34
Metatranscriptomes 1.66
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.21
Rhizosphere 94.48
Stem 0
Stem Tuber 0
Unclassified 3.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000157 3300000546 Bacteria 10981
2 Ga0070709_10065152 3300005434 Unclassified 2332
3 Ga0070714_100041656 3300005435 Bacteria 3876
4 Ga0070701_10009827 3300005438 Bacteria 4206
5 Ga0070711_100029120 3300005439 Unclassified 3641
6 Ga0070711_100116230 3300005439 Bacteria 1971
7 Ga0070705_100077959 3300005440 Unclassified 2025
8 Ga0070700_100060029 3300005441 Bacteria 2396
9 Ga0070708_100003881 3300005445 Bacteria 11735
10 Ga0070708_100005542 3300005445 Bacteria 10004
11 Ga0070708_100204101 3300005445 Bacteria 1851
12 Ga0070708_100412159 3300005445 Unclassified 1274
13 Ga0070706_100009698 3300005467 Bacteria 8949
14 Ga0070706_100017501 3300005467 Bacteria 6615
15 Ga0070706_100021778 3300005467 Bacteria 5902
16 Ga0070706_100192198 3300005467 Unclassified 1907
17 Ga0070706_100266120 3300005467 Bacteria 1600
18 Ga0070706_100358869 3300005467 Unclassified 1358
19 Ga0070707_100000327 3300005468 Bacteria 46790
20 Ga0070707_100007058 3300005468 Bacteria 10416
21 Ga0070707_100073814 3300005468 Bacteria 3289
22 Ga0070698_100020686 3300005471 Bacteria 6900
23 Ga0070698_100028135 3300005471 Bacteria 5842
24 Ga0070699_100013432 3300005518 Bacteria 7054
25 Ga0070699_100064767 3300005518 Bacteria 3170
26 Ga0070697_100005329 3300005536 Bacteria 9884
27 Ga0068854_100033349 3300005578 Bacteria 3590
28 Ga0068856_100012885 3300005614 Bacteria 8093
29 Ga0068859_100293961 3300005617 Bacteria 1718
30 Ga0068866_10050453 3300005718 Bacteria 2113
31 Ga0068862_100186937 3300005844 Bacteria 1862
32 Ga0070717_10000617 3300006028 Bacteria 22842
33 Ga0070716_100022433 3300006173 Bacteria 3337
34 Ga0097621_100004250 3300006237 Bacteria 9952
35 Ga0068871_100046396 3300006358 Bacteria 3500
36 Ga0068871_100491704 3300006358 Bacteria 1105
37 Ga0075428_100092985 3300006844 Bacteria 3287
38 Ga0075433_10000396 3300006852 Bacteria 27734
39 Ga0075434_100000839 3300006871 Bacteria 24421
40 Ga0097620_100293960 3300006931 Bacteria 1718
41 Ga0075435_100000861 3300007076 Bacteria 18993
42 Ga0075435_100057855 3300007076 Bacteria 3137
43 Ga0099794_10011929 3300007265 Unclassified 3735
44 Ga0099794_10021308 3300007265 Bacteria 2944
45 Ga0099794_10023465 3300007265 Unclassified 2822
46 Ga0105240_10197617 3300009093 Bacteria 2359
47 Ga0105245_10027346 3300009098 Bacteria 5026
48 Ga0114129_10022629 3300009147 Bacteria 8914
49 Ga0105242_10007870 3300009176 Bacteria 8203
50 Ga0105248_10181700 3300009177 Bacteria 2370
51 Ga0105248_10283061 3300009177 Bacteria 1867
52 Ga0105248_10459844 3300009177 Bacteria 1435
53 Ga0105249_10030186 3300009553 Bacteria 4899
54 Ga0105239_10363781 3300010375 Unclassified 1634
55 Ga0157373_10005990 3300013100 Bacteria 9095
56 Ga0157370_10041500 3300013104 Bacteria 4438
57 Ga0157369_10118430 3300013105 Bacteria 2811
58 Ga0157374_10063744 3300013296 Bacteria 3457
59 Ga0157378_10000399 3300013297 Bacteria 42664
60 Ga0157378_10000614 3300013297 Bacteria 33505
61 Ga0163162_10040405 3300013306 Bacteria 4664
62 Ga0157372_10171921 3300013307 Bacteria 2507
63 Ga0157372_10567156 3300013307 Bacteria 1323
64 Ga0157375_10292697 3300013308 Unclassified 1791
65 Ga0157375_10384433 3300013308 Bacteria 1570
66 Ga0163163_10015903 3300014325 Bacteria 6969
67 Ga0163163_10138302 3300014325 Unclassified 2477
68 Ga0157379_10006889 3300014968 Bacteria 9827
69 Ga0213876_10005421 3300021384 Bacteria 7022
70 Ga0213875_10022986 3300021388 Bacteria 2981
71 Ga0207642_10043799 3300025899 Bacteria 1977
72 Ga0207699_10070485 3300025906 Unclassified 2134
73 Ga0207684_10018771 3300025910 Bacteria 5917
74 Ga0207684_10058501 3300025910 Bacteria 3271
75 Ga0207684_10059331 3300025910 Bacteria 3249
76 Ga0207684_10075032 3300025910 Bacteria 2874
77 Ga0207684_10164646 3300025910 Unclassified 1910
78 Ga0207695_10005356 3300025913 Bacteria 17065
79 Ga0207671_10039057 3300025914 Bacteria 3516
80 Ga0207693_10155916 3300025915 Unclassified 1796
81 Ga0207663_10023585 3300025916 Unclassified 3533
82 Ga0207646_10000042 3300025922 Bacteria 186121
83 Ga0207646_10000549 3300025922 Bacteria 49403
84 Ga0207646_10089589 3300025922 Bacteria 2754
85 Ga0207646_10110632 3300025922 Bacteria 2465
86 Ga0207646_10112286 3300025922 Bacteria 2446
87 Ga0207646_10195170 3300025922 Bacteria 1828
88 Ga0207694_10054025 3300025924 Bacteria 3116
89 Ga0207687_10005867 3300025927 Bacteria 8121
90 Ga0207700_10344638 3300025928 Bacteria 1296
91 Ga0207664_10047596 3300025929 Bacteria 3370
92 Ga0207665_10010658 3300025939 Bacteria 6036
93 Ga0207665_10217707 3300025939 Bacteria 1398
94 Ga0207711_10071101 3300025941 Bacteria 3019
95 Ga0207711_10100963 3300025941 Unclassified 2553
96 Ga0207661_10035612 3300025944 Bacteria 3881
97 Ga0207712_10061625 3300025961 Bacteria 2663
98 Ga0207677_10005678 3300026023 Bacteria 6789
99 Ga0207678_10080096 3300026067 Bacteria 2796
100 Ga0207648_10253658 3300026089 Bacteria 1568
101 Ga0209588_1000292 3300027671 Bacteria 13222
102 Ga0207428_10000395 3300027907 Bacteria 54490
103 Ga0268264_10020359 3300028381 Bacteria 5421
104 Ga0265338_10008544 3300028800 Bacteria 12400
105 Ga0265765_1005176 3300030879 Bacteria 1361
106 Ga0265760_10003310 3300031090 Bacteria 4717
107 Ga0265760_10009869 3300031090 Unclassified 2725
108 Ga0265339_10066541 3300031249 Bacteria 1929
109 Ga0265314_10006307 3300031711 Bacteria 10518
110 Ga0373926_0014847 3300035083 Bacteria 2652
111 Ga0373923_0038502 3300035111 Bacteria 1960
112 Ga0373954_0038704 3300035118 Bacteria 2219
113 Ga0373956_0028865 3300035119 Bacteria 2416
114 Ga0373956_0048259 3300035119 Bacteria 1907
115 Ga0373933_0000363 3300035724 Bacteria 28995
116 Ga0373947_0086394 3300035725 Bacteria 1950
117 Ga0373937_0000036 3300036401 Bacteria 113462
118 Ga0436364_1271488 3300037853 Bacteria 14707
119 Ga0436364_1408110 3300037853 Unclassified 2274
120 Ga0436365_1931493 3300039437 Bacteria 9557
121 Ga0436363_0740639 3300039450 Bacteria 7786
122 Ga0436362_0287237 3300039453 Unclassified 2452
123 Ga0436362_0952519 3300039453 Bacteria 6440
124 Ga0436362_1055815 3300039453 Bacteria 1525
125 Ga0451577_0000331 3300042876 Bacteria 88029
126 Ga0453683_0009319 3300044673 Bacteria 6560
127 Ga0453684_0000429 3300044712 Bacteria 171513
128 Ga0451576_0002208 3300045051 Bacteria 29964
129 Ga0495603_0032317 3300046455 Bacteria 3149
130 Ga0495651_0000035 3300046462 Bacteria 98834
131 Ga0495651_0019148 3300046462 Bacteria 5304
132 Ga0495651_0039131 3300046462 Bacteria 3692
133 Ga0495651_0105802 3300046462 Bacteria 2086
134 Ga0495580_0005416 3300046472 Bacteria 10547
135 Ga0495580_0027560 3300046472 Bacteria 4133
136 Ga0495664_0071103 3300046477 Bacteria 2078
137 Ga0495664_0087513 3300046477 Bacteria 1872
138 Ga0495608_0013739 3300046511 Bacteria 5617
139 Ga0495618_0148305 3300046514 Bacteria 1499
140 Ga0495628_0000993 3300046516 Bacteria 25943
141 Ga0495630_0059356 3300046517 Bacteria 2870
142 Ga0495630_0106288 3300046517 Bacteria 2125
143 Ga0495652_0019007 3300046529 Bacteria 6122
144 Ga0495652_0091598 3300046529 Bacteria 2485
145 Ga0495665_0034434 3300046531 Bacteria 2708
146 Ga0495587_0000526 3300046536 Bacteria 26512
147 Ga0495587_0000556 3300046536 Bacteria 25765
148 Ga0495667_0002518 3300046559 Bacteria 12243
149 Ga0495634_0103323 3300046642 Bacteria 1839
150 Ga0495635_0064067 3300046663 Unclassified 2524
151 Ga0495657_0093303 3300046675 Unclassified 1927
152 Ga0495623_0025839 3300046679 Bacteria 3782
153 Ga0495623_0062399 3300046679 Unclassified 2336
154 Ga0495613_0067543 3300046689 Bacteria 2610
155 Ga0495624_0022506 3300046690 Bacteria 4164
156 Ga0495600_0002221 3300046809 Bacteria 11043
157 Ga0495604_0033047 3300047317 Bacteria 4096
158 Ga0495604_0056437 3300047317 Bacteria 3023
159 Ga0495604_0063870 3300047317 Unclassified 2807
160 Ga0495674_0059419 3300047319 Unclassified 3339
161 Ga0495674_0098096 3300047319 Bacteria 2495
162 Ga0495680_0003494 3300047322 Bacteria 15423
163 Ga0495680_0004501 3300047322 Bacteria 13331
164 Ga0495675_0000340 3300047444 Bacteria 32927
165 Ga0495675_0007246 3300047444 Bacteria 6831
166 Ga0495684_0042679 3300047471 Bacteria 3473
167 Ga0495602_0000077 3300048088 Bacteria 94586
168 Ga0495602_0037003 3300048088 Bacteria 4535
169 Ga0496102_0129015 3300048905 Unclassified 2365
170 Ga0496102_0209636 3300048905 Unclassified 1837
171 Ga0496106_0051200 3300048909 Unclassified 3114
172 Ga0496115_0112902 3300048918 Unclassified 2233
173 Ga0501036_0244683 3300049572 Bacteria 1504
174 Ga0501074_0044335 3300049590 Bacteria 3220
175 Ga0501074_0095655 3300049590 Bacteria 2127
176 Ga0501077_0148538 3300049593 Unclassified 1487
177 Ga0501083_0182488 3300049744 Bacteria 1370
178 nmdc:mga08y16_5111_c1 3300050511 Bacteria 13707
179 Ga0495612_0016556 3300053078 Bacteria 2954
180 Ga0495619_0327075 3300053085 Unclassified 1061
181 Ga0501084_0133392 3300054114 Bacteria 2091

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039453 Ga0436362_0287237 Ga0436362_0287237_1499_2380 293
2 3300053085 Ga0495619_0327075 Ga0495619_0327075_67_978 303
3 3300027907 Ga0207428_10000395 Ga0207428_100003955 315
4 3300050511 nmdc:mga08y16_5111_c1 nmdc:mga08y16_5111_c1_4061_5035 315
5 3300005467 Ga0070706_100021778 Ga0070706_1000217787 317
6 3300005617 Ga0068859_100293961 Ga0068859_1002939612 323
7 3300006358 Ga0068871_100491704 Ga0068871_1004917041 323
8 3300006931 Ga0097620_100293960 Ga0097620_1002939602 323
9 3300009177 Ga0105248_10181700 Ga0105248_101817002 323
10 3300009177 Ga0105248_10459844 Ga0105248_104598442 323
11 3300014325 Ga0163163_10015903 Ga0163163_100159035 323
12 3300014968 Ga0157379_10006889 Ga0157379_100068897 323
13 3300025941 Ga0207711_10100963 Ga0207711_101009632 323
14 3300026089 Ga0207648_10253658 Ga0207648_102536582 323
15 3300046642 Ga0495634_0103323 Ga0495634_0103323_177_1154 323
16 3300005438 Ga0070701_10009827 Ga0070701_100098274 324
17 3300005441 Ga0070700_100060029 Ga0070700_1000600292 324
18 3300006844 Ga0075428_100092985 Ga0075428_1000929852 324
19 3300021388 Ga0213875_10022986 Ga0213875_100229862 324
20 3300037853 Ga0436364_1271488 Ga0436364_1271488_5711_6685 324
21 3300049572 Ga0501036_0244683 Ga0501036_0244683_106_1080 324
22 3300049590 Ga0501074_0044335 Ga0501074_0044335_247_1221 324
23 3300005718 Ga0068866_10050453 Ga0068866_100504533 325
24 3300006237 Ga0097621_100004250 Ga0097621_1000042505 325
25 3300006358 Ga0068871_100046396 Ga0068871_1000463967 325
26 3300013100 Ga0157373_10005990 Ga0157373_100059902 325
27 3300025927 Ga0207687_10005867 Ga0207687_100058677 325
28 3300025941 Ga0207711_10071101 Ga0207711_100711012 325
29 3300026023 Ga0207677_10005678 Ga0207677_100056787 325
30 3300005445 Ga0070708_100412159 Ga0070708_1004121592 326
31 3300005467 Ga0070706_100192198 Ga0070706_1001921982 326
32 3300005467 Ga0070706_100358869 Ga0070706_1003588692 326
33 3300005578 Ga0068854_100033349 Ga0068854_1000333492 326
34 3300007076 Ga0075435_100057855 Ga0075435_1000578553 326
35 3300009098 Ga0105245_10027346 Ga0105245_100273467 326
36 3300009176 Ga0105242_10007870 Ga0105242_1000787010 326
37 3300013296 Ga0157374_10063744 Ga0157374_100637448 326
38 3300013297 Ga0157378_10000614 Ga0157378_100006148 326
39 3300013306 Ga0163162_10040405 Ga0163162_100404053 326
40 3300013307 Ga0157372_10171921 Ga0157372_101719212 326
41 3300013308 Ga0157375_10384433 Ga0157375_103844332 326
42 3300025910 Ga0207684_10164646 Ga0207684_101646462 326
43 3300009177 Ga0105248_10283061 Ga0105248_102830612 327
44 3300013307 Ga0157372_10567156 Ga0157372_105671561 327
45 3300026067 Ga0207678_10080096 Ga0207678_100800962 327
46 3300005614 Ga0068856_100012885 Ga0068856_1000128854 328
47 3300049744 Ga0501083_0182488 Ga0501083_0182488_144_1130 328
48 3300046472 Ga0495580_0027560 Ga0495580_0027560_1238_2227 329
49 3300006852 Ga0075433_10000396 Ga0075433_100003968 330
50 3300006871 Ga0075434_100000839 Ga0075434_1000008398 330
51 3300007076 Ga0075435_100000861 Ga0075435_10000086112 330
52 3300028381 Ga0268264_10020359 Ga0268264_100203593 330
53 3300030879 Ga0265765_1005176 Ga0265765_10051764 330
54 3300035083 Ga0373926_0014847 Ga0373926_0014847_1425_2420 330
55 3300035111 Ga0373923_0038502 Ga0373923_0038502_789_1784 330
56 3300035118 Ga0373954_0038704 Ga0373954_0038704_1031_2026 330
57 3300035119 Ga0373956_0048259 Ga0373956_0048259_196_1191 330
58 3300035725 Ga0373947_0086394 Ga0373947_0086394_167_1162 330
59 3300046462 Ga0495651_0000035 Ga0495651_0000035_78998_79993 330
60 3300046462 Ga0495651_0039131 Ga0495651_0039131_160_1155 330
61 3300046462 Ga0495651_0105802 Ga0495651_0105802_69_1064 330
62 3300046472 Ga0495580_0005416 Ga0495580_0005416_6123_7118 330
63 3300046477 Ga0495664_0071103 Ga0495664_0071103_523_1518 330
64 3300046477 Ga0495664_0087513 Ga0495664_0087513_186_1181 330
65 3300046511 Ga0495608_0013739 Ga0495608_0013739_697_1692 330
66 3300046514 Ga0495618_0148305 Ga0495618_0148305_419_1414 330
67 3300046516 Ga0495628_0000993 Ga0495628_0000993_7146_8141 330
68 3300046517 Ga0495630_0059356 Ga0495630_0059356_187_1182 330
69 3300046517 Ga0495630_0106288 Ga0495630_0106288_556_1551 330
70 3300046529 Ga0495652_0019007 Ga0495652_0019007_4114_5109 330
71 3300046531 Ga0495665_0034434 Ga0495665_0034434_210_1205 330
72 3300046536 Ga0495587_0000526 Ga0495587_0000526_7542_8537 330
73 3300046559 Ga0495667_0002518 Ga0495667_0002518_4839_5834 330
74 3300046663 Ga0495635_0064067 Ga0495635_0064067_175_1170 330
75 3300046675 Ga0495657_0093303 Ga0495657_0093303_368_1363 330
76 3300046689 Ga0495613_0067543 Ga0495613_0067543_185_1180 330
77 3300046690 Ga0495624_0022506 Ga0495624_0022506_2146_3141 330
78 3300046809 Ga0495600_0002221 Ga0495600_0002221_3096_4091 330
79 3300047317 Ga0495604_0033047 Ga0495604_0033047_1897_2892 330
80 3300047317 Ga0495604_0056437 Ga0495604_0056437_1890_2885 330
81 3300047319 Ga0495674_0098096 Ga0495674_0098096_1487_2482 330
82 3300047322 Ga0495680_0003494 Ga0495680_0003494_1708_2703 330
83 3300047322 Ga0495680_0004501 Ga0495680_0004501_11553_12548 330
84 3300047444 Ga0495675_0000340 Ga0495675_0000340_14283_15278 330
85 3300047471 Ga0495684_0042679 Ga0495684_0042679_2008_3003 330
86 3300048088 Ga0495602_0037003 Ga0495602_0037003_1327_2322 330
87 3300053078 Ga0495612_0016556 Ga0495612_0016556_1563_2558 330
88 3300005445 Ga0070708_100005542 Ga0070708_1000055425 331
89 3300005468 Ga0070707_100007058 Ga0070707_1000070582 331
90 3300005518 Ga0070699_100013432 Ga0070699_1000134326 331
91 3300005536 Ga0070697_100005329 Ga0070697_1000053292 331
92 3300025922 Ga0207646_10112286 Ga0207646_101122862 331
93 3300005467 Ga0070706_100266120 Ga0070706_1002661202 332
94 3300006028 Ga0070717_10000617 Ga0070717_100006178 332
95 3300049590 Ga0501074_0095655 Ga0501074_0095655_361_1362 333
96 3300049593 Ga0501077_0148538 Ga0501077_0148538_287_1288 333
97 3300054114 Ga0501084_0133392 Ga0501084_0133392_444_1445 333
98 3300042876 Ga0451577_0000331 Ga0451577_0000331_15219_16283 340
99 3300044673 Ga0453683_0009319 Ga0453683_0009319_2005_3069 340
100 3300044712 Ga0453684_0000429 Ga0453684_0000429_58493_59557 340
101 3300045051 Ga0451576_0002208 Ga0451576_0002208_22898_23962 340
102 3300005445 Ga0070708_100003881 Ga0070708_10000388114 342
103 3300025924 Ga0207694_10054025 Ga0207694_100540252 342
104 3300025913 Ga0207695_10005356 Ga0207695_100053567 345
105 3300025914 Ga0207671_10039057 Ga0207671_100390572 345
106 3300039437 Ga0436365_1931493 Ga0436365_1931493_2376_3416 345
107 3300048918 Ga0496115_0112902 Ga0496115_0112902_1158_2195 345
108 3300025899 Ga0207642_10043799 Ga0207642_100437991 346
109 3300005844 Ga0068862_100186937 Ga0068862_1001869372 347
110 3300009147 Ga0114129_10022629 Ga0114129_1002262912 347
111 3300009553 Ga0105249_10030186 Ga0105249_100301865 347
112 3300013104 Ga0157370_10041500 Ga0157370_100415002 347
113 3300013105 Ga0157369_10118430 Ga0157369_101184303 347
114 3300021384 Ga0213876_10005421 Ga0213876_100054213 347
115 3300025944 Ga0207661_10035612 Ga0207661_100356121 347
116 3300025961 Ga0207712_10061625 Ga0207712_100616252 347
117 3300037853 Ga0436364_1408110 Ga0436364_1408110_1049_2095 347
118 3300039450 Ga0436363_0740639 Ga0436363_0740639_4355_5401 347
119 3300039453 Ga0436362_0952519 Ga0436362_0952519_4356_5402 347
120 3300039453 Ga0436362_1055815 Ga0436362_1055815_186_1232 347
121 3300005434 Ga0070709_10065152 Ga0070709_100651522 355
122 3300005439 Ga0070711_100029120 Ga0070711_1000291202 355
123 3300025906 Ga0207699_10070485 Ga0207699_100704853 355
124 3300025916 Ga0207663_10023585 Ga0207663_100235852 355
125 3300025939 Ga0207665_10217707 Ga0207665_102177072 355
126 3300035119 Ga0373956_0028865 Ga0373956_0028865_851_1936 355
127 3300035724 Ga0373933_0000363 Ga0373933_0000363_3576_4661 355
128 3300036401 Ga0373937_0000036 Ga0373937_0000036_3584_4669 355
129 3300046462 Ga0495651_0019148 Ga0495651_0019148_641_1726 355
130 3300046529 Ga0495652_0091598 Ga0495652_0091598_1160_2245 355
131 3300046536 Ga0495587_0000556 Ga0495587_0000556_3592_4677 355
132 3300046679 Ga0495623_0025839 Ga0495623_0025839_2626_3711 355
133 3300047444 Ga0495675_0007246 Ga0495675_0007246_4204_5289 355
134 3300048088 Ga0495602_0000077 Ga0495602_0000077_91496_92581 355
135 3300048905 Ga0496102_0209636 Ga0496102_0209636_509_1576 355
136 3300005468 Ga0070707_100073814 Ga0070707_1000738143 356
137 3300025910 Ga0207684_10059331 Ga0207684_100593313 356
138 3300025922 Ga0207646_10195170 Ga0207646_101951702 356
139 3300025939 Ga0207665_10010658 Ga0207665_100106583 356
140 3300031090 Ga0265760_10009869 Ga0265760_100098693 356
141 3300009093 Ga0105240_10197617 Ga0105240_101976172 357
142 3300014325 Ga0163163_10138302 Ga0163163_101383024 357
143 3300031090 Ga0265760_10003310 Ga0265760_100033103 357
144 3300031249 Ga0265339_10066541 Ga0265339_100665412 357
145 3300031711 Ga0265314_10006307 Ga0265314_100063072 357
146 3300046455 Ga0495603_0032317 Ga0495603_0032317_1453_2532 357
147 3300005435 Ga0070714_100041656 Ga0070714_1000416562 358
148 3300005439 Ga0070711_100116230 Ga0070711_1001162302 358
149 3300005440 Ga0070705_100077959 Ga0070705_1000779592 358
150 3300005467 Ga0070706_100009698 Ga0070706_1000096985 358
151 3300005467 Ga0070706_100017501 Ga0070706_1000175016 358
152 3300005468 Ga0070707_100000327 Ga0070707_1000003279 358
153 3300005471 Ga0070698_100020686 Ga0070698_1000206864 358
154 3300005471 Ga0070698_100028135 Ga0070698_1000281353 358
155 3300005518 Ga0070699_100064767 Ga0070699_1000647672 358
156 3300006173 Ga0070716_100022433 Ga0070716_1000224333 358
157 3300007265 Ga0099794_10021308 Ga0099794_100213081 358
158 3300007265 Ga0099794_10023465 Ga0099794_100234652 358
159 3300010375 Ga0105239_10363781 Ga0105239_103637812 358
160 3300013297 Ga0157378_10000399 Ga0157378_1000039914 358
161 3300013308 Ga0157375_10292697 Ga0157375_102926972 358
162 3300025910 Ga0207684_10018771 Ga0207684_100187712 358
163 3300025915 Ga0207693_10155916 Ga0207693_101559162 358
164 3300025922 Ga0207646_10000042 Ga0207646_1000004288 358
165 3300025922 Ga0207646_10000549 Ga0207646_1000054942 358
166 3300025922 Ga0207646_10110632 Ga0207646_101106321 358
167 3300025928 Ga0207700_10344638 Ga0207700_103446381 358
168 3300025929 Ga0207664_10047596 Ga0207664_100475962 358
169 3300027671 Ga0209588_1000292 Ga0209588_10002926 358
170 3300046679 Ga0495623_0062399 Ga0495623_0062399_932_2122 358
171 3300047317 Ga0495604_0063870 Ga0495604_0063870_96_1286 358
172 3300047319 Ga0495674_0059419 Ga0495674_0059419_1231_2421 358
173 3300048905 Ga0496102_0129015 Ga0496102_0129015_62_1138 358
174 3300048909 Ga0496106_0051200 Ga0496106_0051200_1705_2781 358
175 3300005445 Ga0070708_100204101 Ga0070708_1002041012 359
176 3300025910 Ga0207684_10075032 Ga0207684_100750324 359
177 3300025922 Ga0207646_10089589 Ga0207646_100895894 359
178 3300000546 LJNas_1000157 LJNas_100015710 360
179 3300007265 Ga0099794_10011929 Ga0099794_100119293 360
180 3300025910 Ga0207684_10058501 Ga0207684_100585012 360
181 3300028800 Ga0265338_10008544 Ga0265338_100085442 360

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

69

216

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b4c-assembly9.cif.gz_I structure of viperin from trichoderma virens 0.6934 26 241
8fsi-assembly1.cif.gz_A the structure of a crystallizable variant of e. coli pyruvate formate-lyase activating enzyme bound to sam 0.693 38 242
2yx0-assembly1.cif.gz_A crystal structure of p. horikoshii tyw1 0.6899 82 233
3cb8-assembly1.cif.gz_A 4fe-4s-pyruvate formate-lyase activating enzyme in complex with adomet and a peptide substrate 0.6848 38 233
3eo3-assembly2.cif.gz_C-2 crystal structure of the n-acetylmannosamine kinase domain of human gne protein 0.6811 69 116
ID Description Score Start End Superfamily
af_Q4CKR7_277_480_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.836 84 119 3.20.20.70
3canA00 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;pyruvate-formate lyase- activating enzyme 0.75 86 243 3.80.30.10
3canA00 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;pyruvate-formate lyase- activating enzyme 0.7297 86 243 3.80.30.10
af_A0A1D6PAR6_93_238_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7272 71 114 3.40.50.620
af_P95188_67_289_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7249 27 207 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7W1SD14-F1-model_v4 Radical SAM protein 0.9876 13 332 GO:0003824
GO:0046872
GO:0051536
AF-A0A2V8GMP1-F1-model_v4 Radical SAM protein 0.9806 91 332
AF-A0A522TA29-F1-model_v4 Radical SAM protein 0.9777 11 331 GO:0003824
GO:0046872
GO:0051536
AF-A0A2V9LAW0-F1-model_v4 Radical SAM protein 0.9765 11 226 GO:0003824
GO:0046872
GO:0051536
AF-A0A7W1SD14-F1-model_v4 Radical SAM protein 0.9725 13 332 GO:0003824
GO:0046872
GO:0051536

Feature Viewer

pLDDT pTM Quality
84.41 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map