F277992
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 181 | 125 | 181 | 341 |
Family's Representative Sequence
| Representative Sequence | 3300046679|Ga0495623_0062399|Ga0495623_0062399_932_2122 |
| Length | 396 |
| Sequence | MTNKIINKNDLRHTVNRHRQNRKNKCSLGLVSCIESHMTSGVPNPSISPGELLAAWGRILTGRVPMLSIEITRECPLSCPGCYAYGDTHLGGGITLSELSDLRGDQLVEGVLQLVRKHKPLHVSLVGGEPMVRHRELSRILPELSRMEVFSLVVTSGVLPVPAEWMSLPRVRIAISVDGLPEHHDIRRKPASYERILKNIEGREVNIHWVITRPMLERAGYLEEYVNFWNARAETNRIWVSVYSPQIGERSPETLAPEDREIVARELPSLAKKYPKLLFNEGIAKAFLRSPKNPDECLFAKMSANYSADFETRVEPCVFGGTPDCTQCGCAASTGLHWIRGIKMAGPVKVDHFIGSSVKIGLMMNRLRSHAARPSRWTPSDESRNAKGDKLLQIQS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 3 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 5 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 15 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 16 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 17 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 18 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 19 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 22 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 23 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 24 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 25 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 26 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 28 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 29 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 47 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 48 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 69 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 71 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 72 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 73 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 74 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 75 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 76 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 77 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 78 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 79 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 80 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 81 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 82 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 83 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 84 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 85 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 86 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 87 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 88 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 89 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 90 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 116 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 117 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 118 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 119 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 120 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 121 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 123 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.34 |
| Metatranscriptomes | 1.66 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.21 |
| Rhizosphere | 94.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1000157 | 3300000546 | Bacteria | 10981 |
| 2 | Ga0070709_10065152 | 3300005434 | Unclassified | 2332 |
| 3 | Ga0070714_100041656 | 3300005435 | Bacteria | 3876 |
| 4 | Ga0070701_10009827 | 3300005438 | Bacteria | 4206 |
| 5 | Ga0070711_100029120 | 3300005439 | Unclassified | 3641 |
| 6 | Ga0070711_100116230 | 3300005439 | Bacteria | 1971 |
| 7 | Ga0070705_100077959 | 3300005440 | Unclassified | 2025 |
| 8 | Ga0070700_100060029 | 3300005441 | Bacteria | 2396 |
| 9 | Ga0070708_100003881 | 3300005445 | Bacteria | 11735 |
| 10 | Ga0070708_100005542 | 3300005445 | Bacteria | 10004 |
| 11 | Ga0070708_100204101 | 3300005445 | Bacteria | 1851 |
| 12 | Ga0070708_100412159 | 3300005445 | Unclassified | 1274 |
| 13 | Ga0070706_100009698 | 3300005467 | Bacteria | 8949 |
| 14 | Ga0070706_100017501 | 3300005467 | Bacteria | 6615 |
| 15 | Ga0070706_100021778 | 3300005467 | Bacteria | 5902 |
| 16 | Ga0070706_100192198 | 3300005467 | Unclassified | 1907 |
| 17 | Ga0070706_100266120 | 3300005467 | Bacteria | 1600 |
| 18 | Ga0070706_100358869 | 3300005467 | Unclassified | 1358 |
| 19 | Ga0070707_100000327 | 3300005468 | Bacteria | 46790 |
| 20 | Ga0070707_100007058 | 3300005468 | Bacteria | 10416 |
| 21 | Ga0070707_100073814 | 3300005468 | Bacteria | 3289 |
| 22 | Ga0070698_100020686 | 3300005471 | Bacteria | 6900 |
| 23 | Ga0070698_100028135 | 3300005471 | Bacteria | 5842 |
| 24 | Ga0070699_100013432 | 3300005518 | Bacteria | 7054 |
| 25 | Ga0070699_100064767 | 3300005518 | Bacteria | 3170 |
| 26 | Ga0070697_100005329 | 3300005536 | Bacteria | 9884 |
| 27 | Ga0068854_100033349 | 3300005578 | Bacteria | 3590 |
| 28 | Ga0068856_100012885 | 3300005614 | Bacteria | 8093 |
| 29 | Ga0068859_100293961 | 3300005617 | Bacteria | 1718 |
| 30 | Ga0068866_10050453 | 3300005718 | Bacteria | 2113 |
| 31 | Ga0068862_100186937 | 3300005844 | Bacteria | 1862 |
| 32 | Ga0070717_10000617 | 3300006028 | Bacteria | 22842 |
| 33 | Ga0070716_100022433 | 3300006173 | Bacteria | 3337 |
| 34 | Ga0097621_100004250 | 3300006237 | Bacteria | 9952 |
| 35 | Ga0068871_100046396 | 3300006358 | Bacteria | 3500 |
| 36 | Ga0068871_100491704 | 3300006358 | Bacteria | 1105 |
| 37 | Ga0075428_100092985 | 3300006844 | Bacteria | 3287 |
| 38 | Ga0075433_10000396 | 3300006852 | Bacteria | 27734 |
| 39 | Ga0075434_100000839 | 3300006871 | Bacteria | 24421 |
| 40 | Ga0097620_100293960 | 3300006931 | Bacteria | 1718 |
| 41 | Ga0075435_100000861 | 3300007076 | Bacteria | 18993 |
| 42 | Ga0075435_100057855 | 3300007076 | Bacteria | 3137 |
| 43 | Ga0099794_10011929 | 3300007265 | Unclassified | 3735 |
| 44 | Ga0099794_10021308 | 3300007265 | Bacteria | 2944 |
| 45 | Ga0099794_10023465 | 3300007265 | Unclassified | 2822 |
| 46 | Ga0105240_10197617 | 3300009093 | Bacteria | 2359 |
| 47 | Ga0105245_10027346 | 3300009098 | Bacteria | 5026 |
| 48 | Ga0114129_10022629 | 3300009147 | Bacteria | 8914 |
| 49 | Ga0105242_10007870 | 3300009176 | Bacteria | 8203 |
| 50 | Ga0105248_10181700 | 3300009177 | Bacteria | 2370 |
| 51 | Ga0105248_10283061 | 3300009177 | Bacteria | 1867 |
| 52 | Ga0105248_10459844 | 3300009177 | Bacteria | 1435 |
| 53 | Ga0105249_10030186 | 3300009553 | Bacteria | 4899 |
| 54 | Ga0105239_10363781 | 3300010375 | Unclassified | 1634 |
| 55 | Ga0157373_10005990 | 3300013100 | Bacteria | 9095 |
| 56 | Ga0157370_10041500 | 3300013104 | Bacteria | 4438 |
| 57 | Ga0157369_10118430 | 3300013105 | Bacteria | 2811 |
| 58 | Ga0157374_10063744 | 3300013296 | Bacteria | 3457 |
| 59 | Ga0157378_10000399 | 3300013297 | Bacteria | 42664 |
| 60 | Ga0157378_10000614 | 3300013297 | Bacteria | 33505 |
| 61 | Ga0163162_10040405 | 3300013306 | Bacteria | 4664 |
| 62 | Ga0157372_10171921 | 3300013307 | Bacteria | 2507 |
| 63 | Ga0157372_10567156 | 3300013307 | Bacteria | 1323 |
| 64 | Ga0157375_10292697 | 3300013308 | Unclassified | 1791 |
| 65 | Ga0157375_10384433 | 3300013308 | Bacteria | 1570 |
| 66 | Ga0163163_10015903 | 3300014325 | Bacteria | 6969 |
| 67 | Ga0163163_10138302 | 3300014325 | Unclassified | 2477 |
| 68 | Ga0157379_10006889 | 3300014968 | Bacteria | 9827 |
| 69 | Ga0213876_10005421 | 3300021384 | Bacteria | 7022 |
| 70 | Ga0213875_10022986 | 3300021388 | Bacteria | 2981 |
| 71 | Ga0207642_10043799 | 3300025899 | Bacteria | 1977 |
| 72 | Ga0207699_10070485 | 3300025906 | Unclassified | 2134 |
| 73 | Ga0207684_10018771 | 3300025910 | Bacteria | 5917 |
| 74 | Ga0207684_10058501 | 3300025910 | Bacteria | 3271 |
| 75 | Ga0207684_10059331 | 3300025910 | Bacteria | 3249 |
| 76 | Ga0207684_10075032 | 3300025910 | Bacteria | 2874 |
| 77 | Ga0207684_10164646 | 3300025910 | Unclassified | 1910 |
| 78 | Ga0207695_10005356 | 3300025913 | Bacteria | 17065 |
| 79 | Ga0207671_10039057 | 3300025914 | Bacteria | 3516 |
| 80 | Ga0207693_10155916 | 3300025915 | Unclassified | 1796 |
| 81 | Ga0207663_10023585 | 3300025916 | Unclassified | 3533 |
| 82 | Ga0207646_10000042 | 3300025922 | Bacteria | 186121 |
| 83 | Ga0207646_10000549 | 3300025922 | Bacteria | 49403 |
| 84 | Ga0207646_10089589 | 3300025922 | Bacteria | 2754 |
| 85 | Ga0207646_10110632 | 3300025922 | Bacteria | 2465 |
| 86 | Ga0207646_10112286 | 3300025922 | Bacteria | 2446 |
| 87 | Ga0207646_10195170 | 3300025922 | Bacteria | 1828 |
| 88 | Ga0207694_10054025 | 3300025924 | Bacteria | 3116 |
| 89 | Ga0207687_10005867 | 3300025927 | Bacteria | 8121 |
| 90 | Ga0207700_10344638 | 3300025928 | Bacteria | 1296 |
| 91 | Ga0207664_10047596 | 3300025929 | Bacteria | 3370 |
| 92 | Ga0207665_10010658 | 3300025939 | Bacteria | 6036 |
| 93 | Ga0207665_10217707 | 3300025939 | Bacteria | 1398 |
| 94 | Ga0207711_10071101 | 3300025941 | Bacteria | 3019 |
| 95 | Ga0207711_10100963 | 3300025941 | Unclassified | 2553 |
| 96 | Ga0207661_10035612 | 3300025944 | Bacteria | 3881 |
| 97 | Ga0207712_10061625 | 3300025961 | Bacteria | 2663 |
| 98 | Ga0207677_10005678 | 3300026023 | Bacteria | 6789 |
| 99 | Ga0207678_10080096 | 3300026067 | Bacteria | 2796 |
| 100 | Ga0207648_10253658 | 3300026089 | Bacteria | 1568 |
| 101 | Ga0209588_1000292 | 3300027671 | Bacteria | 13222 |
| 102 | Ga0207428_10000395 | 3300027907 | Bacteria | 54490 |
| 103 | Ga0268264_10020359 | 3300028381 | Bacteria | 5421 |
| 104 | Ga0265338_10008544 | 3300028800 | Bacteria | 12400 |
| 105 | Ga0265765_1005176 | 3300030879 | Bacteria | 1361 |
| 106 | Ga0265760_10003310 | 3300031090 | Bacteria | 4717 |
| 107 | Ga0265760_10009869 | 3300031090 | Unclassified | 2725 |
| 108 | Ga0265339_10066541 | 3300031249 | Bacteria | 1929 |
| 109 | Ga0265314_10006307 | 3300031711 | Bacteria | 10518 |
| 110 | Ga0373926_0014847 | 3300035083 | Bacteria | 2652 |
| 111 | Ga0373923_0038502 | 3300035111 | Bacteria | 1960 |
| 112 | Ga0373954_0038704 | 3300035118 | Bacteria | 2219 |
| 113 | Ga0373956_0028865 | 3300035119 | Bacteria | 2416 |
| 114 | Ga0373956_0048259 | 3300035119 | Bacteria | 1907 |
| 115 | Ga0373933_0000363 | 3300035724 | Bacteria | 28995 |
| 116 | Ga0373947_0086394 | 3300035725 | Bacteria | 1950 |
| 117 | Ga0373937_0000036 | 3300036401 | Bacteria | 113462 |
| 118 | Ga0436364_1271488 | 3300037853 | Bacteria | 14707 |
| 119 | Ga0436364_1408110 | 3300037853 | Unclassified | 2274 |
| 120 | Ga0436365_1931493 | 3300039437 | Bacteria | 9557 |
| 121 | Ga0436363_0740639 | 3300039450 | Bacteria | 7786 |
| 122 | Ga0436362_0287237 | 3300039453 | Unclassified | 2452 |
| 123 | Ga0436362_0952519 | 3300039453 | Bacteria | 6440 |
| 124 | Ga0436362_1055815 | 3300039453 | Bacteria | 1525 |
| 125 | Ga0451577_0000331 | 3300042876 | Bacteria | 88029 |
| 126 | Ga0453683_0009319 | 3300044673 | Bacteria | 6560 |
| 127 | Ga0453684_0000429 | 3300044712 | Bacteria | 171513 |
| 128 | Ga0451576_0002208 | 3300045051 | Bacteria | 29964 |
| 129 | Ga0495603_0032317 | 3300046455 | Bacteria | 3149 |
| 130 | Ga0495651_0000035 | 3300046462 | Bacteria | 98834 |
| 131 | Ga0495651_0019148 | 3300046462 | Bacteria | 5304 |
| 132 | Ga0495651_0039131 | 3300046462 | Bacteria | 3692 |
| 133 | Ga0495651_0105802 | 3300046462 | Bacteria | 2086 |
| 134 | Ga0495580_0005416 | 3300046472 | Bacteria | 10547 |
| 135 | Ga0495580_0027560 | 3300046472 | Bacteria | 4133 |
| 136 | Ga0495664_0071103 | 3300046477 | Bacteria | 2078 |
| 137 | Ga0495664_0087513 | 3300046477 | Bacteria | 1872 |
| 138 | Ga0495608_0013739 | 3300046511 | Bacteria | 5617 |
| 139 | Ga0495618_0148305 | 3300046514 | Bacteria | 1499 |
| 140 | Ga0495628_0000993 | 3300046516 | Bacteria | 25943 |
| 141 | Ga0495630_0059356 | 3300046517 | Bacteria | 2870 |
| 142 | Ga0495630_0106288 | 3300046517 | Bacteria | 2125 |
| 143 | Ga0495652_0019007 | 3300046529 | Bacteria | 6122 |
| 144 | Ga0495652_0091598 | 3300046529 | Bacteria | 2485 |
| 145 | Ga0495665_0034434 | 3300046531 | Bacteria | 2708 |
| 146 | Ga0495587_0000526 | 3300046536 | Bacteria | 26512 |
| 147 | Ga0495587_0000556 | 3300046536 | Bacteria | 25765 |
| 148 | Ga0495667_0002518 | 3300046559 | Bacteria | 12243 |
| 149 | Ga0495634_0103323 | 3300046642 | Bacteria | 1839 |
| 150 | Ga0495635_0064067 | 3300046663 | Unclassified | 2524 |
| 151 | Ga0495657_0093303 | 3300046675 | Unclassified | 1927 |
| 152 | Ga0495623_0025839 | 3300046679 | Bacteria | 3782 |
| 153 | Ga0495623_0062399 | 3300046679 | Unclassified | 2336 |
| 154 | Ga0495613_0067543 | 3300046689 | Bacteria | 2610 |
| 155 | Ga0495624_0022506 | 3300046690 | Bacteria | 4164 |
| 156 | Ga0495600_0002221 | 3300046809 | Bacteria | 11043 |
| 157 | Ga0495604_0033047 | 3300047317 | Bacteria | 4096 |
| 158 | Ga0495604_0056437 | 3300047317 | Bacteria | 3023 |
| 159 | Ga0495604_0063870 | 3300047317 | Unclassified | 2807 |
| 160 | Ga0495674_0059419 | 3300047319 | Unclassified | 3339 |
| 161 | Ga0495674_0098096 | 3300047319 | Bacteria | 2495 |
| 162 | Ga0495680_0003494 | 3300047322 | Bacteria | 15423 |
| 163 | Ga0495680_0004501 | 3300047322 | Bacteria | 13331 |
| 164 | Ga0495675_0000340 | 3300047444 | Bacteria | 32927 |
| 165 | Ga0495675_0007246 | 3300047444 | Bacteria | 6831 |
| 166 | Ga0495684_0042679 | 3300047471 | Bacteria | 3473 |
| 167 | Ga0495602_0000077 | 3300048088 | Bacteria | 94586 |
| 168 | Ga0495602_0037003 | 3300048088 | Bacteria | 4535 |
| 169 | Ga0496102_0129015 | 3300048905 | Unclassified | 2365 |
| 170 | Ga0496102_0209636 | 3300048905 | Unclassified | 1837 |
| 171 | Ga0496106_0051200 | 3300048909 | Unclassified | 3114 |
| 172 | Ga0496115_0112902 | 3300048918 | Unclassified | 2233 |
| 173 | Ga0501036_0244683 | 3300049572 | Bacteria | 1504 |
| 174 | Ga0501074_0044335 | 3300049590 | Bacteria | 3220 |
| 175 | Ga0501074_0095655 | 3300049590 | Bacteria | 2127 |
| 176 | Ga0501077_0148538 | 3300049593 | Unclassified | 1487 |
| 177 | Ga0501083_0182488 | 3300049744 | Bacteria | 1370 |
| 178 | nmdc:mga08y16_5111_c1 | 3300050511 | Bacteria | 13707 |
| 179 | Ga0495612_0016556 | 3300053078 | Bacteria | 2954 |
| 180 | Ga0495619_0327075 | 3300053085 | Unclassified | 1061 |
| 181 | Ga0501084_0133392 | 3300054114 | Bacteria | 2091 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039453 | Ga0436362_0287237 | Ga0436362_0287237_1499_2380 | 293 |
| 2 | 3300053085 | Ga0495619_0327075 | Ga0495619_0327075_67_978 | 303 |
| 3 | 3300027907 | Ga0207428_10000395 | Ga0207428_100003955 | 315 |
| 4 | 3300050511 | nmdc:mga08y16_5111_c1 | nmdc:mga08y16_5111_c1_4061_5035 | 315 |
| 5 | 3300005467 | Ga0070706_100021778 | Ga0070706_1000217787 | 317 |
| 6 | 3300005617 | Ga0068859_100293961 | Ga0068859_1002939612 | 323 |
| 7 | 3300006358 | Ga0068871_100491704 | Ga0068871_1004917041 | 323 |
| 8 | 3300006931 | Ga0097620_100293960 | Ga0097620_1002939602 | 323 |
| 9 | 3300009177 | Ga0105248_10181700 | Ga0105248_101817002 | 323 |
| 10 | 3300009177 | Ga0105248_10459844 | Ga0105248_104598442 | 323 |
| 11 | 3300014325 | Ga0163163_10015903 | Ga0163163_100159035 | 323 |
| 12 | 3300014968 | Ga0157379_10006889 | Ga0157379_100068897 | 323 |
| 13 | 3300025941 | Ga0207711_10100963 | Ga0207711_101009632 | 323 |
| 14 | 3300026089 | Ga0207648_10253658 | Ga0207648_102536582 | 323 |
| 15 | 3300046642 | Ga0495634_0103323 | Ga0495634_0103323_177_1154 | 323 |
| 16 | 3300005438 | Ga0070701_10009827 | Ga0070701_100098274 | 324 |
| 17 | 3300005441 | Ga0070700_100060029 | Ga0070700_1000600292 | 324 |
| 18 | 3300006844 | Ga0075428_100092985 | Ga0075428_1000929852 | 324 |
| 19 | 3300021388 | Ga0213875_10022986 | Ga0213875_100229862 | 324 |
| 20 | 3300037853 | Ga0436364_1271488 | Ga0436364_1271488_5711_6685 | 324 |
| 21 | 3300049572 | Ga0501036_0244683 | Ga0501036_0244683_106_1080 | 324 |
| 22 | 3300049590 | Ga0501074_0044335 | Ga0501074_0044335_247_1221 | 324 |
| 23 | 3300005718 | Ga0068866_10050453 | Ga0068866_100504533 | 325 |
| 24 | 3300006237 | Ga0097621_100004250 | Ga0097621_1000042505 | 325 |
| 25 | 3300006358 | Ga0068871_100046396 | Ga0068871_1000463967 | 325 |
| 26 | 3300013100 | Ga0157373_10005990 | Ga0157373_100059902 | 325 |
| 27 | 3300025927 | Ga0207687_10005867 | Ga0207687_100058677 | 325 |
| 28 | 3300025941 | Ga0207711_10071101 | Ga0207711_100711012 | 325 |
| 29 | 3300026023 | Ga0207677_10005678 | Ga0207677_100056787 | 325 |
| 30 | 3300005445 | Ga0070708_100412159 | Ga0070708_1004121592 | 326 |
| 31 | 3300005467 | Ga0070706_100192198 | Ga0070706_1001921982 | 326 |
| 32 | 3300005467 | Ga0070706_100358869 | Ga0070706_1003588692 | 326 |
| 33 | 3300005578 | Ga0068854_100033349 | Ga0068854_1000333492 | 326 |
| 34 | 3300007076 | Ga0075435_100057855 | Ga0075435_1000578553 | 326 |
| 35 | 3300009098 | Ga0105245_10027346 | Ga0105245_100273467 | 326 |
| 36 | 3300009176 | Ga0105242_10007870 | Ga0105242_1000787010 | 326 |
| 37 | 3300013296 | Ga0157374_10063744 | Ga0157374_100637448 | 326 |
| 38 | 3300013297 | Ga0157378_10000614 | Ga0157378_100006148 | 326 |
| 39 | 3300013306 | Ga0163162_10040405 | Ga0163162_100404053 | 326 |
| 40 | 3300013307 | Ga0157372_10171921 | Ga0157372_101719212 | 326 |
| 41 | 3300013308 | Ga0157375_10384433 | Ga0157375_103844332 | 326 |
| 42 | 3300025910 | Ga0207684_10164646 | Ga0207684_101646462 | 326 |
| 43 | 3300009177 | Ga0105248_10283061 | Ga0105248_102830612 | 327 |
| 44 | 3300013307 | Ga0157372_10567156 | Ga0157372_105671561 | 327 |
| 45 | 3300026067 | Ga0207678_10080096 | Ga0207678_100800962 | 327 |
| 46 | 3300005614 | Ga0068856_100012885 | Ga0068856_1000128854 | 328 |
| 47 | 3300049744 | Ga0501083_0182488 | Ga0501083_0182488_144_1130 | 328 |
| 48 | 3300046472 | Ga0495580_0027560 | Ga0495580_0027560_1238_2227 | 329 |
| 49 | 3300006852 | Ga0075433_10000396 | Ga0075433_100003968 | 330 |
| 50 | 3300006871 | Ga0075434_100000839 | Ga0075434_1000008398 | 330 |
| 51 | 3300007076 | Ga0075435_100000861 | Ga0075435_10000086112 | 330 |
| 52 | 3300028381 | Ga0268264_10020359 | Ga0268264_100203593 | 330 |
| 53 | 3300030879 | Ga0265765_1005176 | Ga0265765_10051764 | 330 |
| 54 | 3300035083 | Ga0373926_0014847 | Ga0373926_0014847_1425_2420 | 330 |
| 55 | 3300035111 | Ga0373923_0038502 | Ga0373923_0038502_789_1784 | 330 |
| 56 | 3300035118 | Ga0373954_0038704 | Ga0373954_0038704_1031_2026 | 330 |
| 57 | 3300035119 | Ga0373956_0048259 | Ga0373956_0048259_196_1191 | 330 |
| 58 | 3300035725 | Ga0373947_0086394 | Ga0373947_0086394_167_1162 | 330 |
| 59 | 3300046462 | Ga0495651_0000035 | Ga0495651_0000035_78998_79993 | 330 |
| 60 | 3300046462 | Ga0495651_0039131 | Ga0495651_0039131_160_1155 | 330 |
| 61 | 3300046462 | Ga0495651_0105802 | Ga0495651_0105802_69_1064 | 330 |
| 62 | 3300046472 | Ga0495580_0005416 | Ga0495580_0005416_6123_7118 | 330 |
| 63 | 3300046477 | Ga0495664_0071103 | Ga0495664_0071103_523_1518 | 330 |
| 64 | 3300046477 | Ga0495664_0087513 | Ga0495664_0087513_186_1181 | 330 |
| 65 | 3300046511 | Ga0495608_0013739 | Ga0495608_0013739_697_1692 | 330 |
| 66 | 3300046514 | Ga0495618_0148305 | Ga0495618_0148305_419_1414 | 330 |
| 67 | 3300046516 | Ga0495628_0000993 | Ga0495628_0000993_7146_8141 | 330 |
| 68 | 3300046517 | Ga0495630_0059356 | Ga0495630_0059356_187_1182 | 330 |
| 69 | 3300046517 | Ga0495630_0106288 | Ga0495630_0106288_556_1551 | 330 |
| 70 | 3300046529 | Ga0495652_0019007 | Ga0495652_0019007_4114_5109 | 330 |
| 71 | 3300046531 | Ga0495665_0034434 | Ga0495665_0034434_210_1205 | 330 |
| 72 | 3300046536 | Ga0495587_0000526 | Ga0495587_0000526_7542_8537 | 330 |
| 73 | 3300046559 | Ga0495667_0002518 | Ga0495667_0002518_4839_5834 | 330 |
| 74 | 3300046663 | Ga0495635_0064067 | Ga0495635_0064067_175_1170 | 330 |
| 75 | 3300046675 | Ga0495657_0093303 | Ga0495657_0093303_368_1363 | 330 |
| 76 | 3300046689 | Ga0495613_0067543 | Ga0495613_0067543_185_1180 | 330 |
| 77 | 3300046690 | Ga0495624_0022506 | Ga0495624_0022506_2146_3141 | 330 |
| 78 | 3300046809 | Ga0495600_0002221 | Ga0495600_0002221_3096_4091 | 330 |
| 79 | 3300047317 | Ga0495604_0033047 | Ga0495604_0033047_1897_2892 | 330 |
| 80 | 3300047317 | Ga0495604_0056437 | Ga0495604_0056437_1890_2885 | 330 |
| 81 | 3300047319 | Ga0495674_0098096 | Ga0495674_0098096_1487_2482 | 330 |
| 82 | 3300047322 | Ga0495680_0003494 | Ga0495680_0003494_1708_2703 | 330 |
| 83 | 3300047322 | Ga0495680_0004501 | Ga0495680_0004501_11553_12548 | 330 |
| 84 | 3300047444 | Ga0495675_0000340 | Ga0495675_0000340_14283_15278 | 330 |
| 85 | 3300047471 | Ga0495684_0042679 | Ga0495684_0042679_2008_3003 | 330 |
| 86 | 3300048088 | Ga0495602_0037003 | Ga0495602_0037003_1327_2322 | 330 |
| 87 | 3300053078 | Ga0495612_0016556 | Ga0495612_0016556_1563_2558 | 330 |
| 88 | 3300005445 | Ga0070708_100005542 | Ga0070708_1000055425 | 331 |
| 89 | 3300005468 | Ga0070707_100007058 | Ga0070707_1000070582 | 331 |
| 90 | 3300005518 | Ga0070699_100013432 | Ga0070699_1000134326 | 331 |
| 91 | 3300005536 | Ga0070697_100005329 | Ga0070697_1000053292 | 331 |
| 92 | 3300025922 | Ga0207646_10112286 | Ga0207646_101122862 | 331 |
| 93 | 3300005467 | Ga0070706_100266120 | Ga0070706_1002661202 | 332 |
| 94 | 3300006028 | Ga0070717_10000617 | Ga0070717_100006178 | 332 |
| 95 | 3300049590 | Ga0501074_0095655 | Ga0501074_0095655_361_1362 | 333 |
| 96 | 3300049593 | Ga0501077_0148538 | Ga0501077_0148538_287_1288 | 333 |
| 97 | 3300054114 | Ga0501084_0133392 | Ga0501084_0133392_444_1445 | 333 |
| 98 | 3300042876 | Ga0451577_0000331 | Ga0451577_0000331_15219_16283 | 340 |
| 99 | 3300044673 | Ga0453683_0009319 | Ga0453683_0009319_2005_3069 | 340 |
| 100 | 3300044712 | Ga0453684_0000429 | Ga0453684_0000429_58493_59557 | 340 |
| 101 | 3300045051 | Ga0451576_0002208 | Ga0451576_0002208_22898_23962 | 340 |
| 102 | 3300005445 | Ga0070708_100003881 | Ga0070708_10000388114 | 342 |
| 103 | 3300025924 | Ga0207694_10054025 | Ga0207694_100540252 | 342 |
| 104 | 3300025913 | Ga0207695_10005356 | Ga0207695_100053567 | 345 |
| 105 | 3300025914 | Ga0207671_10039057 | Ga0207671_100390572 | 345 |
| 106 | 3300039437 | Ga0436365_1931493 | Ga0436365_1931493_2376_3416 | 345 |
| 107 | 3300048918 | Ga0496115_0112902 | Ga0496115_0112902_1158_2195 | 345 |
| 108 | 3300025899 | Ga0207642_10043799 | Ga0207642_100437991 | 346 |
| 109 | 3300005844 | Ga0068862_100186937 | Ga0068862_1001869372 | 347 |
| 110 | 3300009147 | Ga0114129_10022629 | Ga0114129_1002262912 | 347 |
| 111 | 3300009553 | Ga0105249_10030186 | Ga0105249_100301865 | 347 |
| 112 | 3300013104 | Ga0157370_10041500 | Ga0157370_100415002 | 347 |
| 113 | 3300013105 | Ga0157369_10118430 | Ga0157369_101184303 | 347 |
| 114 | 3300021384 | Ga0213876_10005421 | Ga0213876_100054213 | 347 |
| 115 | 3300025944 | Ga0207661_10035612 | Ga0207661_100356121 | 347 |
| 116 | 3300025961 | Ga0207712_10061625 | Ga0207712_100616252 | 347 |
| 117 | 3300037853 | Ga0436364_1408110 | Ga0436364_1408110_1049_2095 | 347 |
| 118 | 3300039450 | Ga0436363_0740639 | Ga0436363_0740639_4355_5401 | 347 |
| 119 | 3300039453 | Ga0436362_0952519 | Ga0436362_0952519_4356_5402 | 347 |
| 120 | 3300039453 | Ga0436362_1055815 | Ga0436362_1055815_186_1232 | 347 |
| 121 | 3300005434 | Ga0070709_10065152 | Ga0070709_100651522 | 355 |
| 122 | 3300005439 | Ga0070711_100029120 | Ga0070711_1000291202 | 355 |
| 123 | 3300025906 | Ga0207699_10070485 | Ga0207699_100704853 | 355 |
| 124 | 3300025916 | Ga0207663_10023585 | Ga0207663_100235852 | 355 |
| 125 | 3300025939 | Ga0207665_10217707 | Ga0207665_102177072 | 355 |
| 126 | 3300035119 | Ga0373956_0028865 | Ga0373956_0028865_851_1936 | 355 |
| 127 | 3300035724 | Ga0373933_0000363 | Ga0373933_0000363_3576_4661 | 355 |
| 128 | 3300036401 | Ga0373937_0000036 | Ga0373937_0000036_3584_4669 | 355 |
| 129 | 3300046462 | Ga0495651_0019148 | Ga0495651_0019148_641_1726 | 355 |
| 130 | 3300046529 | Ga0495652_0091598 | Ga0495652_0091598_1160_2245 | 355 |
| 131 | 3300046536 | Ga0495587_0000556 | Ga0495587_0000556_3592_4677 | 355 |
| 132 | 3300046679 | Ga0495623_0025839 | Ga0495623_0025839_2626_3711 | 355 |
| 133 | 3300047444 | Ga0495675_0007246 | Ga0495675_0007246_4204_5289 | 355 |
| 134 | 3300048088 | Ga0495602_0000077 | Ga0495602_0000077_91496_92581 | 355 |
| 135 | 3300048905 | Ga0496102_0209636 | Ga0496102_0209636_509_1576 | 355 |
| 136 | 3300005468 | Ga0070707_100073814 | Ga0070707_1000738143 | 356 |
| 137 | 3300025910 | Ga0207684_10059331 | Ga0207684_100593313 | 356 |
| 138 | 3300025922 | Ga0207646_10195170 | Ga0207646_101951702 | 356 |
| 139 | 3300025939 | Ga0207665_10010658 | Ga0207665_100106583 | 356 |
| 140 | 3300031090 | Ga0265760_10009869 | Ga0265760_100098693 | 356 |
| 141 | 3300009093 | Ga0105240_10197617 | Ga0105240_101976172 | 357 |
| 142 | 3300014325 | Ga0163163_10138302 | Ga0163163_101383024 | 357 |
| 143 | 3300031090 | Ga0265760_10003310 | Ga0265760_100033103 | 357 |
| 144 | 3300031249 | Ga0265339_10066541 | Ga0265339_100665412 | 357 |
| 145 | 3300031711 | Ga0265314_10006307 | Ga0265314_100063072 | 357 |
| 146 | 3300046455 | Ga0495603_0032317 | Ga0495603_0032317_1453_2532 | 357 |
| 147 | 3300005435 | Ga0070714_100041656 | Ga0070714_1000416562 | 358 |
| 148 | 3300005439 | Ga0070711_100116230 | Ga0070711_1001162302 | 358 |
| 149 | 3300005440 | Ga0070705_100077959 | Ga0070705_1000779592 | 358 |
| 150 | 3300005467 | Ga0070706_100009698 | Ga0070706_1000096985 | 358 |
| 151 | 3300005467 | Ga0070706_100017501 | Ga0070706_1000175016 | 358 |
| 152 | 3300005468 | Ga0070707_100000327 | Ga0070707_1000003279 | 358 |
| 153 | 3300005471 | Ga0070698_100020686 | Ga0070698_1000206864 | 358 |
| 154 | 3300005471 | Ga0070698_100028135 | Ga0070698_1000281353 | 358 |
| 155 | 3300005518 | Ga0070699_100064767 | Ga0070699_1000647672 | 358 |
| 156 | 3300006173 | Ga0070716_100022433 | Ga0070716_1000224333 | 358 |
| 157 | 3300007265 | Ga0099794_10021308 | Ga0099794_100213081 | 358 |
| 158 | 3300007265 | Ga0099794_10023465 | Ga0099794_100234652 | 358 |
| 159 | 3300010375 | Ga0105239_10363781 | Ga0105239_103637812 | 358 |
| 160 | 3300013297 | Ga0157378_10000399 | Ga0157378_1000039914 | 358 |
| 161 | 3300013308 | Ga0157375_10292697 | Ga0157375_102926972 | 358 |
| 162 | 3300025910 | Ga0207684_10018771 | Ga0207684_100187712 | 358 |
| 163 | 3300025915 | Ga0207693_10155916 | Ga0207693_101559162 | 358 |
| 164 | 3300025922 | Ga0207646_10000042 | Ga0207646_1000004288 | 358 |
| 165 | 3300025922 | Ga0207646_10000549 | Ga0207646_1000054942 | 358 |
| 166 | 3300025922 | Ga0207646_10110632 | Ga0207646_101106321 | 358 |
| 167 | 3300025928 | Ga0207700_10344638 | Ga0207700_103446381 | 358 |
| 168 | 3300025929 | Ga0207664_10047596 | Ga0207664_100475962 | 358 |
| 169 | 3300027671 | Ga0209588_1000292 | Ga0209588_10002926 | 358 |
| 170 | 3300046679 | Ga0495623_0062399 | Ga0495623_0062399_932_2122 | 358 |
| 171 | 3300047317 | Ga0495604_0063870 | Ga0495604_0063870_96_1286 | 358 |
| 172 | 3300047319 | Ga0495674_0059419 | Ga0495674_0059419_1231_2421 | 358 |
| 173 | 3300048905 | Ga0496102_0129015 | Ga0496102_0129015_62_1138 | 358 |
| 174 | 3300048909 | Ga0496106_0051200 | Ga0496106_0051200_1705_2781 | 358 |
| 175 | 3300005445 | Ga0070708_100204101 | Ga0070708_1002041012 | 359 |
| 176 | 3300025910 | Ga0207684_10075032 | Ga0207684_100750324 | 359 |
| 177 | 3300025922 | Ga0207646_10089589 | Ga0207646_100895894 | 359 |
| 178 | 3300000546 | LJNas_1000157 | LJNas_100015710 | 360 |
| 179 | 3300007265 | Ga0099794_10011929 | Ga0099794_100119293 | 360 |
| 180 | 3300025910 | Ga0207684_10058501 | Ga0207684_100585012 | 360 |
| 181 | 3300028800 | Ga0265338_10008544 | Ga0265338_100085442 | 360 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6b4c-assembly9.cif.gz_I | structure of viperin from trichoderma virens | 0.6934 | 26 | 241 |
| 8fsi-assembly1.cif.gz_A | the structure of a crystallizable variant of e. coli pyruvate formate-lyase activating enzyme bound to sam | 0.693 | 38 | 242 |
| 2yx0-assembly1.cif.gz_A | crystal structure of p. horikoshii tyw1 | 0.6899 | 82 | 233 |
| 3cb8-assembly1.cif.gz_A | 4fe-4s-pyruvate formate-lyase activating enzyme in complex with adomet and a peptide substrate | 0.6848 | 38 | 233 |
| 3eo3-assembly2.cif.gz_C-2 | crystal structure of the n-acetylmannosamine kinase domain of human gne protein | 0.6811 | 69 | 116 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4CKR7_277_480_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.836 | 84 | 119 | 3.20.20.70 |
| 3canA00 | Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;pyruvate-formate lyase- activating enzyme | 0.75 | 86 | 243 | 3.80.30.10 |
| 3canA00 | Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;pyruvate-formate lyase- activating enzyme | 0.7297 | 86 | 243 | 3.80.30.10 |
| af_A0A1D6PAR6_93_238_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.7272 | 71 | 114 | 3.40.50.620 |
| af_P95188_67_289_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.7249 | 27 | 207 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1SD14-F1-model_v4 | Radical SAM protein | 0.9876 | 13 | 332 |
GO:0003824
GO:0046872 GO:0051536 |
| AF-A0A2V8GMP1-F1-model_v4 | Radical SAM protein | 0.9806 | 91 | 332 |
|
| AF-A0A522TA29-F1-model_v4 | Radical SAM protein | 0.9777 | 11 | 331 |
GO:0003824
GO:0046872 GO:0051536 |
| AF-A0A2V9LAW0-F1-model_v4 | Radical SAM protein | 0.9765 | 11 | 226 |
GO:0003824
GO:0046872 GO:0051536 |
| AF-A0A7W1SD14-F1-model_v4 | Radical SAM protein | 0.9725 | 13 | 332 |
GO:0003824
GO:0046872 GO:0051536 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar