F277538

General Info

Members Datasets Scaffolds Average Seq Length
181 108 362 227

Family's Representative Sequence

Representative Sequence 3300026088|Ga0207641_10946134|Ga0207641_109461341
Length 251
Sequence MASVEVQNVVKVYRRDAEEVRVLDGLSLSIADGEFVALMGPSGSGKTTLLNLIGGIDQPTSGDLTVAGTNIARLKSNQLARWRSVSIGYIFQLYNLMPVLTALENVELPLLLVKMSGAERKQRATAALQLVGLGDRLKHYPRQLSGGQEQRAAIARALVSDPKVLLADEPTGDLDRKSAEDVLQLLDRLNKEYKKTIVMVTHDPHAAERASRRYQLDKGVLIEDRAWIARVAADVVDRDVDVPRTRRVGCS

Samples

Sample ID Description Type Environment
1 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
62 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
63 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
64 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
65 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
66 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
67 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
68 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
69 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
70 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
71 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
72 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
73 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
74 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
75 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
76 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
77 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
78 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
79 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
80 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
81 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
82 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
83 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
84 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
85 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
86 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
87 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
88 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
89 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
90 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
91 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
92 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
93 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
94 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
95 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
96 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
97 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
98 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
99 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
100 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
101 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
102 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
103 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
104 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
105 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
106 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
107 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
108 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207641_10946134 3300026088 Bacteria 857
2 Ga0070670_100024253 3300005331 Bacteria 5217
3 Ga0070680_100391964 3300005336 Bacteria 1183
4 Ga0070689_100006377 3300005340 Bacteria 8158
5 Ga0070687_100010860 3300005343 Bacteria 3960
6 Ga0070675_100013469 3300005354 Bacteria 6426
7 Ga0070673_100408552 3300005364 Bacteria 1215
8 Ga0070688_100024626 3300005365 Bacteria 3554
9 Ga0070701_10100594 3300005438 Bacteria 1600
10 Ga0070705_100058362 3300005440 Bacteria 2281
11 Ga0070705_100173852 3300005440 Bacteria 1452
12 Ga0070694_100018120 3300005444 Bacteria 4464
13 Ga0070708_100010160 3300005445 Bacteria 7619
14 Ga0070678_100690030 3300005456 Bacteria 919
15 Ga0070685_10000907 3300005466 Bacteria 15924
16 Ga0070685_10071822 3300005466 Bacteria 2053
17 Ga0070706_100211913 3300005467 Bacteria 1809
18 Ga0070707_100121166 3300005468 Bacteria 2540
19 Ga0070707_100220801 3300005468 Bacteria 1846
20 Ga0070698_100160875 3300005471 Bacteria 2189
21 Ga0070698_100250730 3300005471 Bacteria 1703
22 Ga0070698_100586578 3300005471 Bacteria 1055
23 Ga0070699_100314653 3300005518 Bacteria 1406
24 Ga0070686_100044674 3300005544 Bacteria 2786
25 Ga0070695_100003215 3300005545 Bacteria 9534
26 Ga0070704_100048923 3300005549 Bacteria 2962
27 Ga0070704_100185240 3300005549 Bacteria 1669
28 Ga0068857_100084239 3300005577 Bacteria 2841
29 Ga0068859_100005080 3300005617 Bacteria 13367
30 Ga0068859_100173209 3300005617 Bacteria 2240
31 Ga0068864_100121819 3300005618 Bacteria 2333
32 Ga0068864_100123618 3300005618 Bacteria 2316
33 Ga0068863_100083149 3300005841 Bacteria 3033
34 Ga0068863_100149597 3300005841 Bacteria 2234
35 Ga0068858_100452672 3300005842 Bacteria 1237
36 Ga0070715_10001835 3300006163 Bacteria 6345
37 Ga0075428_100012358 3300006844 Bacteria 9500
38 Ga0075428_100198766 3300006844 Bacteria 2168
39 Ga0075430_100187986 3300006846 Bacteria 1717
40 Ga0075433_10003119 3300006852 Bacteria 12763
41 Ga0075433_10018764 3300006852 Bacteria 5755
42 Ga0075433_10186306 3300006852 Bacteria 1847
43 Ga0075434_100005413 3300006871 Bacteria 11616
44 Ga0075434_100008746 3300006871 Bacteria 9420
45 Ga0075434_100038691 3300006871 Bacteria 4725
46 Ga0075434_100105356 3300006871 Bacteria 2830
47 Ga0075434_100118077 3300006871 Bacteria 2666
48 Ga0075434_100196484 3300006871 Bacteria 2037
49 Ga0075429_100003357 3300006880 Bacteria 13646
50 Ga0075429_100292193 3300006880 Bacteria 1427
51 Ga0075436_100013414 3300006914 Bacteria 5610
52 Ga0097620_100005080 3300006931 Bacteria 13367
53 Ga0097620_100173211 3300006931 Bacteria 2240
54 Ga0075435_100015612 3300007076 Bacteria 5713
55 Ga0075435_100073360 3300007076 Bacteria 2798
56 Ga0075435_100401927 3300007076 Bacteria 1178
57 Ga0111539_10003509 3300009094 Bacteria 20684
58 Ga0111539_10231810 3300009094 Bacteria 2150
59 Ga0111539_11011201 3300009094 Bacteria 966
60 Ga0114129_10025157 3300009147 Bacteria 8437
61 Ga0114129_10063908 3300009147 Bacteria 5136
62 Ga0114129_10067897 3300009147 Bacteria 4972
63 Ga0114129_10182327 3300009147 Bacteria 2856
64 Ga0105243_10680021 3300009148 Bacteria 1001
65 Ga0105248_10071398 3300009177 Bacteria 3900
66 Ga0105248_10859600 3300009177 Bacteria 1024
67 Ga0105249_10459535 3300009553 Bacteria 1313
68 Ga0163163_10046398 3300014325 Bacteria 4268
69 Ga0157380_10038617 3300014326 Bacteria 3708
70 Ga0157380_10212556 3300014326 Bacteria 1725
71 Ga0157380_10256035 3300014326 Bacteria 1587
72 Ga0157377_10514199 3300014745 Bacteria 839
73 Ga0157376_10797530 3300014969 Bacteria 957
74 Ga0207660_10293456 3300025917 Bacteria 1293
75 Ga0207662_10002509 3300025918 Bacteria 9227
76 Ga0207646_10116399 3300025922 Bacteria 2401
77 Ga0207650_10008275 3300025925 Bacteria 7101
78 Ga0207659_10028506 3300025926 Bacteria 3795
79 Ga0207686_10902243 3300025934 Bacteria 713
80 Ga0207670_10013515 3300025936 Bacteria 4818
81 Ga0207704_10421262 3300025938 Bacteria 1059
82 Ga0207665_10280656 3300025939 Bacteria 1239
83 Ga0207679_10199246 3300025945 Bacteria 1671
84 Ga0207703_10288916 3300026035 Bacteria 1491
85 Ga0207708_10147668 3300026075 Bacteria 1849
86 Ga0207708_10175135 3300026075 Bacteria 1701
87 Ga0207641_10022633 3300026088 Bacteria 5173
88 Ga0207676_10185780 3300026095 Bacteria 1824
89 Ga0207674_10113285 3300026116 Bacteria 2685
90 Ga0207675_100222573 3300026118 Bacteria 1818
91 Ga0207428_10000009 3300027907 Bacteria 410565
92 Ga0207428_10089376 3300027907 Bacteria 2394
93 Ga0265331_10048766 3300031250 Bacteria 2035
94 Ga0265316_10163431 3300031344 Bacteria 1664
95 Ga0265316_10232947 3300031344 Bacteria 1356
96 Ga0316575_10043192 3300031665 Bacteria 1786
97 Ga0316583_10172078 3300032133 Bacteria 754
98 Ga0373934_0018663 3300035086 Bacteria 2656
99 Ga0373934_0063811 3300035086 Bacteria 1469
100 Ga0373953_0015958 3300035117 Bacteria 2733
101 Ga0373954_0016351 3300035118 Bacteria 3320
102 Ga0373954_0205086 3300035118 Bacteria 969
103 Ga0373956_0166879 3300035119 Bacteria 1038
104 Ga0373957_0057439 3300035120 Bacteria 1501
105 Ga0373946_0021661 3300035171 Bacteria 2495
106 Ga0373955_0013657 3300035172 Bacteria 3934
107 Ga0373933_0013826 3300035724 Bacteria 4478
108 Ga0373947_0187246 3300035725 Bacteria 1350
109 Ga0373937_0005867 3300036401 Bacteria 10564
110 Ga0373937_0029282 3300036401 Bacteria 4986
111 Ga0316582_0043984 3300036647 Bacteria 2805
112 Ga0316584_0507378 3300036712 Bacteria 847
113 Ga0451577_0032764 3300042876 Bacteria 4683
114 Ga0451577_0044426 3300042876 Bacteria 3978
115 Ga0453684_0219720 3300044712 Bacteria 2202
116 Ga0453684_0321066 3300044712 Bacteria 1754
117 Ga0451576_0052014 3300045051 Bacteria 4292
118 Ga0451576_0075418 3300045051 Bacteria 3509
119 Ga0451576_0077409 3300045051 Bacteria 3461
120 Ga0451576_0111641 3300045051 Bacteria 2845
121 Ga0451576_0134269 3300045051 Bacteria 2580
122 Ga0451576_0157113 3300045051 Bacteria 2372
123 Ga0451576_0193331 3300045051 Bacteria 2125
124 Ga0451576_0888344 3300045051 Bacteria 935
125 Ga0451576_0963548 3300045051 Bacteria 894
126 Ga0495592_0052226 3300046454 Bacteria 3035
127 Ga0495592_0189311 3300046454 Bacteria 1396
128 Ga0495603_0104285 3300046455 Bacteria 1655
129 Ga0495651_0047672 3300046462 Bacteria 3311
130 Ga0495580_0000546 3300046472 Bacteria 31815
131 Ga0495580_0052977 3300046472 Bacteria 2865
132 Ga0495662_0083481 3300046476 Bacteria 1555
133 Ga0495584_0200032 3300046491 Bacteria 1016
134 Ga0495608_0011214 3300046511 Bacteria 6239
135 Ga0495618_0012126 3300046514 Bacteria 5232
136 Ga0495628_0001711 3300046516 Bacteria 19995
137 Ga0495628_0075385 3300046516 Bacteria 2627
138 Ga0495628_0134790 3300046516 Bacteria 1888
139 Ga0495630_0568962 3300046517 Bacteria 869
140 Ga0495586_0001817 3300046535 Bacteria 11639
141 Ga0495587_0023085 3300046536 Bacteria 3825
142 Ga0495667_0031393 3300046559 Bacteria 3566
143 Ga0495657_0036980 3300046675 Bacteria 3368
144 Ga0495599_0017919 3300046678 Bacteria 4410
145 Ga0495600_0035285 3300046809 Bacteria 3247
146 Ga0495600_0134596 3300046809 Bacteria 1606
147 Ga0495581_0139915 3300047315 Bacteria 1412
148 Ga0495680_0026017 3300047322 Bacteria 4832
149 Ga0495680_0032488 3300047322 Bacteria 4235
150 Ga0495680_0036067 3300047322 Bacteria 3975
151 Ga0495675_0028549 3300047444 Bacteria 3556
152 Ga0501073_0469012 3300049589 Bacteria 870
153 nmdc:mga05p37_170406_c1 3300050507 Bacteria 2655
154 nmdc:mga05p37_2093_c1 3300050507 Bacteria 23289
155 nmdc:mga05p37_308119_c1 3300050507 Bacteria 1878
156 nmdc:mga05p37_759727_c1 3300050507 Bacteria 1067
157 nmdc:mga05p37_94140_c1 3300050507 Bacteria 3691
158 nmdc:mga09592_144800_c1 3300050508 Bacteria 2049
159 nmdc:mga09592_378731_c1 3300050508 Bacteria 1224
160 nmdc:mga09592_404512_c1 3300050508 Bacteria 1180
161 nmdc:mga09592_699_c1 3300050508 Bacteria 25675
162 nmdc:mga0qj67_270381_c1 3300050509 Bacteria 1378
163 nmdc:mga08y16_17392_c1 3300050511 Bacteria 7570
164 nmdc:mga08y16_40_c1 3300050511 Bacteria 130773
165 nmdc:mga08y16_911992_c1 3300050511 Bacteria 864
166 nmdc:mga0n895_2769_c1 3300050512 Bacteria 13859
167 nmdc:mga0n895_382688_c1 3300050512 Bacteria 1424
168 nmdc:mga0n895_39117_c1 3300050512 Bacteria 4599
169 nmdc:mga0n895_632840_c1 3300050512 Bacteria 1070
170 nmdc:mga0n895_84773_c1 3300050512 Bacteria 3162
171 nmdc:mga0rr50_140748_c1 3300050513 Bacteria 1941
172 nmdc:mga0rr50_300428_c1 3300050513 Bacteria 1343
173 nmdc:mga0rr50_40448_c1 3300050513 Bacteria 3390
174 nmdc:mga0a205_1016_c1 3300050515 Bacteria 23328
175 nmdc:mga0a205_134026_c1 3300050515 Bacteria 2377
176 nmdc:mga0a205_17876_c1 3300050515 Bacteria 5765
177 nmdc:mga0a205_202162_c1 3300050515 Bacteria 1877
178 nmdc:mga0a205_216136_c1 3300050515 Bacteria 1804
179 nmdc:mga0a205_406769_c1 3300050515 Bacteria 1224
180 Ga0495595_0000628 3300053084 Bacteria 13440
181 Ga0495619_0044442 3300053085 Bacteria 2916
182 Ga0207641_10946134
183 Ga0070670_100024253
184 Ga0070680_100391964
185 Ga0070689_100006377
186 Ga0070687_100010860
187 Ga0070675_100013469
188 Ga0070673_100408552
189 Ga0070688_100024626
190 Ga0070701_10100594
191 Ga0070705_100058362
192 Ga0070705_100173852
193 Ga0070694_100018120
194 Ga0070708_100010160
195 Ga0070678_100690030
196 Ga0070685_10000907
197 Ga0070685_10071822
198 Ga0070706_100211913
199 Ga0070707_100121166
200 Ga0070707_100220801
201 Ga0070698_100160875
202 Ga0070698_100250730
203 Ga0070698_100586578
204 Ga0070699_100314653
205 Ga0070686_100044674
206 Ga0070695_100003215
207 Ga0070704_100048923
208 Ga0070704_100185240
209 Ga0068857_100084239
210 Ga0068859_100005080
211 Ga0068859_100173209
212 Ga0068864_100121819
213 Ga0068864_100123618
214 Ga0068863_100083149
215 Ga0068863_100149597
216 Ga0068858_100452672
217 Ga0070715_10001835
218 Ga0075428_100012358
219 Ga0075428_100198766
220 Ga0075430_100187986
221 Ga0075433_10003119
222 Ga0075433_10018764
223 Ga0075433_10186306
224 Ga0075434_100005413
225 Ga0075434_100008746
226 Ga0075434_100038691
227 Ga0075434_100105356
228 Ga0075434_100118077
229 Ga0075434_100196484
230 Ga0075429_100003357
231 Ga0075429_100292193
232 Ga0075436_100013414
233 Ga0097620_100005080
234 Ga0097620_100173211
235 Ga0075435_100015612
236 Ga0075435_100073360
237 Ga0075435_100401927
238 Ga0111539_10003509
239 Ga0111539_10231810
240 Ga0111539_11011201
241 Ga0114129_10025157
242 Ga0114129_10063908
243 Ga0114129_10067897
244 Ga0114129_10182327
245 Ga0105243_10680021
246 Ga0105248_10071398
247 Ga0105248_10859600
248 Ga0105249_10459535
249 Ga0163163_10046398
250 Ga0157380_10038617
251 Ga0157380_10212556
252 Ga0157380_10256035
253 Ga0157377_10514199
254 Ga0157376_10797530
255 Ga0207660_10293456
256 Ga0207662_10002509
257 Ga0207646_10116399
258 Ga0207650_10008275
259 Ga0207659_10028506
260 Ga0207686_10902243
261 Ga0207670_10013515
262 Ga0207704_10421262
263 Ga0207665_10280656
264 Ga0207679_10199246
265 Ga0207703_10288916
266 Ga0207708_10147668
267 Ga0207708_10175135
268 Ga0207641_10022633
269 Ga0207676_10185780
270 Ga0207674_10113285
271 Ga0207675_100222573
272 Ga0207428_10000009
273 Ga0207428_10089376
274 Ga0265331_10048766
275 Ga0265316_10163431
276 Ga0265316_10232947
277 Ga0316575_10043192
278 Ga0316583_10172078
279 Ga0373934_0018663
280 Ga0373934_0063811
281 Ga0373953_0015958
282 Ga0373954_0016351
283 Ga0373954_0205086
284 Ga0373956_0166879
285 Ga0373957_0057439
286 Ga0373946_0021661
287 Ga0373955_0013657
288 Ga0373933_0013826
289 Ga0373947_0187246
290 Ga0373937_0005867
291 Ga0373937_0029282
292 Ga0316582_0043984
293 Ga0316584_0507378
294 Ga0451577_0032764
295 Ga0451577_0044426
296 Ga0453684_0219720
297 Ga0453684_0321066
298 Ga0451576_0052014
299 Ga0451576_0075418
300 Ga0451576_0077409
301 Ga0451576_0111641
302 Ga0451576_0134269
303 Ga0451576_0157113
304 Ga0451576_0193331
305 Ga0451576_0888344
306 Ga0451576_0963548
307 Ga0495592_0052226
308 Ga0495592_0189311
309 Ga0495603_0104285
310 Ga0495651_0047672
311 Ga0495580_0000546
312 Ga0495580_0052977
313 Ga0495662_0083481
314 Ga0495584_0200032
315 Ga0495608_0011214
316 Ga0495618_0012126
317 Ga0495628_0001711
318 Ga0495628_0075385
319 Ga0495628_0134790
320 Ga0495630_0568962
321 Ga0495586_0001817
322 Ga0495587_0023085
323 Ga0495667_0031393
324 Ga0495657_0036980
325 Ga0495599_0017919
326 Ga0495600_0035285
327 Ga0495600_0134596
328 Ga0495581_0139915
329 Ga0495680_0026017
330 Ga0495680_0032488
331 Ga0495680_0036067
332 Ga0495675_0028549
333 Ga0501073_0469012
334 nmdc:mga05p37_170406_c1
335 nmdc:mga05p37_2093_c1
336 nmdc:mga05p37_308119_c1
337 nmdc:mga05p37_759727_c1
338 nmdc:mga05p37_94140_c1
339 nmdc:mga09592_144800_c1
340 nmdc:mga09592_378731_c1
341 nmdc:mga09592_404512_c1
342 nmdc:mga09592_699_c1
343 nmdc:mga0qj67_270381_c1
344 nmdc:mga08y16_17392_c1
345 nmdc:mga08y16_40_c1
346 nmdc:mga08y16_911992_c1
347 nmdc:mga0n895_2769_c1
348 nmdc:mga0n895_382688_c1
349 nmdc:mga0n895_39117_c1
350 nmdc:mga0n895_632840_c1
351 nmdc:mga0n895_84773_c1
352 nmdc:mga0rr50_140748_c1
353 nmdc:mga0rr50_300428_c1
354 nmdc:mga0rr50_40448_c1
355 nmdc:mga0a205_1016_c1
356 nmdc:mga0a205_134026_c1
357 nmdc:mga0a205_17876_c1
358 nmdc:mga0a205_202162_c1
359 nmdc:mga0a205_216136_c1
360 nmdc:mga0a205_406769_c1
361 Ga0495595_0000628
362 Ga0495619_0044442

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

23

172

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9783 4 223
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9741 4 223
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9738 4 223
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.9699 4 223
5ws4-assembly1.cif.gz_B crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii 0.9686 1 223
ID Description Score Start End Superfamily
af_P75957_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9758 4 224 3.40.50.300
af_Q8T665_1_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.974 4 223 3.40.50.300
af_Q2FUZ1_1_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9739 4 223 3.40.50.300
af_A4I4M8_123_401_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9707 28 223 3.40.50.300
2pclA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9702 4 223 3.40.50.300
ID Description Score Start End GO Terms
AF-H8FG51-F1-model_v4 deleted 0.9903 1 205
AF-R6CP31-F1-model_v4 deleted 0.9809 1 223
AF-A0A089I4Y8-F1-model_v4 ABC transporter ATP-binding protein 0.9796 4 223 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A7X6XIY9-F1-model_v4 ABC transporter ATP-binding protein 0.9795 1 223 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A812XZS2-F1-model_v4 MacB protein 0.9789 2 222 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0046677

Map