F277153

General Info

Members Datasets Scaffolds Average Seq Length
181 107 362 182

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100194423|Ga0075428_1001944232
Length 208
Sequence MSRQADRRLTKQDTLLIEDIRTTTLEATRRLSDLHPLVAAVRAAVGKRADWPETARLVAAELERHLPSPEVLTEQERAGNPTRYVSHVLHTEPDGAFSILALVWQPGQTTPIHDHLTWCVFGVIQGTEYEELFVLDEANECLLEAASNVNETGDVSGFAPPGDIHRVRNMGEHTAISIHVYGTDVTRVGSSVRRYYELPVRAVEQAVS

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
6 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
7 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
8 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
9 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
10 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
12 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
13 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
15 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
16 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
17 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
18 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
19 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
20 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
26 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
27 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
28 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
29 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
30 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
44 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
45 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
46 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
47 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
48 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
49 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
50 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
51 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
52 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
53 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
54 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
55 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
56 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
57 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
58 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
59 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
60 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
61 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
62 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
63 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
64 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
65 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
66 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
67 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
68 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
69 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
70 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
71 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
72 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
73 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
74 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
75 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
76 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
77 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
89 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
90 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
91 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
92 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
93 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
94 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
95 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
96 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
97 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
98 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
99 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
100 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
101 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
102 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
103 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
104 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
105 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
106 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
107 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.13
Metatranscriptomes 1.66
Isolates 2.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.1
Nodule 0
Rhizoplane 0.55
Rhizosphere 94.48
Stem 0
Stem Tuber 0
Unclassified 2.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100194423 3300006844 Bacteria 2194
2 JGI25407J50210_10012794 3300003373 Bacteria 2152
3 Ga0070683_100101600 3300005329 Bacteria 2708
4 Ga0070661_100571018 3300005344 Bacteria 912
5 Ga0070679_100269720 3300005530 Bacteria 1656
6 Ga0070664_100068678 3300005564 Bacteria 3030
7 Ga0070664_100303230 3300005564 Bacteria 1444
8 Ga0068856_100052350 3300005614 Bacteria 4025
9 Ga0070702_100308580 3300005615 Bacteria 1098
10 Ga0070702_100418812 3300005615 Bacteria 963
11 Ga0068861_100590609 3300005719 Bacteria 1018
12 Ga0081455_10005866 3300005937 Bacteria 13352
13 Ga0081455_10008340 3300005937 Bacteria 10791
14 Ga0081455_10009245 3300005937 Bacteria 10155
15 Ga0081455_10042268 3300005937 Bacteria 4000
16 Ga0081455_10056664 3300005937 Bacteria 3326
17 Ga0081455_10061611 3300005937 Bacteria 3156
18 Ga0081538_10000063 3300005981 Bacteria 99624
19 Ga0081538_10000065 3300005981 Bacteria 98948
20 Ga0081538_10001214 3300005981 Bacteria 27055
21 Ga0081538_10002807 3300005981 Bacteria 16684
22 Ga0081538_10005135 3300005981 Bacteria 11872
23 Ga0081538_10008641 3300005981 Bacteria 8612
24 Ga0081538_10010716 3300005981 Bacteria 7502
25 Ga0081538_10027399 3300005981 Bacteria 3951
26 Ga0081538_10152310 3300005981 Bacteria 1044
27 Ga0081538_10204836 3300005981 Bacteria 805
28 Ga0081540_1065756 3300005983 Bacteria 1703
29 Ga0081539_10004861 3300005985 Bacteria 14369
30 Ga0070717_10023037 3300006028 Bacteria 4928
31 Ga0070712_100598517 3300006175 Bacteria 933
32 Ga0075362_10132074 3300006177 Bacteria 1188
33 Ga0075428_101407691 3300006844 Bacteria 732
34 Ga0075430_100009609 3300006846 Bacteria 8175
35 Ga0075430_100055690 3300006846 Bacteria 3325
36 Ga0075430_100069419 3300006846 Bacteria 2956
37 Ga0075431_100124470 3300006847 Bacteria 2660
38 Ga0075429_100092170 3300006880 Bacteria 2643
39 Ga0111539_10015830 3300009094 Bacteria 9368
40 Ga0105247_10178608 3300009101 Bacteria 1415
41 Ga0114129_10045040 3300009147 Bacteria 6203
42 Ga0114129_10631467 3300009147 Bacteria 1384
43 Ga0114129_12039219 3300009147 Bacteria 693
44 Ga0105243_10648028 3300009148 Bacteria 1023
45 Ga0105239_10384329 3300010375 Bacteria 1587
46 Ga0157374_10077609 3300013296 Bacteria 3144
47 Ga0163162_11656588 3300013306 Bacteria 730
48 Ga0157380_10601860 3300014326 Bacteria 1088
49 Ga0182008_10200259 3300014497 Bacteria 1016
50 Ga0206350_10629074 3300020080 Bacteria 678
51 Ga0224712_10194060 3300022467 Bacteria 920
52 Ga0224712_10286475 3300022467 Bacteria 768
53 Ga0207656_10307215 3300025321 Bacteria 786
54 Ga0207692_10041940 3300025898 Bacteria 2269
55 Ga0207705_10478053 3300025909 Bacteria 967
56 Ga0207705_10766920 3300025909 Bacteria 749
57 Ga0207684_10047558 3300025910 Bacteria 3637
58 Ga0207652_10296650 3300025921 Bacteria 1459
59 Ga0207661_10161904 3300025944 Bacteria 1942
60 Ga0207679_10354611 3300025945 Bacteria 1280
61 Ga0207640_10525537 3300025981 Bacteria 990
62 Ga0207677_10593922 3300026023 Bacteria 971
63 Ga0207677_11428132 3300026023 Bacteria 638
64 Ga0207702_10036713 3300026078 Bacteria 4099
65 Ga0207675_100240991 3300026118 Bacteria 1747
66 Ga0207698_11062583 3300026142 Bacteria 822
67 Ga0207428_10129993 3300027907 Bacteria 1928
68 Ga0307413_10718485 3300031824 Bacteria 832
69 Ga0307406_10215991 3300031901 Bacteria 1422
70 Ga0307407_10052799 3300031903 Bacteria 2336
71 Ga0307409_100171439 3300031995 Bacteria 1910
72 Ga0307409_100551197 3300031995 Bacteria 1132
73 Ga0307409_100715955 3300031995 Bacteria 1002
74 Ga0307416_100060665 3300032002 Bacteria 3082
75 Ga0307411_10139646 3300032005 Bacteria 1785
76 Ga0307415_100211786 3300032126 Bacteria 1547
77 Ga0307415_100693416 3300032126 Bacteria 918
78 Ga0395899_0008218 3300037312 Bacteria 8040
79 Ga0395899_0009721 3300037312 Bacteria 7381
80 Ga0395899_0033714 3300037312 Bacteria 3846
81 Ga0395899_0045015 3300037312 Bacteria 3287
82 Ga0395900_0001454 3300037418 Bacteria 28237
83 Ga0395900_0014413 3300037418 Bacteria 8068
84 Ga0395900_0015596 3300037418 Bacteria 7745
85 Ga0395900_0026259 3300037418 Bacteria 5964
86 Ga0395900_0046819 3300037418 Bacteria 4453
87 Ga0395900_0171037 3300037418 Bacteria 2212
88 Ga0395898_0003155 3300037466 Bacteria 18612
89 Ga0395898_0011885 3300037466 Bacteria 9014
90 Ga0395898_0044771 3300037466 Bacteria 4353
91 Ga0395898_0107938 3300037466 Unclassified 2669
92 Ga0395898_0127582 3300037466 Bacteria 2437
93 Ga0395898_0239561 3300037466 Bacteria 1730
94 Ga0395898_0316387 3300037466 Bacteria 1489
95 Ga0395898_1025572 3300037466 Bacteria 760
96 Ga0395905_0011663 3300037471 Bacteria 8486
97 Ga0395905_0025005 3300037471 Bacteria 5632
98 Ga0395905_0077245 3300037471 Bacteria 3120
99 Ga0395905_0181295 3300037471 Bacteria 1977
100 Ga0436364_0658298 3300037853 Bacteria 2516
101 Ga0436364_0728303 3300037853 Bacteria 1853
102 Ga0395901_0003673 3300038443 Bacteria 15473
103 Ga0395901_0004541 3300038443 Bacteria 14004
104 Ga0395901_0010771 3300038443 Bacteria 9270
105 Ga0395901_0027512 3300038443 Bacteria 5843
106 Ga0395901_0032948 3300038443 Bacteria 5345
107 Ga0395901_0065644 3300038443 Bacteria 3779
108 Ga0395901_0089544 3300038443 Bacteria 3220
109 Ga0451841_0782089 3300041498 Bacteria 618
110 Ga0451853_0684613 3300041512 Bacteria 972
111 Ga0466969_0221810 3300044656 Bacteria 860
112 Ga0466972_0188543 3300044658 Bacteria 967
113 Ga0466966_0127455 3300044684 Bacteria 1560
114 Ga0466963_0074030 3300044694 Bacteria 2297
115 Ga0466963_0296859 3300044694 Bacteria 1136
116 Ga0466968_0493145 3300044735 Bacteria 609
117 Ga0466967_0032037 3300045976 Bacteria 4434
118 Ga0466967_0046938 3300045976 Bacteria 3764
119 Ga0466967_0075826 3300045976 Bacteria 3023
120 Ga0466967_0397700 3300045976 Bacteria 1340
121 Ga0466967_0549176 3300045976 Bacteria 1137
122 Ga0466967_0835022 3300045976 Bacteria 915
123 Ga0495629_0207702 3300046459 Unclassified 1353
124 Ga0495582_0123497 3300046473 Bacteria 1460
125 Ga0495594_0185193 3300046499 Unclassified 1186
126 Ga0495665_0003932 3300046531 Bacteria 8037
127 Ga0495645_0103424 3300046543 Bacteria 2023
128 Ga0495667_0008361 3300046559 Bacteria 7022
129 Ga0495657_0035661 3300046675 Bacteria 3445
130 Ga0495623_0297131 3300046679 Unclassified 894
131 Ga0495604_0169662 3300047317 Bacteria 1536
132 Ga0495680_0080890 3300047322 Bacteria 2454
133 Ga0495675_0158146 3300047444 Bacteria 1396
134 Ga0496102_0612941 3300048905 Bacteria 1012
135 Ga0501031_0134281 3300049568 Bacteria 1616
136 Ga0501031_0356811 3300049568 Bacteria 946
137 Ga0501034_0002341 3300049571 Bacteria 23127
138 Ga0501036_0084982 3300049572 Bacteria 2675
139 Ga0501037_0011686 3300049573 Bacteria 6463
140 Ga0501038_0003974 3300049574 Bacteria 13736
141 Ga0501038_0185810 3300049574 Bacteria 1675
142 Ga0501038_0377923 3300049574 Bacteria 1099
143 Ga0501039_0425364 3300049575 Bacteria 1043
144 Ga0501040_0220114 3300049576 Bacteria 1350
145 Ga0501042_0001551 3300049578 Bacteria 13598
146 Ga0501042_0531394 3300049578 Bacteria 854
147 Ga0501043_0001727 3300049579 Bacteria 18879
148 Ga0501043_0427299 3300049579 Bacteria 998
149 Ga0501046_0167293 3300049580 Bacteria 1651
150 Ga0501048_0001640 3300049582 Bacteria 17048
151 Ga0501048_0027136 3300049582 Bacteria 4165
152 Ga0501072_0159296 3300049588 Bacteria 1800
153 Ga0501074_0301623 3300049590 Bacteria 1138
154 Ga0501075_0163069 3300049591 Bacteria 1701
155 Ga0501075_0612397 3300049591 Bacteria 830
156 Ga0501076_0006544 3300049592 Bacteria 8454
157 Ga0501077_0010951 3300049593 Bacteria 5654
158 Ga0501079_0035419 3300049741 Bacteria 3842
159 Ga0501079_0768938 3300049741 Bacteria 758
160 Ga0501045_0161344 3300049824 Bacteria 1669
161 Ga0501045_0163628 3300049824 Bacteria 1656
162 nmdc:mga00v17_101327_c1 3300050491 Bacteria 1818
163 nmdc:mga05p37_75529_c1 3300050507 Bacteria 4148
164 nmdc:mga09592_1046304_c1 3300050508 Bacteria 680
165 nmdc:mga09592_143509_c1 3300050508 Bacteria 2059
166 nmdc:mga09592_74713_c1 3300050508 Bacteria 2880
167 nmdc:mga0qj67_1402_c1 3300050509 Bacteria 16879
168 nmdc:mga0qj67_32253_c1 3300050509 Bacteria 4084
169 nmdc:mga06r32_13760_c1 3300050510 Bacteria 7339
170 nmdc:mga06r32_539844_c1 3300050510 Bacteria 1141
171 nmdc:mga08y16_29954_c1 3300050511 Bacteria 5731
172 Ga0501084_0119477 3300054114 Bacteria 2215
173 Ga0501084_0129464 3300054114 Bacteria 2124
174 Ga0501082_0024089 3300060353 Bacteria 5250
175 Ga0501082_0456852 3300060353 Bacteria 1116
176 Ga0530510_0016088 3300061734 Bacteria 5288
177 Ga0530510_0337862 3300061734 Bacteria 1130
178 2676489522 2675903060 Bacteria 10051191
179 2884695302 2884693830 Bacteria 11273186
180 2895436988 2895427314 Bacteria 13147766
181 2895445990 2895442618 Bacteria 11027144
182 Ga0075428_100194423
183 JGI25407J50210_10012794
184 Ga0070683_100101600
185 Ga0070661_100571018
186 Ga0070679_100269720
187 Ga0070664_100068678
188 Ga0070664_100303230
189 Ga0068856_100052350
190 Ga0070702_100308580
191 Ga0070702_100418812
192 Ga0068861_100590609
193 Ga0081455_10005866
194 Ga0081455_10008340
195 Ga0081455_10009245
196 Ga0081455_10042268
197 Ga0081455_10056664
198 Ga0081455_10061611
199 Ga0081538_10000063
200 Ga0081538_10000065
201 Ga0081538_10001214
202 Ga0081538_10002807
203 Ga0081538_10005135
204 Ga0081538_10008641
205 Ga0081538_10010716
206 Ga0081538_10027399
207 Ga0081538_10152310
208 Ga0081538_10204836
209 Ga0081540_1065756
210 Ga0081539_10004861
211 Ga0070717_10023037
212 Ga0070712_100598517
213 Ga0075362_10132074
214 Ga0075428_101407691
215 Ga0075430_100009609
216 Ga0075430_100055690
217 Ga0075430_100069419
218 Ga0075431_100124470
219 Ga0075429_100092170
220 Ga0111539_10015830
221 Ga0105247_10178608
222 Ga0114129_10045040
223 Ga0114129_10631467
224 Ga0114129_12039219
225 Ga0105243_10648028
226 Ga0105239_10384329
227 Ga0157374_10077609
228 Ga0163162_11656588
229 Ga0157380_10601860
230 Ga0182008_10200259
231 Ga0206350_10629074
232 Ga0224712_10194060
233 Ga0224712_10286475
234 Ga0207656_10307215
235 Ga0207692_10041940
236 Ga0207705_10478053
237 Ga0207705_10766920
238 Ga0207684_10047558
239 Ga0207652_10296650
240 Ga0207661_10161904
241 Ga0207679_10354611
242 Ga0207640_10525537
243 Ga0207677_10593922
244 Ga0207677_11428132
245 Ga0207702_10036713
246 Ga0207675_100240991
247 Ga0207698_11062583
248 Ga0207428_10129993
249 Ga0307413_10718485
250 Ga0307406_10215991
251 Ga0307407_10052799
252 Ga0307409_100171439
253 Ga0307409_100551197
254 Ga0307409_100715955
255 Ga0307416_100060665
256 Ga0307411_10139646
257 Ga0307415_100211786
258 Ga0307415_100693416
259 Ga0395899_0008218
260 Ga0395899_0009721
261 Ga0395899_0033714
262 Ga0395899_0045015
263 Ga0395900_0001454
264 Ga0395900_0014413
265 Ga0395900_0015596
266 Ga0395900_0026259
267 Ga0395900_0046819
268 Ga0395900_0171037
269 Ga0395898_0003155
270 Ga0395898_0011885
271 Ga0395898_0044771
272 Ga0395898_0107938
273 Ga0395898_0127582
274 Ga0395898_0239561
275 Ga0395898_0316387
276 Ga0395898_1025572
277 Ga0395905_0011663
278 Ga0395905_0025005
279 Ga0395905_0077245
280 Ga0395905_0181295
281 Ga0436364_0658298
282 Ga0436364_0728303
283 Ga0395901_0003673
284 Ga0395901_0004541
285 Ga0395901_0010771
286 Ga0395901_0027512
287 Ga0395901_0032948
288 Ga0395901_0065644
289 Ga0395901_0089544
290 Ga0451841_0782089
291 Ga0451853_0684613
292 Ga0466969_0221810
293 Ga0466972_0188543
294 Ga0466966_0127455
295 Ga0466963_0074030
296 Ga0466963_0296859
297 Ga0466968_0493145
298 Ga0466967_0032037
299 Ga0466967_0046938
300 Ga0466967_0075826
301 Ga0466967_0397700
302 Ga0466967_0549176
303 Ga0466967_0835022
304 Ga0495629_0207702
305 Ga0495582_0123497
306 Ga0495594_0185193
307 Ga0495665_0003932
308 Ga0495645_0103424
309 Ga0495667_0008361
310 Ga0495657_0035661
311 Ga0495623_0297131
312 Ga0495604_0169662
313 Ga0495680_0080890
314 Ga0495675_0158146
315 Ga0496102_0612941
316 Ga0501031_0134281
317 Ga0501031_0356811
318 Ga0501034_0002341
319 Ga0501036_0084982
320 Ga0501037_0011686
321 Ga0501038_0003974
322 Ga0501038_0185810
323 Ga0501038_0377923
324 Ga0501039_0425364
325 Ga0501040_0220114
326 Ga0501042_0001551
327 Ga0501042_0531394
328 Ga0501043_0001727
329 Ga0501043_0427299
330 Ga0501046_0167293
331 Ga0501048_0001640
332 Ga0501048_0027136
333 Ga0501072_0159296
334 Ga0501074_0301623
335 Ga0501075_0163069
336 Ga0501075_0612397
337 Ga0501076_0006544
338 Ga0501077_0010951
339 Ga0501079_0035419
340 Ga0501079_0768938
341 Ga0501045_0161344
342 Ga0501045_0163628
343 nmdc:mga00v17_101327_c1
344 nmdc:mga05p37_75529_c1
345 nmdc:mga09592_1046304_c1
346 nmdc:mga09592_143509_c1
347 nmdc:mga09592_74713_c1
348 nmdc:mga0qj67_1402_c1
349 nmdc:mga0qj67_32253_c1
350 nmdc:mga06r32_13760_c1
351 nmdc:mga06r32_539844_c1
352 nmdc:mga08y16_29954_c1
353 Ga0501084_0119477
354 Ga0501084_0129464
355 Ga0501082_0024089
356 Ga0501082_0456852
357 Ga0530510_0016088
358 Ga0530510_0337862
359 2676489522
360 2884695302
361 2895436988
362 2895445990

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05995

CDO_I

Cysteine dioxygenase type I

79

194

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wvz-assembly2.cif.gz_B crystal structure of artificial crosslinked thiol dioxygenase g95c variant from pseudomonas aeruginosa 0.9265 25 178
4tlf-assembly2.cif.gz_B crystal structure of thiol dioxygenase from pseudomonas aeruginosa 0.9243 25 176
7kov-assembly1.cif.gz_B crystal structure of azotobacter vinelandii 3-mercaptopropionic acid dioxygenase in complex with thiocyanate 0.9184 25 176
6xb9-assembly1.cif.gz_F-2 crystal structure of azotobacter vinelandii 3-mercaptopropionic acid dioxygenase in complex with 3-hydroxypropionic acid 0.9017 25 176
2ea7-assembly1.cif.gz_B crystal structure of adzuki bean 7s globulin-1 0.8788 88 176
ID Description Score Start End Superfamily
4qmaA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8994 65 178 2.60.120.10
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8595 78 174 2.60.120.10
af_Q9LUJ7_61_262_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8561 88 176 2.60.120.10
5zbfA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8551 73 175 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8525 76 176 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A543CN50-F1-model_v4 Cysteine dioxygenase type I 0.9803 30 194 GO:0008198
GO:0016702
AF-A0A4V3FJT7-F1-model_v4 Putative metal-dependent enzyme (Double-stranded beta helix superfamily) 0.9749 30 190 GO:0008198
GO:0016702
AF-A0A6P2BPR5-F1-model_v4 Cysteine dioxygenase 0.9743 30 194 GO:0008198
GO:0016702
AF-A0A6F8YIS1-F1-model_v4 Cysteine dioxygenase 0.9719 30 190 GO:0008198
GO:0016702
AF-A0A6N7IJ79-F1-model_v4 Cysteine dioxygenase 0.9695 28 190 GO:0008198
GO:0016702

Map