F277104

General Info

Members Datasets Scaffolds Average Seq Length
181 137 362 375

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10020156|Ga0081539_100201564
Length 406
Sequence VTSTRSATSRDSIAERLEEARHRTLQLIEPLSDEQLNRVYSPPLSPLIWDLGHIANFEELWLVQTVGGREPLREDLGRFYDAIENPRRTRGELPILGAGEVRSYLEAVRERALEVLDGVDLDRAGDPLLDAGFVYEMLIAHEHQHTETMLQLLQMIERYEPVEVDPRPAAEPVVEGPEMVFVEAGESEVGAAPLGFAYDNERPRHSVELEGFWIDRTPVTNEAYLRFIEETGADPPMYWERDGAGGWLRAAMGRPEPIDPRQPVVHVSWYEAEAFAGWAGKRLPSEPEWEVACAGADPTRANLDQLAFGTAAAGAYADRPADCGAVQMLGDVWEWTSSDFEPYPGFEPFXYPEYSQVFFGDGYKVLRGGAWATRRAVIRPSFRNWDLPQRRQLFAGLRCAKDALSR

Samples

Sample ID Description Type Environment
1 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
65 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
66 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
67 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
70 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
71 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
72 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
73 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
74 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
75 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
76 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
77 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
78 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
79 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
80 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
81 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
82 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
83 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
84 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
85 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
86 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
87 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
88 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
89 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
90 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
91 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
92 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
93 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
94 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
95 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
96 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
97 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
98 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
99 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
100 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
101 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
102 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
103 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
104 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
105 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
106 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
107 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
108 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
109 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
110 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
111 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
112 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
113 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
114 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
115 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
119 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
120 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
121 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
122 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
123 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
124 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
127 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
128 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
133 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
134 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
135 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
136 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
137 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.87
Nodule 0
Rhizoplane 11.6
Rhizosphere 77.9
Stem 0
Stem Tuber 0
Unclassified 0.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081539_10020156 3300005985 Bacteria 4524
2 JGI24740J21852_10018423 3300001979 Bacteria 2476
3 Ga0070677_10000001 3300005333 Bacteria 118426
4 Ga0068868_100001902 3300005338 Bacteria 14340
5 Ga0068868_100033512 3300005338 Bacteria 3959
6 Ga0070691_10000054 3300005341 Bacteria 32149
7 Ga0070669_100142027 3300005353 Bacteria 1852
8 Ga0070674_100000025 3300005356 Bacteria 78679
9 Ga0070673_100008516 3300005364 Bacteria 6823
10 Ga0070711_100003626 3300005439 Bacteria 9019
11 Ga0070678_100055704 3300005456 Bacteria 2888
12 Ga0070681_10006943 3300005458 Bacteria 11021
13 Ga0068867_100006377 3300005459 Bacteria 8340
14 Ga0070679_100001155 3300005530 Bacteria 23125
15 Ga0070693_100005662 3300005547 Bacteria 6028
16 Ga0070665_100000202 3300005548 Bacteria 104773
17 Ga0068854_100015861 3300005578 Bacteria 5007
18 Ga0068856_100041544 3300005614 Bacteria 4520
19 Ga0068866_10000001 3300005718 Bacteria 519680
20 Ga0068858_100214193 3300005842 Bacteria 1823
21 Ga0081455_10013080 3300005937 Bacteria 8226
22 Ga0081538_10036690 3300005981 Bacteria 3194
23 Ga0081540_1000006 3300005983 Bacteria 208724
24 Ga0081540_1013796 3300005983 Bacteria 5229
25 Ga0075365_10033614 3300006038 Bacteria 3306
26 Ga0075364_10030683 3300006051 Bacteria 3451
27 Ga0075364_10031231 3300006051 Bacteria 3422
28 Ga0070716_100043996 3300006173 Bacteria 2500
29 Ga0070712_100008911 3300006175 Bacteria 6320
30 Ga0075428_100113600 3300006844 Bacteria 2951
31 Ga0075430_100031167 3300006846 Bacteria 4526
32 Ga0075430_100046647 3300006846 Bacteria 3659
33 Ga0075431_100009458 3300006847 Bacteria 9785
34 Ga0075431_100195114 3300006847 Bacteria 2073
35 Ga0075434_100119723 3300006871 Bacteria 2647
36 Ga0075434_100219394 3300006871 Unclassified 1921
37 Ga0075436_100109973 3300006914 Bacteria 1923
38 Ga0111539_10113689 3300009094 Bacteria 3175
39 Ga0105245_10000969 3300009098 Bacteria 26182
40 Ga0105245_10023677 3300009098 Bacteria 5390
41 Ga0105247_10006057 3300009101 Bacteria 7523
42 Ga0114129_10008931 3300009147 Bacteria 14282
43 Ga0114129_10159562 3300009147 Bacteria 3082
44 Ga0105242_10000357 3300009176 Bacteria 36537
45 Ga0105242_10074867 3300009176 Bacteria 2818
46 Ga0105242_10124799 3300009176 Bacteria 2214
47 Ga0105238_10000023 3300009551 Bacteria 196844
48 Ga0105249_10000074 3300009553 Bacteria 145235
49 Ga0105249_10333298 3300009553 Bacteria 1532
50 Ga0105239_10058639 3300010375 Bacteria 4224
51 Ga0157378_10014394 3300013297 Bacteria 6925
52 Ga0157375_10062234 3300013308 Bacteria 3708
53 Ga0157379_10024847 3300014968 Bacteria 5318
54 Ga0207682_10000053 3300025893 Bacteria 49064
55 Ga0207642_10000006 3300025899 Bacteria 230268
56 Ga0207642_10000007 3300025899 Bacteria 226017
57 Ga0207710_10000580 3300025900 Bacteria 21659
58 Ga0207707_10022186 3300025912 Bacteria 5550
59 Ga0207693_10028590 3300025915 Bacteria 4406
60 Ga0207663_10043065 3300025916 Bacteria 2762
61 Ga0207652_10000549 3300025921 Bacteria 38051
62 Ga0207681_10127881 3300025923 Bacteria 1874
63 Ga0207694_10000004 3300025924 Bacteria 967075
64 Ga0207687_10000055 3300025927 Bacteria 88382
65 Ga0207690_10096122 3300025932 Bacteria 2106
66 Ga0207669_10000009 3300025937 Bacteria 168012
67 Ga0207665_10091480 3300025939 Bacteria 2109
68 Ga0207651_10005135 3300025960 Bacteria 6684
69 Ga0207712_10000007 3300025961 Bacteria 539589
70 Ga0207640_10010681 3300025981 Bacteria 5180
71 Ga0207677_10003454 3300026023 Bacteria 8372
72 Ga0207702_10002500 3300026078 Bacteria 17354
73 Ga0207648_10000931 3300026089 Bacteria 32948
74 Ga0207428_10028375 3300027907 Bacteria 4650
75 Ga0268266_10000020 3300028379 Bacteria 527065
76 Ga0316574_0099882 3300035398 Bacteria 1857
77 Ga0395900_0150307 3300037418 Bacteria 2379
78 Ga0395900_0378691 3300037418 Bacteria 1384
79 Ga0395898_0005525 3300037466 Bacteria 13644
80 Ga0395898_0038264 3300037466 Bacteria 4755
81 Ga0395905_0088183 3300037471 Bacteria 2908
82 Ga0395901_0013150 3300038443 Bacteria 8403
83 Ga0395901_0029010 3300038443 Bacteria 5692
84 Ga0495592_0000109 3300046454 Bacteria 72116
85 Ga0495603_0000023 3300046455 Bacteria 63559
86 Ga0495641_0000003 3300046461 Bacteria 242879
87 Ga0495653_0098508 3300046463 Bacteria 2123
88 Ga0495582_0000027 3300046473 Bacteria 79970
89 Ga0495662_0000131 3300046476 Bacteria 28301
90 Ga0495594_0000013 3300046499 Bacteria 103201
91 Ga0495596_0027833 3300046500 Bacteria 2271
92 Ga0495618_0000004 3300046514 Bacteria 245690
93 Ga0495620_0017067 3300046515 Bacteria 3628
94 Ga0495628_0001939 3300046516 Bacteria 18762
95 Ga0495628_0117748 3300046516 Bacteria 2040
96 Ga0495630_0001847 3300046517 Bacteria 14783
97 Ga0495644_0012318 3300046523 Bacteria 3289
98 Ga0495652_0144440 3300046529 Bacteria 1867
99 Ga0495587_0013678 3300046536 Bacteria 5097
100 Ga0495622_0000014 3300046557 Bacteria 182142
101 Ga0495633_0098801 3300046558 Bacteria 1355
102 Ga0495634_0022881 3300046642 Bacteria 4400
103 Ga0495635_0000042 3300046663 Bacteria 84550
104 Ga0495635_0011459 3300046663 Bacteria 6217
105 Ga0495635_0042966 3300046663 Bacteria 3120
106 Ga0495658_0000025 3300046683 Bacteria 79910
107 Ga0495624_0021236 3300046690 Bacteria 4308
108 Ga0495600_0002045 3300046809 Bacteria 11363
109 Ga0495604_0000038 3300047317 Bacteria 123703
110 Ga0495676_0081022 3300047321 Bacteria 2462
111 Ga0495680_0000196 3300047322 Bacteria 65437
112 Ga0495680_0077734 3300047322 Bacteria 2513
113 Ga0496100_0016259 3300048903 Bacteria 4364
114 Ga0496102_0017079 3300048905 Bacteria 6351
115 Ga0496102_0380166 3300048905 Bacteria 1329
116 Ga0496103_0007810 3300048906 Bacteria 6357
117 Ga0496104_0000002 3300048907 Bacteria 686017
118 Ga0496104_0000013 3300048907 Bacteria 397163
119 Ga0496104_0063844 3300048907 Bacteria 3493
120 Ga0496105_0000001 3300048908 Bacteria 1328178
121 Ga0496105_0000006 3300048908 Bacteria 393578
122 Ga0496105_0012858 3300048908 Bacteria 6635
123 Ga0496106_0020776 3300048909 Bacteria 4872
124 Ga0496107_0297625 3300048910 Bacteria 1201
125 Ga0496108_0063640 3300048911 Bacteria 3106
126 Ga0496109_0205557 3300048912 Bacteria 1851
127 Ga0496109_0293474 3300048912 Bacteria 1533
128 Ga0496110_0078173 3300048913 Bacteria 2945
129 Ga0496111_0020281 3300048914 Bacteria 4626
130 Ga0496111_0076637 3300048914 Bacteria 2437
131 Ga0496113_0020486 3300048916 Bacteria 4650
132 Ga0496115_0000020 3300048918 Bacteria 171995
133 Ga0496115_0022817 3300048918 Bacteria 4852
134 Ga0496116_0000819 3300048919 Bacteria 39388
135 Ga0496117_0088964 3300048920 Bacteria 1996
136 Ga0496118_0055537 3300048921 Bacteria 2987
137 Ga0496119_0010882 3300048922 Bacteria 7603
138 Ga0496119_0013464 3300048922 Bacteria 6511
139 Ga0496119_0022882 3300048922 Bacteria 4453
140 Ga0496120_0001229 3300048923 Bacteria 32395
141 Ga0496121_0008178 3300048924 Bacteria 12420
142 Ga0496121_0148263 3300048924 Bacteria 1730
143 Ga0496125_0031981 3300048928 Bacteria 4680
144 Ga0496126_0009557 3300048929 Bacteria 10288
145 Ga0496126_0071434 3300048929 Bacteria 3089
146 Ga0501036_0208308 3300049572 Bacteria 1643
147 Ga0501041_0055622 3300049577 Bacteria 2416
148 Ga0501047_0138021 3300049581 Bacteria 2318
149 Ga0501047_0210720 3300049581 Bacteria 1802
150 Ga0501068_0054008 3300049584 Bacteria 2434
151 Ga0501071_0047365 3300049587 Bacteria 3088
152 Ga0501072_0047235 3300049588 Bacteria 3390
153 Ga0501072_0066727 3300049588 Bacteria 2839
154 Ga0501075_0045405 3300049591 Bacteria 3298
155 Ga0501080_0177808 3300049742 Bacteria 1960
156 Ga0501080_0271210 3300049742 Bacteria 1544
157 Ga0501081_0005806 3300049743 Bacteria 7993
158 Ga0501081_0153940 3300049743 Bacteria 1653
159 Ga0501083_0024623 3300049744 Bacteria 4168
160 Ga0501083_0219227 3300049744 Bacteria 1239
161 Ga0501044_0026777 3300049823 Bacteria 6102
162 Ga0501045_0014597 3300049824 Bacteria 5570
163 nmdc:mga00v17_25087_c1 3300050491 Bacteria 3462
164 nmdc:mga0yw44_2500_c1 3300050492 Bacteria 7868
165 nmdc:mga0yw44_658_c1 3300050492 Bacteria 12589
166 nmdc:mga05p37_12877_c1 3300050507 Bacteria 10000
167 nmdc:mga0qj67_13628_c1 3300050509 Bacteria 6133
168 nmdc:mga06r32_134719_c1 3300050510 Bacteria 2445
169 nmdc:mga06r32_138204_c1 3300050510 Bacteria 2411
170 nmdc:mga06r32_31097_c1 3300050510 Bacteria 5012
171 nmdc:mga0a205_63935_c1 3300050515 Bacteria 3554
172 Ga0495601_0010614 3300053077 Bacteria 5488
173 Ga0495601_0035148 3300053077 Bacteria 3126
174 Ga0495601_0038088 3300053077 Bacteria 3006
175 Ga0495601_0040358 3300053077 Bacteria 2923
176 Ga0495619_0002345 3300053085 Bacteria 12464
177 Ga0495619_0003648 3300053085 Bacteria 9921
178 Ga0500614_001170 3300053123 Bacteria 6441
179 Ga0501084_0011250 3300054114 Bacteria 7409
180 Ga0530510_0012506 3300061734 Bacteria 5962
181 Ga0530510_0185601 3300061734 Bacteria 1543
182 Ga0081539_10020156
183 JGI24740J21852_10018423
184 Ga0070677_10000001
185 Ga0068868_100001902
186 Ga0068868_100033512
187 Ga0070691_10000054
188 Ga0070669_100142027
189 Ga0070674_100000025
190 Ga0070673_100008516
191 Ga0070711_100003626
192 Ga0070678_100055704
193 Ga0070681_10006943
194 Ga0068867_100006377
195 Ga0070679_100001155
196 Ga0070693_100005662
197 Ga0070665_100000202
198 Ga0068854_100015861
199 Ga0068856_100041544
200 Ga0068866_10000001
201 Ga0068858_100214193
202 Ga0081455_10013080
203 Ga0081538_10036690
204 Ga0081540_1000006
205 Ga0081540_1013796
206 Ga0075365_10033614
207 Ga0075364_10030683
208 Ga0075364_10031231
209 Ga0070716_100043996
210 Ga0070712_100008911
211 Ga0075428_100113600
212 Ga0075430_100031167
213 Ga0075430_100046647
214 Ga0075431_100009458
215 Ga0075431_100195114
216 Ga0075434_100119723
217 Ga0075434_100219394
218 Ga0075436_100109973
219 Ga0111539_10113689
220 Ga0105245_10000969
221 Ga0105245_10023677
222 Ga0105247_10006057
223 Ga0114129_10008931
224 Ga0114129_10159562
225 Ga0105242_10000357
226 Ga0105242_10074867
227 Ga0105242_10124799
228 Ga0105238_10000023
229 Ga0105249_10000074
230 Ga0105249_10333298
231 Ga0105239_10058639
232 Ga0157378_10014394
233 Ga0157375_10062234
234 Ga0157379_10024847
235 Ga0207682_10000053
236 Ga0207642_10000006
237 Ga0207642_10000007
238 Ga0207710_10000580
239 Ga0207707_10022186
240 Ga0207693_10028590
241 Ga0207663_10043065
242 Ga0207652_10000549
243 Ga0207681_10127881
244 Ga0207694_10000004
245 Ga0207687_10000055
246 Ga0207690_10096122
247 Ga0207669_10000009
248 Ga0207665_10091480
249 Ga0207651_10005135
250 Ga0207712_10000007
251 Ga0207640_10010681
252 Ga0207677_10003454
253 Ga0207702_10002500
254 Ga0207648_10000931
255 Ga0207428_10028375
256 Ga0268266_10000020
257 Ga0316574_0099882
258 Ga0395900_0150307
259 Ga0395900_0378691
260 Ga0395898_0005525
261 Ga0395898_0038264
262 Ga0395905_0088183
263 Ga0395901_0013150
264 Ga0395901_0029010
265 Ga0495592_0000109
266 Ga0495603_0000023
267 Ga0495641_0000003
268 Ga0495653_0098508
269 Ga0495582_0000027
270 Ga0495662_0000131
271 Ga0495594_0000013
272 Ga0495596_0027833
273 Ga0495618_0000004
274 Ga0495620_0017067
275 Ga0495628_0001939
276 Ga0495628_0117748
277 Ga0495630_0001847
278 Ga0495644_0012318
279 Ga0495652_0144440
280 Ga0495587_0013678
281 Ga0495622_0000014
282 Ga0495633_0098801
283 Ga0495634_0022881
284 Ga0495635_0000042
285 Ga0495635_0011459
286 Ga0495635_0042966
287 Ga0495658_0000025
288 Ga0495624_0021236
289 Ga0495600_0002045
290 Ga0495604_0000038
291 Ga0495676_0081022
292 Ga0495680_0000196
293 Ga0495680_0077734
294 Ga0496100_0016259
295 Ga0496102_0017079
296 Ga0496102_0380166
297 Ga0496103_0007810
298 Ga0496104_0000002
299 Ga0496104_0000013
300 Ga0496104_0063844
301 Ga0496105_0000001
302 Ga0496105_0000006
303 Ga0496105_0012858
304 Ga0496106_0020776
305 Ga0496107_0297625
306 Ga0496108_0063640
307 Ga0496109_0205557
308 Ga0496109_0293474
309 Ga0496110_0078173
310 Ga0496111_0020281
311 Ga0496111_0076637
312 Ga0496113_0020486
313 Ga0496115_0000020
314 Ga0496115_0022817
315 Ga0496116_0000819
316 Ga0496117_0088964
317 Ga0496118_0055537
318 Ga0496119_0010882
319 Ga0496119_0013464
320 Ga0496119_0022882
321 Ga0496120_0001229
322 Ga0496121_0008178
323 Ga0496121_0148263
324 Ga0496125_0031981
325 Ga0496126_0009557
326 Ga0496126_0071434
327 Ga0501036_0208308
328 Ga0501041_0055622
329 Ga0501047_0138021
330 Ga0501047_0210720
331 Ga0501068_0054008
332 Ga0501071_0047365
333 Ga0501072_0047235
334 Ga0501072_0066727
335 Ga0501075_0045405
336 Ga0501080_0177808
337 Ga0501080_0271210
338 Ga0501081_0005806
339 Ga0501081_0153940
340 Ga0501083_0024623
341 Ga0501083_0219227
342 Ga0501044_0026777
343 Ga0501045_0014597
344 nmdc:mga00v17_25087_c1
345 nmdc:mga0yw44_2500_c1
346 nmdc:mga0yw44_658_c1
347 nmdc:mga05p37_12877_c1
348 nmdc:mga0qj67_13628_c1
349 nmdc:mga06r32_134719_c1
350 nmdc:mga06r32_138204_c1
351 nmdc:mga06r32_31097_c1
352 nmdc:mga0a205_63935_c1
353 Ga0495601_0010614
354 Ga0495601_0035148
355 Ga0495601_0038088
356 Ga0495601_0040358
357 Ga0495619_0002345
358 Ga0495619_0003648
359 Ga0500614_001170
360 Ga0501084_0011250
361 Ga0530510_0012506
362 Ga0530510_0185601

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04978

DUF664

Protein of unknown function (DUF664)

12

146

0.92

PF03781

FGE-sulfatase

Sulfatase-modifying factor enzyme 1

175

401

0.85

PF12867

DinB_2

DinB superfamily

16

149

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
8k5j-assembly1.cif.gz_A the structure of sena in complex with n,n,n-trimethyl-histidine 0.8652 6 365
4x8e-assembly2.cif.gz_B ergothioneine-biosynthetic sulfoxide synthase egtb in complex with n,n,n-trimethyl-histidine 0.8575 6 365
8k5j-assembly1.cif.gz_A the structure of sena in complex with n,n,n-trimethyl-histidine 0.8495 6 365
6o6l-assembly1.cif.gz_D the structure of egtb(cabther) in complex with hercynine 0.8461 6 365
6o6l-assembly1.cif.gz_C the structure of egtb(cabther) in complex with hercynine 0.843 6 365
ID Description Score Start End Superfamily
af_O69671_154_424_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.8543 162 364 3.90.1580.10
af_A4I4F2_219_492_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.842 161 366 3.90.1580.10
af_O94632_506_773_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.8087 162 364 3.90.1580.10
af_Q8NBJ7_27_294_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.7636 172 365 3.90.1580.10
af_A0A2R8Q5G7_74_369_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.7332 169 366 3.90.1580.10
ID Description Score Start End GO Terms
AF-A0A6H0J302-F1-model_v4 SUMF1/EgtB/PvdO family nonheme iron enzyme 0.9359 265 366
AF-A0A520J4T9-F1-model_v4 Ergothioneine biosynthesis protein EgtB 0.9335 175 363
AF-A0A7W1HDX5-F1-model_v4 SUMF1/EgtB/PvdO family nonheme iron enzyme 0.9322 248 361
AF-A0A534CJC6-F1-model_v4 Ergothioneine biosynthesis protein EgtB 0.9296 169 365
AF-G2DFQ1-F1-model_v4 Sulfatase-modifying factor enzyme domain-containing protein 0.9288 251 365

Map