F277014

General Info

Members Datasets Scaffolds Average Seq Length
181 121 181 217

Family's Representative Sequence

Representative Sequence 3300005544|Ga0070686_100690845|Ga0070686_1006908451
Length 218
Sequence MITVGCAGFAVPLTRYVKEFMFVEVQETNFSSPGRGTLGRWKRQGPEGFEFALLGPREVGQEGFRDGKVVETALNMLGEVADELGSRTVVFIAPPDFPANKANRAVVKDFLSGVRKRFDRVVWEAPPNWDPEDALNVALEAGAVASRDPLALTPPTYKSKFGYYRLPGPAGHKSRYEDPALEKLAEIVKNAKHETSVWVFTNVDMFADAKRLKKLLKL

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
21 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
38 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
57 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
58 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
59 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
62 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
63 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
64 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
65 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
66 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
67 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
68 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
69 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
70 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
71 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
72 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
73 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
74 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
75 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
76 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
77 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
78 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
79 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
80 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
83 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
84 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
85 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
86 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
90 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
91 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
92 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
93 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
94 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
95 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
96 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
99 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
100 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
101 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
105 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
106 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
107 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
108 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
109 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
110 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
111 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
112 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
113 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
114 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
115 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
116 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
117 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
118 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
119 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
120 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
121 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.31
Nodule 0
Rhizoplane 1.1
Rhizosphere 88.4
Stem 0
Stem Tuber 0
Unclassified 7.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10005911 3300003320 Bacteria 5357
2 rootH2_10048550 3300003320 Bacteria 2688
3 rootH1_10037221 3300003323 Bacteria 4973
4 rootH1_10099634 3300003323 Bacteria 2394
5 Ga0070683_100019315 3300005329 Bacteria 6052
6 Ga0070670_100759298 3300005331 Bacteria 874
7 Ga0070682_100001277 3300005337 Bacteria 14274
8 Ga0070682_100176262 3300005337 Bacteria 1490
9 Ga0070689_100010835 3300005340 Bacteria 6516
10 Ga0070668_100030420 3300005347 Bacteria 4105
11 Ga0070663_100021247 3300005455 Bacteria 4314
12 Ga0070678_100007988 3300005456 Bacteria 6306
13 Ga0068867_100064417 3300005459 Bacteria 2725
14 Ga0070685_10136143 3300005466 Bacteria 1541
15 Ga0070685_10137340 3300005466 Bacteria 1535
16 Ga0070684_100035765 3300005535 Bacteria 4253
17 Ga0070684_100334400 3300005535 Bacteria 1392
18 Ga0070684_100601968 3300005535 Bacteria 1022
19 Ga0070686_100690845 3300005544 Bacteria 813
20 Ga0068855_100008737 3300005563 Bacteria 12248
21 Ga0068855_100726294 3300005563 Bacteria 1061
22 Ga0068856_100051876 3300005614 Bacteria 4044
23 Ga0068856_100206288 3300005614 Bacteria 1980
24 Ga0070702_100101719 3300005615 Unclassified 1764
25 Ga0068859_100851400 3300005617 Bacteria 998
26 Ga0068861_100026256 3300005719 Bacteria 4233
27 Ga0068863_100279001 3300005841 Bacteria 1619
28 Ga0075366_10007111 3300006195 Bacteria 6162
29 Ga0075366_10029393 3300006195 Bacteria 3229
30 Ga0097621_100335744 3300006237 Bacteria 1341
31 Ga0068871_100372247 3300006358 Bacteria 1267
32 Ga0075428_100293343 3300006844 Bacteria 1749
33 Ga0068865_100135771 3300006881 Bacteria 1848
34 Ga0097620_100851376 3300006931 Bacteria 998
35 Ga0111539_10012570 3300009094 Bacteria 10608
36 Ga0111539_10814092 3300009094 Bacteria 1087
37 Ga0111539_10993624 3300009094 Bacteria 976
38 Ga0105245_10002021 3300009098 Bacteria 18392
39 Ga0105247_10001154 3300009101 Bacteria 19598
40 Ga0105247_10345021 3300009101 Bacteria 1046
41 Ga0105243_10698033 3300009148 Bacteria 989
42 Ga0105241_10013650 3300009174 Bacteria 5952
43 Ga0105242_10070808 3300009176 Bacteria 2892
44 Ga0157370_10843693 3300013104 Bacteria 833
45 Ga0157374_10297039 3300013296 Bacteria 1597
46 Ga0157374_10880869 3300013296 Bacteria 913
47 Ga0163163_10561960 3300014325 Bacteria 1204
48 Ga0163163_10882573 3300014325 Bacteria 958
49 Ga0157380_10043383 3300014326 Bacteria 3521
50 Ga0157376_10046970 3300014969 Bacteria 3563
51 Ga0157376_10098073 3300014969 Bacteria 2554
52 Ga0213876_10076454 3300021384 Archaea 1768
53 Ga0207710_10000636 3300025900 Bacteria 20157
54 Ga0207654_10014163 3300025911 Bacteria 4116
55 Ga0207650_10751183 3300025925 Bacteria 825
56 Ga0207687_10008285 3300025927 Bacteria 6799
57 Ga0207709_10784146 3300025935 Bacteria 768
58 Ga0207670_10023721 3300025936 Bacteria 3823
59 Ga0207691_10000802 3300025940 Bacteria 31230
60 Ga0207661_10015463 3300025944 Bacteria 5616
61 Ga0207661_10435799 3300025944 Bacteria 1192
62 Ga0207667_10015617 3300025949 Bacteria 8613
63 Ga0207667_10611030 3300025949 Bacteria 1099
64 Ga0207712_10192330 3300025961 Unclassified 1611
65 Ga0207668_10025306 3300025972 Bacteria 3840
66 Ga0207677_10027841 3300026023 Bacteria 3567
67 Ga0207678_10025346 3300026067 Bacteria 5176
68 Ga0207702_10094285 3300026078 Bacteria 2627
69 Ga0207702_10203599 3300026078 Bacteria 1836
70 Ga0207641_10305877 3300026088 Bacteria 1503
71 Ga0207641_10436187 3300026088 Bacteria 1264
72 Ga0207648_10040614 3300026089 Bacteria 4088
73 Ga0207648_10118829 3300026089 Bacteria 2323
74 Ga0207675_100019210 3300026118 Bacteria 6377
75 Ga0207683_10006762 3300026121 Bacteria 9811
76 Ga0207428_10314855 3300027907 Bacteria 1156
77 Ga0265337_1001009 3300028556 Bacteria 14633
78 Ga0265319_1000182 3300028563 Bacteria 47513
79 Ga0265318_10000367 3300028577 Bacteria 35684
80 Ga0265318_10002459 3300028577 Bacteria 9898
81 Ga0265338_10098050 3300028800 Bacteria 2399
82 Ga0265330_10000658 3300031235 Bacteria 22185
83 Ga0265330_10079369 3300031235 Unclassified 1415
84 Ga0265332_10003211 3300031238 Bacteria 7958
85 Ga0265332_10074321 3300031238 Bacteria 1445
86 Ga0265328_10003421 3300031239 Bacteria 7008
87 Ga0265320_10000146 3300031240 Bacteria 59684
88 Ga0265320_10056072 3300031240 Bacteria 1895
89 Ga0265320_10129520 3300031240 Bacteria 1147
90 Ga0265320_10180720 3300031240 Bacteria 945
91 Ga0265325_10007313 3300031241 Bacteria 6620
92 Ga0265329_10000082 3300031242 Bacteria 44094
93 Ga0265340_10002602 3300031247 Bacteria 10254
94 Ga0265340_10002626 3300031247 Bacteria 10221
95 Ga0265340_10015415 3300031247 Bacteria 3971
96 Ga0265339_10000451 3300031249 Bacteria 32188
97 Ga0265331_10000909 3300031250 Bacteria 23852
98 Ga0265331_10037061 3300031250 Bacteria 2390
99 Ga0265331_10037524 3300031250 Bacteria 2372
100 Ga0265316_10000831 3300031344 Bacteria 34190
101 Ga0265316_10002560 3300031344 Bacteria 18798
102 Ga0265316_10009998 3300031344 Bacteria 8678
103 Ga0307513_10252602 3300031456 Unclassified 1558
104 Ga0265313_10000224 3300031595 Bacteria 60981
105 Ga0265313_10001098 3300031595 Bacteria 26016
106 Ga0316579_10236835 3300031691 Bacteria 883
107 Ga0265314_10000001 3300031711 Bacteria 3792860
108 Ga0265314_10003251 3300031711 Bacteria 15884
109 Ga0265314_10070660 3300031711 Bacteria 2338
110 Ga0265342_10001155 3300031712 Bacteria 25168
111 Ga0265342_10025354 3300031712 Bacteria 3730
112 Ga0316576_10015905 3300031727 Bacteria 5064
113 Ga0316576_10110342 3300031727 Bacteria 2062
114 Ga0316576_10112822 3300031727 Bacteria 2038
115 Ga0316576_10130072 3300031727 Bacteria 1894
116 Ga0316576_10321469 3300031727 Bacteria 1154
117 Ga0316578_10129569 3300031728 Bacteria 1517
118 Ga0307406_10194299 3300031901 Bacteria 1488
119 Ga0307406_10466415 3300031901 Bacteria 1017
120 Ga0307407_10030407 3300031903 Bacteria 2913
121 Ga0307412_10009993 3300031911 Bacteria 5459
122 Ga0307409_100894213 3300031995 Bacteria 901
123 Ga0373931_0252689 3300035691 Bacteria 1073
124 Ga0373927_0219619 3300035695 Bacteria 1248
125 Ga0373937_0172278 3300036401 Bacteria 2031
126 Ga0373937_0373680 3300036401 Bacteria 1352
127 Ga0316582_0138135 3300036647 Bacteria 1642
128 Ga0316584_0251867 3300036712 Bacteria 1290
129 Ga0395905_0189219 3300037471 Bacteria 1931
130 Ga0436365_0675035 3300039437 Archaea 1920
131 Ga0451791_0196591 3300041451 Bacteria 1551
132 Ga0451851_0255332 3300041507 Bacteria 1642
133 Ga0451851_0672240 3300041507 Bacteria 880
134 Ga0451843_0217615 3300041509 Bacteria 1270
135 Ga0451853_0636983 3300041512 Bacteria 9620
136 Ga0451853_3562005 3300041512 Bacteria 837
137 Ga0453683_0005633 3300044673 Bacteria 8702
138 Ga0466965_0130532 3300044683 Bacteria 1303
139 Ga0466960_0348393 3300044901 Bacteria 844
140 Ga0451576_0019282 3300045051 Bacteria 7447
141 Ga0451576_0178373 3300045051 Bacteria 2218
142 Ga0451576_0610582 3300045051 Bacteria 1146
143 Ga0495629_0352052 3300046459 Bacteria 1004
144 Ga0495581_0103428 3300047315 Bacteria 1655
145 Ga0495680_0168856 3300047322 Bacteria 1584
146 Ga0496114_0030934 3300048917 Bacteria 4404
147 Ga0496123_0356210 3300048926 Bacteria 679
148 Ga0501034_0280359 3300049571 Bacteria 1606
149 Ga0501047_0328170 3300049581 Bacteria 1369
150 Ga0501067_0125820 3300049583 Bacteria 1426
151 Ga0501068_0145550 3300049584 Unclassified 1487
152 Ga0501068_0190117 3300049584 Unclassified 1300
153 Ga0501069_0427791 3300049585 Bacteria 785
154 Ga0501071_0043087 3300049587 Bacteria 3235
155 Ga0501073_0020547 3300049589 Bacteria 4761
156 Ga0501073_0086146 3300049589 Bacteria 2185
157 Ga0501073_0159832 3300049589 Unclassified 1561
158 Ga0501074_0092890 3300049590 Bacteria 2161
159 Ga0501074_0473302 3300049590 Bacteria 888
160 Ga0501076_0140795 3300049592 Bacteria 1960
161 Ga0501076_0322947 3300049592 Bacteria 1266
162 Ga0501257_115940 3300049686 Bacteria 714
163 Ga0501080_0016083 3300049742 Bacteria 6906
164 Ga0501080_0072203 3300049742 Bacteria 3211
165 Ga0501080_0093062 3300049742 Bacteria 2799
166 Ga0501080_0274545 3300049742 Bacteria 1534
167 Ga0501081_0083844 3300049743 Bacteria 2235
168 Ga0501083_0001032 3300049744 Bacteria 18570
169 Ga0501083_0311760 3300049744 Bacteria 1023
170 Ga0501035_0677975 3300049822 Bacteria 833
171 nmdc:mga0k408_150789_c1 3300050493 Unclassified 1384
172 nmdc:mga0k408_155085_c1 3300050493 Bacteria 1364
173 nmdc:mga0k408_187458_c1 3300050493 Bacteria 1234
174 nmdc:mga06r32_607853_c1 3300050510 Bacteria 1064
175 nmdc:mga08y16_11630_c1 3300050511 Bacteria 9245
176 nmdc:mga08y16_15793_c1 3300050511 Bacteria 7939
177 nmdc:mga08y16_535614_c1 3300050511 Bacteria 1186
178 Ga0500635_0067315 3300053080 Bacteria 1263
179 Ga0501084_0440483 3300054114 Unclassified 1101
180 Ga0501084_0505856 3300054114 Unclassified 1021
181 Ga0501082_0042829 3300060353 Bacteria 3903

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005456 Ga0070678_100007988 Ga0070678_1000079883 195
2 3300026121 Ga0207683_10006762 Ga0207683_100067625 195
3 3300005535 Ga0070684_100334400 Ga0070684_1003344002 214
4 3300003320 rootH2_10048550 rootH2_100485503 215
5 3300003323 rootH1_10037221 rootH1_100372213 215
6 3300005331 Ga0070670_100759298 Ga0070670_1007592981 215
7 3300005337 Ga0070682_100001277 Ga0070682_10000127714 215
8 3300005340 Ga0070689_100010835 Ga0070689_1000108353 215
9 3300005347 Ga0070668_100030420 Ga0070668_1000304202 215
10 3300005455 Ga0070663_100021247 Ga0070663_1000212472 215
11 3300005459 Ga0068867_100064417 Ga0068867_1000644172 215
12 3300005466 Ga0070685_10136143 Ga0070685_101361432 215
13 3300005466 Ga0070685_10137340 Ga0070685_101373401 215
14 3300005535 Ga0070684_100601968 Ga0070684_1006019681 215
15 3300005544 Ga0070686_100690845 Ga0070686_1006908451 215
16 3300005563 Ga0068855_100726294 Ga0068855_1007262941 215
17 3300005615 Ga0070702_100101719 Ga0070702_1001017192 215
18 3300005617 Ga0068859_100851400 Ga0068859_1008514002 215
19 3300005719 Ga0068861_100026256 Ga0068861_1000262564 215
20 3300005841 Ga0068863_100279001 Ga0068863_1002790012 215
21 3300006195 Ga0075366_10007111 Ga0075366_100071115 215
22 3300006195 Ga0075366_10029393 Ga0075366_100293933 215
23 3300006237 Ga0097621_100335744 Ga0097621_1003357441 215
24 3300006358 Ga0068871_100372247 Ga0068871_1003722472 215
25 3300006844 Ga0075428_100293343 Ga0075428_1002933432 215
26 3300006931 Ga0097620_100851376 Ga0097620_1008513762 215
27 3300009094 Ga0111539_10012570 Ga0111539_100125707 215
28 3300009094 Ga0111539_10814092 Ga0111539_108140921 215
29 3300009094 Ga0111539_10993624 Ga0111539_109936241 215
30 3300009101 Ga0105247_10001154 Ga0105247_100011543 215
31 3300009101 Ga0105247_10345021 Ga0105247_103450212 215
32 3300009148 Ga0105243_10698033 Ga0105243_106980331 215
33 3300014325 Ga0163163_10561960 Ga0163163_105619602 215
34 3300014325 Ga0163163_10882573 Ga0163163_108825732 215
35 3300014326 Ga0157380_10043383 Ga0157380_100433833 215
36 3300021384 Ga0213876_10076454 Ga0213876_100764541 215
37 3300025900 Ga0207710_10000636 Ga0207710_100006365 215
38 3300025925 Ga0207650_10751183 Ga0207650_107511832 215
39 3300025935 Ga0207709_10784146 Ga0207709_107841461 215
40 3300025936 Ga0207670_10023721 Ga0207670_100237213 215
41 3300025949 Ga0207667_10611030 Ga0207667_106110301 215
42 3300025961 Ga0207712_10192330 Ga0207712_101923301 215
43 3300025972 Ga0207668_10025306 Ga0207668_100253062 215
44 3300026067 Ga0207678_10025346 Ga0207678_100253464 215
45 3300026088 Ga0207641_10305877 Ga0207641_103058772 215
46 3300026088 Ga0207641_10436187 Ga0207641_104361872 215
47 3300026089 Ga0207648_10118829 Ga0207648_101188293 215
48 3300026118 Ga0207675_100019210 Ga0207675_1000192101 215
49 3300027907 Ga0207428_10314855 Ga0207428_103148551 215
50 3300028556 Ga0265337_1001009 Ga0265337_10010097 215
51 3300028563 Ga0265319_1000182 Ga0265319_10001824 215
52 3300028577 Ga0265318_10000367 Ga0265318_100003674 215
53 3300028800 Ga0265338_10098050 Ga0265338_100980503 215
54 3300031235 Ga0265330_10000658 Ga0265330_1000065816 215
55 3300031238 Ga0265332_10003211 Ga0265332_100032114 215
56 3300031238 Ga0265332_10074321 Ga0265332_100743212 215
57 3300031239 Ga0265328_10003421 Ga0265328_100034214 215
58 3300031240 Ga0265320_10000146 Ga0265320_1000014624 215
59 3300031240 Ga0265320_10180720 Ga0265320_101807201 215
60 3300031242 Ga0265329_10000082 Ga0265329_1000008228 215
61 3300031247 Ga0265340_10002602 Ga0265340_100026024 215
62 3300031249 Ga0265339_10000451 Ga0265339_1000045120 215
63 3300031250 Ga0265331_10000909 Ga0265331_1000090920 215
64 3300031250 Ga0265331_10037061 Ga0265331_100370613 215
65 3300031250 Ga0265331_10037524 Ga0265331_100375242 215
66 3300031344 Ga0265316_10000831 Ga0265316_1000083114 215
67 3300031344 Ga0265316_10002560 Ga0265316_100025604 215
68 3300031595 Ga0265313_10000224 Ga0265313_1000022413 215
69 3300031691 Ga0316579_10236835 Ga0316579_102368351 215
70 3300031711 Ga0265314_10000001 Ga0265314_100000012292 215
71 3300031711 Ga0265314_10003251 Ga0265314_100032512 215
72 3300031711 Ga0265314_10070660 Ga0265314_100706602 215
73 3300031712 Ga0265342_10001155 Ga0265342_100011558 215
74 3300031727 Ga0316576_10015905 Ga0316576_100159055 215
75 3300031727 Ga0316576_10112822 Ga0316576_101128221 215
76 3300031727 Ga0316576_10130072 Ga0316576_101300722 215
77 3300031727 Ga0316576_10321469 Ga0316576_103214691 215
78 3300031728 Ga0316578_10129569 Ga0316578_101295692 215
79 3300031901 Ga0307406_10194299 Ga0307406_101942992 215
80 3300031901 Ga0307406_10466415 Ga0307406_104664152 215
81 3300031903 Ga0307407_10030407 Ga0307407_100304072 215
82 3300031911 Ga0307412_10009993 Ga0307412_100099932 215
83 3300031995 Ga0307409_100894213 Ga0307409_1008942131 215
84 3300035691 Ga0373931_0252689 Ga0373931_0252689_234_884 215
85 3300035695 Ga0373927_0219619 Ga0373927_0219619_97_747 215
86 3300036401 Ga0373937_0172278 Ga0373937_0172278_487_1137 215
87 3300036401 Ga0373937_0373680 Ga0373937_0373680_603_1253 215
88 3300036712 Ga0316584_0251867 Ga0316584_0251867_209_859 215
89 3300037471 Ga0395905_0189219 Ga0395905_0189219_1212_1889 215
90 3300039437 Ga0436365_0675035 Ga0436365_0675035_178_828 215
91 3300041451 Ga0451791_0196591 Ga0451791_0196591_757_1407 215
92 3300041507 Ga0451851_0255332 Ga0451851_0255332_49_699 215
93 3300041512 Ga0451853_0636983 Ga0451853_0636983_8742_9392 215
94 3300041512 Ga0451853_3562005 Ga0451853_3562005_171_821 215
95 3300044673 Ga0453683_0005633 Ga0453683_0005633_3748_4398 215
96 3300044683 Ga0466965_0130532 Ga0466965_0130532_450_1097 215
97 3300044901 Ga0466960_0348393 Ga0466960_0348393_126_776 215
98 3300045051 Ga0451576_0019282 Ga0451576_0019282_4234_4884 215
99 3300045051 Ga0451576_0178373 Ga0451576_0178373_64_714 215
100 3300045051 Ga0451576_0610582 Ga0451576_0610582_268_921 215
101 3300046459 Ga0495629_0352052 Ga0495629_0352052_112_762 215
102 3300047315 Ga0495581_0103428 Ga0495581_0103428_875_1525 215
103 3300047322 Ga0495680_0168856 Ga0495680_0168856_101_751 215
104 3300048926 Ga0496123_0356210 Ga0496123_0356210_13_663 215
105 3300049581 Ga0501047_0328170 Ga0501047_0328170_531_1181 215
106 3300049583 Ga0501067_0125820 Ga0501067_0125820_463_1113 215
107 3300049584 Ga0501068_0145550 Ga0501068_0145550_170_820 215
108 3300049584 Ga0501068_0190117 Ga0501068_0190117_538_1188 215
109 3300049587 Ga0501071_0043087 Ga0501071_0043087_1970_2620 215
110 3300049589 Ga0501073_0020547 Ga0501073_0020547_2728_3378 215
111 3300049589 Ga0501073_0086146 Ga0501073_0086146_323_973 215
112 3300049589 Ga0501073_0159832 Ga0501073_0159832_11_661 215
113 3300049590 Ga0501074_0092890 Ga0501074_0092890_370_1020 215
114 3300049590 Ga0501074_0473302 Ga0501074_0473302_84_734 215
115 3300049592 Ga0501076_0140795 Ga0501076_0140795_317_967 215
116 3300049592 Ga0501076_0322947 Ga0501076_0322947_182_832 215
117 3300049686 Ga0501257_115940 Ga0501257_115940_27_677 215
118 3300049742 Ga0501080_0016083 Ga0501080_0016083_1639_2289 215
119 3300049742 Ga0501080_0072203 Ga0501080_0072203_1074_1724 215
120 3300049742 Ga0501080_0093062 Ga0501080_0093062_2101_2751 215
121 3300049743 Ga0501081_0083844 Ga0501081_0083844_300_950 215
122 3300049744 Ga0501083_0001032 Ga0501083_0001032_17055_17705 215
123 3300049744 Ga0501083_0311760 Ga0501083_0311760_83_733 215
124 3300050493 nmdc:mga0k408_150789_c1 nmdc:mga0k408_150789_c1_590_1240 215
125 3300050493 nmdc:mga0k408_155085_c1 nmdc:mga0k408_155085_c1_401_1051 215
126 3300050493 nmdc:mga0k408_187458_c1 nmdc:mga0k408_187458_c1_69_719 215
127 3300050510 nmdc:mga06r32_607853_c1 nmdc:mga06r32_607853_c1_391_1041 215
128 3300050511 nmdc:mga08y16_11630_c1 nmdc:mga08y16_11630_c1_5588_6238 215
129 3300050511 nmdc:mga08y16_15793_c1 nmdc:mga08y16_15793_c1_317_967 215
130 3300050511 nmdc:mga08y16_535614_c1 nmdc:mga08y16_535614_c1_307_957 215
131 3300054114 Ga0501084_0440483 Ga0501084_0440483_138_788 215
132 3300054114 Ga0501084_0505856 Ga0501084_0505856_133_783 215
133 3300060353 Ga0501082_0042829 Ga0501082_0042829_1642_2292 215
134 3300003320 rootH2_10005911 rootH2_100059114 216
135 3300003323 rootH1_10099634 rootH1_100996343 216
136 3300005329 Ga0070683_100019315 Ga0070683_1000193152 216
137 3300005337 Ga0070682_100176262 Ga0070682_1001762622 216
138 3300005535 Ga0070684_100035765 Ga0070684_1000357656 216
139 3300005563 Ga0068855_100008737 Ga0068855_10000873710 216
140 3300005614 Ga0068856_100051876 Ga0068856_1000518763 216
141 3300005614 Ga0068856_100206288 Ga0068856_1002062883 216
142 3300006881 Ga0068865_100135771 Ga0068865_1001357712 216
143 3300009098 Ga0105245_10002021 Ga0105245_1000202114 216
144 3300009174 Ga0105241_10013650 Ga0105241_100136505 216
145 3300009176 Ga0105242_10070808 Ga0105242_100708082 216
146 3300013104 Ga0157370_10843693 Ga0157370_108436931 216
147 3300013296 Ga0157374_10297039 Ga0157374_102970392 216
148 3300013296 Ga0157374_10880869 Ga0157374_108808691 216
149 3300014969 Ga0157376_10046970 Ga0157376_100469702 216
150 3300014969 Ga0157376_10098073 Ga0157376_100980731 216
151 3300025911 Ga0207654_10014163 Ga0207654_100141634 216
152 3300025927 Ga0207687_10008285 Ga0207687_100082853 216
153 3300025940 Ga0207691_10000802 Ga0207691_1000080223 216
154 3300025944 Ga0207661_10015463 Ga0207661_100154633 216
155 3300025944 Ga0207661_10435799 Ga0207661_104357991 216
156 3300025949 Ga0207667_10015617 Ga0207667_100156177 216
157 3300026023 Ga0207677_10027841 Ga0207677_100278413 216
158 3300026078 Ga0207702_10094285 Ga0207702_100942852 216
159 3300026078 Ga0207702_10203599 Ga0207702_102035993 216
160 3300026089 Ga0207648_10040614 Ga0207648_100406143 216
161 3300028577 Ga0265318_10002459 Ga0265318_100024595 216
162 3300031235 Ga0265330_10079369 Ga0265330_100793692 216
163 3300031240 Ga0265320_10056072 Ga0265320_100560722 216
164 3300031240 Ga0265320_10129520 Ga0265320_101295202 216
165 3300031241 Ga0265325_10007313 Ga0265325_100073135 216
166 3300031247 Ga0265340_10002626 Ga0265340_100026267 216
167 3300031247 Ga0265340_10015415 Ga0265340_100154152 216
168 3300031344 Ga0265316_10009998 Ga0265316_100099983 216
169 3300031456 Ga0307513_10252602 Ga0307513_102526022 216
170 3300031595 Ga0265313_10001098 Ga0265313_1000109817 216
171 3300031712 Ga0265342_10025354 Ga0265342_100253542 216
172 3300031727 Ga0316576_10110342 Ga0316576_101103422 216
173 3300036647 Ga0316582_0138135 Ga0316582_0138135_962_1615 216
174 3300041507 Ga0451851_0672240 Ga0451851_0672240_34_687 216
175 3300041509 Ga0451843_0217615 Ga0451843_0217615_529_1182 216
176 3300048917 Ga0496114_0030934 Ga0496114_0030934_1239_1904 216
177 3300049571 Ga0501034_0280359 Ga0501034_0280359_394_1047 216
178 3300049585 Ga0501069_0427791 Ga0501069_0427791_92_745 216
179 3300049742 Ga0501080_0274545 Ga0501080_0274545_94_747 216
180 3300049822 Ga0501035_0677975 Ga0501035_0677975_80_733 216
181 3300053080 Ga0500635_0067315 Ga0500635_0067315_296_949 216

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01904

DUF72

Protein of unknown function DUF72

10

217

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ztv-assembly1.cif.gz_B crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 3.10 a resolution 0.7665 1 216
1ztv-assembly1.cif.gz_B crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 3.10 a resolution 0.7633 1 216
1vpy-assembly1.cif.gz_A crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 2.52 a resolution 0.7618 2 216
1vpy-assembly1.cif.gz_A crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 2.52 a resolution 0.756 2 216
1vpq-assembly1.cif.gz_A crystal structure of a duf72 family protein (tm1631) from thermotoga maritima msb8 at 2.20 a resolution 0.7315 2 214
ID Description Score Start End Superfamily
1ztvA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7662 1 216 3.20.20.410
1ztvA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7633 1 216 3.20.20.410
af_Q2FZX7_1_282_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7565 1 216 3.20.20.410
af_Q4E4B4_140_369_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7547 43 214 3.20.20.410
af_Q2FZX7_1_282_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7534 1 216 3.20.20.410
ID Description Score Start End GO Terms
AF-A0A017T0C8-F1-model_v4 DUF72 domain-containing protein 0.9598 38 214
AF-A0A1L6L7I7-F1-model_v4 deleted 0.9592 69 214
AF-A0A150S3K4-F1-model_v4 DUF72 domain-containing protein 0.9562 2 214
AF-A0A4Q3J8I1-F1-model_v4 DUF72 domain-containing protein 0.9555 2 215
AF-A0A2W4LTS7-F1-model_v4 DUF72 domain-containing protein 0.9456 1 188

Feature Viewer

pLDDT pTM Quality
87.71 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map