F276985

General Info

Members Datasets Scaffolds Average Seq Length
181 132 362 169

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100059684|Ga0070699_1000596842
Length 188
Sequence VIFWGSGRKHRAEITAVTLSIAAVLAVFAPMIAEALLSARHERALRALGAVEPPDDVYRIMQIAYPGAFAALIAEGALRGVRGGVAFDAGAALFLASKALKYWAIASLGTRWTFRVLVPPGSAPVRRGPYRWIAHPNYLAVAGELAAVALAMHAIVTGAPAVVGFSLLMRRRAQIEERALAEGTIRRA

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
72 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
75 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
76 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
77 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
82 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
83 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
84 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
85 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
86 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
87 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
88 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
89 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
90 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
91 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
92 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
93 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
94 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
95 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
96 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
97 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
98 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
105 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
106 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
107 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
108 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
109 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
110 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
111 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
112 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
113 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
114 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
115 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
116 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
117 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
118 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
119 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
120 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
121 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
122 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
123 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
124 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
125 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
126 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
127 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
128 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
129 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
130 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
131 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
132 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.6
Nodule 0
Rhizoplane 3.31
Rhizosphere 83.98
Stem 0
Stem Tuber 0
Unclassified 27.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100059684 3300005518 Unclassified 3304
2 JGI24751J29686_10042374 3300002459 Bacteria 941
3 Ga0065712_10143111 3300005290 Unclassified 1432
4 Ga0065715_10145853 3300005293 Bacteria 1790
5 Ga0065715_10152618 3300005293 Unclassified 1712
6 Ga0065715_10697638 3300005293 Bacteria 654
7 Ga0065707_10189550 3300005295 Unclassified 1369
8 Ga0070676_10397169 3300005328 Unclassified 958
9 Ga0070683_100017572 3300005329 Bacteria 6322
10 Ga0070670_100011256 3300005331 Bacteria 7647
11 Ga0070677_10166439 3300005333 Unclassified 1038
12 Ga0070680_100722897 3300005336 Bacteria 857
13 Ga0070689_100664225 3300005340 Unclassified 908
14 Ga0070689_100964391 3300005340 Bacteria 757
15 Ga0070691_10241576 3300005341 Bacteria 965
16 Ga0070661_100314810 3300005344 Bacteria 1221
17 Ga0070669_100106776 3300005353 Unclassified 2120
18 Ga0070671_100573284 3300005355 Bacteria 974
19 Ga0070713_100048672 3300005436 Bacteria 3492
20 Ga0070700_100038490 3300005441 Unclassified 2915
21 Ga0070694_100320252 3300005444 Bacteria 1193
22 Ga0070708_100588309 3300005445 Bacteria 1049
23 Ga0070681_10765271 3300005458 Bacteria 882
24 Ga0068867_101402333 3300005459 Unclassified 648
25 Ga0070706_100112470 3300005467 Unclassified 2535
26 Ga0070684_100168487 3300005535 Bacteria 1989
27 Ga0070672_100781366 3300005543 Unclassified 839
28 Ga0070696_100130998 3300005546 Unclassified 1825
29 Ga0070704_100204343 3300005549 Bacteria 1597
30 Ga0070704_101006070 3300005549 Bacteria 754
31 Ga0068855_101418746 3300005563 Bacteria 715
32 Ga0068859_100130765 3300005617 Bacteria 2582
33 Ga0068864_101005466 3300005618 Unclassified 827
34 Ga0068863_100344656 3300005841 Bacteria 1450
35 Ga0068858_100535502 3300005842 Bacteria 1133
36 Ga0068858_101148185 3300005842 Bacteria 763
37 Ga0068862_100237267 3300005844 Bacteria 1656
38 Ga0068862_100401569 3300005844 Bacteria 1282
39 Ga0075365_10478016 3300006038 Bacteria 880
40 Ga0075368_10180434 3300006042 Bacteria 890
41 Ga0075364_10002202 3300006051 Bacteria 10928
42 Ga0075364_10019933 3300006051 Bacteria 4214
43 Ga0075362_10005018 3300006177 Bacteria 4806
44 Ga0075367_10623074 3300006178 Bacteria 686
45 Ga0075367_10654492 3300006178 Bacteria 668
46 Ga0075366_10021650 3300006195 Bacteria 3738
47 Ga0075366_10035932 3300006195 Bacteria 2921
48 Ga0075370_10190071 3300006353 Bacteria 1210
49 Ga0068871_100969420 3300006358 Bacteria 791
50 Ga0075428_100030563 3300006844 Bacteria 5957
51 Ga0075430_100005707 3300006846 Bacteria 10499
52 Ga0075430_100013244 3300006846 Bacteria 7028
53 Ga0075430_100406809 3300006846 Bacteria 1123
54 Ga0075431_100010377 3300006847 Bacteria 9359
55 Ga0075431_100126201 3300006847 Bacteria 2640
56 Ga0075431_100140025 3300006847 Bacteria 2494
57 Ga0075431_101232069 3300006847 Bacteria 710
58 Ga0075434_100179132 3300006871 Bacteria 2139
59 Ga0075429_100163311 3300006880 Bacteria 1951
60 Ga0097620_100130774 3300006931 Bacteria 2582
61 Ga0105240_10609475 3300009093 Bacteria 1201
62 Ga0111539_10029810 3300009094 Bacteria 6640
63 Ga0111539_10692552 3300009094 Bacteria 1186
64 Ga0114129_10006775 3300009147 Bacteria 16266
65 Ga0114129_10008879 3300009147 Bacteria 14334
66 Ga0105248_10004791 3300009177 Bacteria 14977
67 Ga0105248_10549654 3300009177 Bacteria 1303
68 Ga0105249_10244234 3300009553 Bacteria 1777
69 Ga0105249_12344803 3300009553 Bacteria 606
70 Ga0157370_10797867 3300013104 Unclassified 859
71 Ga0163163_10211409 3300014325 Bacteria 1989
72 Ga0163163_10401468 3300014325 Unclassified 1429
73 Ga0157380_10665805 3300014326 Bacteria 1041
74 Ga0157380_10986994 3300014326 Bacteria 875
75 Ga0157377_10225093 3300014745 Bacteria 1203
76 Ga0207645_10335399 3300025907 Unclassified 1010
77 Ga0207660_10338547 3300025917 Unclassified 1204
78 Ga0207681_10194254 3300025923 Bacteria 1555
79 Ga0207700_10008036 3300025928 Bacteria 6504
80 Ga0207706_10551511 3300025933 Bacteria 992
81 Ga0207670_10208436 3300025936 Bacteria 1489
82 Ga0207711_10065064 3300025941 Bacteria 3151
83 Ga0207661_10019893 3300025944 Bacteria 5010
84 Ga0207712_10214244 3300025961 Bacteria 1536
85 Ga0207708_10005571 3300026075 Bacteria 9294
86 Ga0207708_10344410 3300026075 Bacteria 1221
87 Ga0207641_10270039 3300026088 Bacteria 1596
88 Ga0207675_100868228 3300026118 Bacteria 918
89 Ga0209971_1040524 3300027682 Bacteria 1120
90 Ga0268265_10549956 3300028380 Bacteria 1096
91 Ga0307408_100093047 3300031548 Bacteria 2280
92 Ga0307408_100114206 3300031548 Bacteria 2080
93 Ga0307408_100463164 3300031548 Bacteria 1102
94 Ga0307410_10474895 3300031852 Bacteria 1025
95 Ga0307409_100041320 3300031995 Bacteria 3443
96 Ga0307409_100793688 3300031995 Bacteria 954
97 Ga0307416_100031785 3300032002 Unclassified 3979
98 Ga0307416_100095965 3300032002 Bacteria 2562
99 Ga0307416_100217953 3300032002 Bacteria 1827
100 Ga0307416_100453283 3300032002 Bacteria 1336
101 Ga0307415_100582135 3300032126 Bacteria 993
102 Ga0373939_0161622 3300035114 Bacteria 823
103 Ga0373946_0229760 3300035171 Unclassified 898
104 Ga0373946_0369303 3300035171 Bacteria 720
105 Ga0373933_0015030 3300035724 Unclassified 4314
106 Ga0373937_0001133 3300036401 Bacteria 22430
107 Ga0373925_0003703 3300037068 Bacteria 11742
108 Ga0395900_0651094 3300037418 Bacteria 990
109 Ga0436365_0919609 3300039437 Bacteria 1003
110 Ga0451853_1578631 3300041512 Bacteria 946
111 Ga0439433_0047602 3300041999 Unclassified 1007
112 Ga0450921_013671 3300042123 Unclassified 715
113 Ga0439446_0007246 3300042156 Unclassified 2913
114 Ga0439435_0003774 3300042436 Unclassified 3190
115 Ga0439464_0036717 3300042439 Unclassified 1387
116 Ga0439464_0073757 3300042439 Bacteria 1012
117 Ga0453683_0517440 3300044673 Bacteria 775
118 Ga0495608_0080337 3300046511 Bacteria 2120
119 Ga0495599_0312052 3300046678 Unclassified 948
120 Ga0495613_0586531 3300046689 Bacteria 743
121 Ga0495680_0511959 3300047322 Unclassified 813
122 Ga0496101_0274324 3300048904 Unclassified 1317
123 Ga0496105_1238260 3300048908 Bacteria 548
124 Ga0496107_0440930 3300048910 Unclassified 968
125 Ga0496108_0805541 3300048911 Bacteria 810
126 Ga0496112_0438214 3300048915 Bacteria 1245
127 Ga0496112_0613551 3300048915 Bacteria 1019
128 Ga0501032_0458075 3300049569 Unclassified 817
129 Ga0501032_0624124 3300049569 Unclassified 685
130 Ga0501034_0844133 3300049571 Unclassified 806
131 Ga0501040_0039111 3300049576 Bacteria 3226
132 Ga0501042_0216388 3300049578 Unclassified 1382
133 Ga0501043_0223008 3300049579 Bacteria 1458
134 Ga0501046_0473470 3300049580 Unclassified 899
135 Ga0501067_0096910 3300049583 Unclassified 1638
136 Ga0501067_0259186 3300049583 Bacteria 968
137 Ga0501071_0044962 3300049587 Bacteria 3169
138 Ga0501072_0032592 3300049588 Bacteria 4081
139 Ga0501073_0000430 3300049589 Bacteria 28781
140 Ga0501074_0774506 3300049590 Unclassified 676
141 Ga0501075_0057718 3300049591 Bacteria 2923
142 Ga0501075_0277543 3300049591 Unclassified 1277
143 Ga0501076_0080627 3300049592 Bacteria 2613
144 Ga0501076_0154796 3300049592 Unclassified 1865
145 Ga0501079_0142350 3300049741 Unclassified 1868
146 Ga0501079_0325222 3300049741 Unclassified 1204
147 Ga0501080_0116958 3300049742 Bacteria 2471
148 Ga0501080_0232500 3300049742 Bacteria 1685
149 Ga0501080_0524400 3300049742 Unclassified 1057
150 Ga0501080_1055924 3300049742 Bacteria 703
151 Ga0501081_0029844 3300049743 Bacteria 3687
152 Ga0501268_025313 3300049765 Bacteria 1042
153 Ga0501045_0137468 3300049824 Unclassified 1817
154 Ga0501045_0607756 3300049824 Unclassified 809
155 nmdc:mga03683_45580_c1 3300050489 Bacteria 1815
156 nmdc:mga03n38_115973_c1 3300050490 Bacteria 969
157 nmdc:mga00v17_15767_c1 3300050491 Bacteria 4248
158 nmdc:mga0yw44_36335_c1 3300050492 Bacteria 2902
159 nmdc:mga0k408_22797_c1 3300050493 Bacteria 3528
160 nmdc:mga0k408_2313_c1 3300050493 Bacteria 10143
161 nmdc:mga06z11_348282_c1 3300050494 Unclassified 886
162 nmdc:mga06z11_547060_c1 3300050494 Bacteria 703
163 nmdc:mga06z11_7417_c1 3300050494 Bacteria 4510
164 nmdc:mga04h51_329142_c1 3300050495 Bacteria 628
165 nmdc:mga07m45_150144_c1 3300050496 Bacteria 1351
166 nmdc:mga05p37_8365_c1 3300050507 Bacteria 12234
167 nmdc:mga05p37_9434_c1 3300050507 Bacteria 11553
168 nmdc:mga09592_159209_c1 3300050508 Bacteria 1950
169 nmdc:mga09592_663923_c1 3300050508 Unclassified 889
170 nmdc:mga0qj67_15116_c1 3300050509 Bacteria 5841
171 nmdc:mga0qj67_42034_c1 3300050509 Bacteria 3598
172 nmdc:mga06r32_116246_c1 3300050510 Bacteria 2635
173 nmdc:mga06r32_235522_c1 3300050510 Bacteria 1818
174 nmdc:mga06r32_45481_c1 3300050510 Bacteria 4185
175 nmdc:mga08y16_1122864_c1 3300050511 Unclassified 760
176 nmdc:mga08y16_611860_c1 3300050511 Unclassified 1097
177 nmdc:mga08y16_873161_c1 3300050511 Unclassified 887
178 nmdc:mga0n895_122099_c1 3300050512 Bacteria 2626
179 nmdc:mga08x19_360492_c1 3300050514 Unclassified 1016
180 Ga0495601_0146818 3300053077 Bacteria 1539
181 Ga0501084_0132423 3300054114 Bacteria 2099
182 Ga0070699_100059684
183 JGI24751J29686_10042374
184 Ga0065712_10143111
185 Ga0065715_10145853
186 Ga0065715_10152618
187 Ga0065715_10697638
188 Ga0065707_10189550
189 Ga0070676_10397169
190 Ga0070683_100017572
191 Ga0070670_100011256
192 Ga0070677_10166439
193 Ga0070680_100722897
194 Ga0070689_100664225
195 Ga0070689_100964391
196 Ga0070691_10241576
197 Ga0070661_100314810
198 Ga0070669_100106776
199 Ga0070671_100573284
200 Ga0070713_100048672
201 Ga0070700_100038490
202 Ga0070694_100320252
203 Ga0070708_100588309
204 Ga0070681_10765271
205 Ga0068867_101402333
206 Ga0070706_100112470
207 Ga0070684_100168487
208 Ga0070672_100781366
209 Ga0070696_100130998
210 Ga0070704_100204343
211 Ga0070704_101006070
212 Ga0068855_101418746
213 Ga0068859_100130765
214 Ga0068864_101005466
215 Ga0068863_100344656
216 Ga0068858_100535502
217 Ga0068858_101148185
218 Ga0068862_100237267
219 Ga0068862_100401569
220 Ga0075365_10478016
221 Ga0075368_10180434
222 Ga0075364_10002202
223 Ga0075364_10019933
224 Ga0075362_10005018
225 Ga0075367_10623074
226 Ga0075367_10654492
227 Ga0075366_10021650
228 Ga0075366_10035932
229 Ga0075370_10190071
230 Ga0068871_100969420
231 Ga0075428_100030563
232 Ga0075430_100005707
233 Ga0075430_100013244
234 Ga0075430_100406809
235 Ga0075431_100010377
236 Ga0075431_100126201
237 Ga0075431_100140025
238 Ga0075431_101232069
239 Ga0075434_100179132
240 Ga0075429_100163311
241 Ga0097620_100130774
242 Ga0105240_10609475
243 Ga0111539_10029810
244 Ga0111539_10692552
245 Ga0114129_10006775
246 Ga0114129_10008879
247 Ga0105248_10004791
248 Ga0105248_10549654
249 Ga0105249_10244234
250 Ga0105249_12344803
251 Ga0157370_10797867
252 Ga0163163_10211409
253 Ga0163163_10401468
254 Ga0157380_10665805
255 Ga0157380_10986994
256 Ga0157377_10225093
257 Ga0207645_10335399
258 Ga0207660_10338547
259 Ga0207681_10194254
260 Ga0207700_10008036
261 Ga0207706_10551511
262 Ga0207670_10208436
263 Ga0207711_10065064
264 Ga0207661_10019893
265 Ga0207712_10214244
266 Ga0207708_10005571
267 Ga0207708_10344410
268 Ga0207641_10270039
269 Ga0207675_100868228
270 Ga0209971_1040524
271 Ga0268265_10549956
272 Ga0307408_100093047
273 Ga0307408_100114206
274 Ga0307408_100463164
275 Ga0307410_10474895
276 Ga0307409_100041320
277 Ga0307409_100793688
278 Ga0307416_100031785
279 Ga0307416_100095965
280 Ga0307416_100217953
281 Ga0307416_100453283
282 Ga0307415_100582135
283 Ga0373939_0161622
284 Ga0373946_0229760
285 Ga0373946_0369303
286 Ga0373933_0015030
287 Ga0373937_0001133
288 Ga0373925_0003703
289 Ga0395900_0651094
290 Ga0436365_0919609
291 Ga0451853_1578631
292 Ga0439433_0047602
293 Ga0450921_013671
294 Ga0439446_0007246
295 Ga0439435_0003774
296 Ga0439464_0036717
297 Ga0439464_0073757
298 Ga0453683_0517440
299 Ga0495608_0080337
300 Ga0495599_0312052
301 Ga0495613_0586531
302 Ga0495680_0511959
303 Ga0496101_0274324
304 Ga0496105_1238260
305 Ga0496107_0440930
306 Ga0496108_0805541
307 Ga0496112_0438214
308 Ga0496112_0613551
309 Ga0501032_0458075
310 Ga0501032_0624124
311 Ga0501034_0844133
312 Ga0501040_0039111
313 Ga0501042_0216388
314 Ga0501043_0223008
315 Ga0501046_0473470
316 Ga0501067_0096910
317 Ga0501067_0259186
318 Ga0501071_0044962
319 Ga0501072_0032592
320 Ga0501073_0000430
321 Ga0501074_0774506
322 Ga0501075_0057718
323 Ga0501075_0277543
324 Ga0501076_0080627
325 Ga0501076_0154796
326 Ga0501079_0142350
327 Ga0501079_0325222
328 Ga0501080_0116958
329 Ga0501080_0232500
330 Ga0501080_0524400
331 Ga0501080_1055924
332 Ga0501081_0029844
333 Ga0501268_025313
334 Ga0501045_0137468
335 Ga0501045_0607756
336 nmdc:mga03683_45580_c1
337 nmdc:mga03n38_115973_c1
338 nmdc:mga00v17_15767_c1
339 nmdc:mga0yw44_36335_c1
340 nmdc:mga0k408_22797_c1
341 nmdc:mga0k408_2313_c1
342 nmdc:mga06z11_348282_c1
343 nmdc:mga06z11_547060_c1
344 nmdc:mga06z11_7417_c1
345 nmdc:mga04h51_329142_c1
346 nmdc:mga07m45_150144_c1
347 nmdc:mga05p37_8365_c1
348 nmdc:mga05p37_9434_c1
349 nmdc:mga09592_159209_c1
350 nmdc:mga09592_663923_c1
351 nmdc:mga0qj67_15116_c1
352 nmdc:mga0qj67_42034_c1
353 nmdc:mga06r32_116246_c1
354 nmdc:mga06r32_235522_c1
355 nmdc:mga06r32_45481_c1
356 nmdc:mga08y16_1122864_c1
357 nmdc:mga08y16_611860_c1
358 nmdc:mga08y16_873161_c1
359 nmdc:mga0n895_122099_c1
360 nmdc:mga08x19_360492_c1
361 Ga0495601_0146818
362 Ga0501084_0132423

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04191

PEMT

Phospholipid methyltransferase

85

183

0.93

PF04140

ICMT

Isoprenylcysteine carboxyl methyltransferase (ICMT) family

90

182

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7c83-assembly1.cif.gz_A crystal structure of an integral membrane steroid 5-alpha-reductase pbsrd5a 0.8031 56 122
4a2n-assembly1.cif.gz_B crystal structure of ma-icmt 0.7961 58 151
4quv-assembly3.cif.gz_A structure of an integral membrane delta(14)-sterol reductase 0.7659 55 150
5vg9-assembly1.cif.gz_A structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase) without a monobody 0.7159 31 151
5v7p-assembly1.cif.gz_A atomic structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase), in complex with a monobody 0.7116 34 151
ID Description Score Start End Superfamily
af_A0A1D8PPI7_47_265_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9155 56 151 1.20.120.1630
af_Q4DVP0_51_248_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.902 56 151 1.20.120.1630
af_Q4D7B7_120_287_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9002 56 151 1.20.120.1630
af_O60725_93_277_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8947 55 151 1.20.120.1630
af_P32584_46_239_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8552 54 158 1.20.120.1630
ID Description Score Start End GO Terms
AF-Q7D8S3-F1-model_v4 Isoprenylcysteine carboxyl methyltransferase 0.9508 58 152 GO:0004671
GO:0016020
AF-A0A537EVH4-F1-model_v4 Isoprenylcysteine carboxylmethyltransferase family protein 0.9364 63 157 GO:0008168
GO:0012505
GO:0016020
GO:0032259
AF-A0A3N9PUP8-F1-model_v4 deleted 0.9356 54 154
AF-A0A2V9QQ97-F1-model_v4 Isoprenylcysteine carboxylmethyltransferase family protein 0.9348 56 156 GO:0004671
GO:0016020
AF-A0A1Y5FDL3-F1-model_v4 Protein-S-isoprenylcysteine O-methyltransferase 0.9346 58 151 GO:0004671
GO:0016020

Map