F276381

General Info

Members Datasets Scaffolds Average Seq Length
180 143 178 159

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_866382_c1|nmdc:mga06r32_866382_c1_281_802
Length 173
Sequence VSGSQIDNQQMKGKTMTNRIEPIPSDHHTLTPHLVVKGASKAIEFYKKAFGAQEVGRLTGPDGKSIMHADLKIGNSHVFLVDEFPEMGSKGPEGGASPVTIHMYVEDVDAAFDKAVRAGAQVRMPVADMFWGDRYGILTDPFGHSWSIATHKEDLSPEEIRKRAQTACSEAAH

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2643221583 Caulobacter sp. Root655 Isolate Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
61 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
81 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
82 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
83 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
84 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
85 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
86 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
91 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
92 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
93 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
94 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
99 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
100 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
101 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
102 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
103 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
104 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
105 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
106 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
109 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
110 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
111 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
114 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
115 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
116 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
117 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
118 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
119 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
120 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
121 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
122 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
123 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
124 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
125 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
128 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
129 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
130 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
131 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
132 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
133 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
138 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
139 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
141 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
142 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
143 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.56
Metatranscriptomes 3.33
Isolates 1.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.11
Nodule 0
Rhizoplane 1.11
Rhizosphere 90
Stem 0
Stem Tuber 0
Unclassified 2.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10169614 3300003320 Unclassified 1292
2 Ga0007429J51699_1068041 3300003579 Unclassified 569
3 Ga0058862_11817544 3300004803 Bacteria 591
4 Ga0065715_10134885 3300005293 Bacteria 1947
5 Ga0065715_10589119 3300005293 Unclassified 715
6 Ga0065707_10160944 3300005295 Bacteria 1554
7 Ga0070690_100000429 3300005330 Bacteria 21302
8 Ga0070690_100165316 3300005330 Unclassified 1519
9 Ga0070690_100730493 3300005330 Bacteria 763
10 Ga0070670_100550907 3300005331 Unclassified 1029
11 Ga0070666_10542735 3300005335 Unclassified 845
12 Ga0070666_10640878 3300005335 Bacteria 777
13 Ga0070689_100000077 3300005340 Bacteria 58188
14 Ga0070689_100710215 3300005340 Bacteria 878
15 Ga0070687_100001312 3300005343 Bacteria 8688
16 Ga0070692_10355724 3300005345 Bacteria 911
17 Ga0070675_100740066 3300005354 Unclassified 897
18 Ga0070671_100283898 3300005355 Bacteria 1408
19 Ga0070673_100427618 3300005364 Unclassified 1188
20 Ga0070673_100975549 3300005364 Unclassified 788
21 Ga0070688_100000047 3300005365 Bacteria 57889
22 Ga0070667_100624084 3300005367 Bacteria 994
23 Ga0070714_100511297 3300005435 Unclassified 1146
24 Ga0070713_100084342 3300005436 Bacteria 2718
25 Ga0070694_100092369 3300005444 Bacteria 2126
26 Ga0070708_101357097 3300005445 Bacteria 664
27 Ga0070662_100602330 3300005457 Bacteria 924
28 Ga0068867_100001787 3300005459 Bacteria 14954
29 Ga0070685_10000100 3300005466 Bacteria 54253
30 Ga0070706_100347478 3300005467 Bacteria 1383
31 Ga0070706_100818607 3300005467 Bacteria 862
32 Ga0070706_101457443 3300005467 Bacteria 626
33 Ga0070707_100179327 3300005468 Unclassified 2065
34 Ga0070707_100472146 3300005468 Bacteria 1216
35 Ga0070698_100577759 3300005471 Unclassified 1064
36 Ga0070699_100069803 3300005518 Bacteria 3053
37 Ga0070684_100611964 3300005535 Bacteria 1013
38 Ga0070697_100007061 3300005536 Bacteria 8731
39 Ga0070686_100000206 3300005544 Bacteria 40820
40 Ga0070696_101051169 3300005546 Bacteria 682
41 Ga0070704_100007599 3300005549 Bacteria 6458
42 Ga0070704_101454065 3300005549 Unclassified 630
43 Ga0070704_101538305 3300005549 Bacteria 612
44 Ga0068857_101117926 3300005577 Bacteria 761
45 Ga0068859_100000188 3300005617 Bacteria 59908
46 Ga0068864_100672417 3300005618 Bacteria 1009
47 Ga0068861_100273204 3300005719 Unclassified 1452
48 Ga0068863_100483036 3300005841 Bacteria 1218
49 Ga0070717_10134412 3300006028 Bacteria 2129
50 Ga0075368_10034420 3300006042 Unclassified 1974
51 Ga0075364_10025059 3300006051 Bacteria 3794
52 Ga0070716_101121806 3300006173 Unclassified 628
53 Ga0075367_10110091 3300006178 Unclassified 1690
54 Ga0075370_10026163 3300006353 Bacteria 3231
55 Ga0075428_100008361 3300006844 Bacteria 11475
56 Ga0075428_100528593 3300006844 Bacteria 1261
57 Ga0075431_100240443 3300006847 Bacteria 1842
58 Ga0075433_10027632 3300006852 Bacteria 4814
59 Ga0075434_100019683 3300006871 Bacteria 6533
60 Ga0075434_100888244 3300006871 Bacteria 906
61 Ga0075436_100102162 3300006914 Bacteria 1997
62 Ga0097620_100000188 3300006931 Bacteria 59908
63 Ga0075435_100640382 3300007076 Unclassified 923
64 Ga0111539_10034594 3300009094 Bacteria 6124
65 Ga0111539_11483991 3300009094 Unclassified 786
66 Ga0114129_10117708 3300009147 Bacteria 3660
67 Ga0105242_11762599 3300009176 Bacteria 657
68 Ga0163162_12317485 3300013306 Unclassified 617
69 Ga0206356_10489863 3300020070 Bacteria 638
70 Ga0206356_11828742 3300020070 Bacteria 813
71 Ga0206350_10260252 3300020080 Unclassified 853
72 Ga0206354_10049109 3300020081 Bacteria 505
73 Ga0213872_10001295 3300021361 Bacteria 16702
74 Ga0213872_10111850 3300021361 Bacteria 1213
75 Ga0213874_10060850 3300021377 Bacteria 1182
76 Ga0207680_10351882 3300025903 Bacteria 1035
77 Ga0207680_10401347 3300025903 Bacteria 969
78 Ga0207684_10089231 3300025910 Unclassified 2627
79 Ga0207693_10229250 3300025915 Bacteria 1458
80 Ga0207662_10015585 3300025918 Bacteria 4279
81 Ga0207646_10141618 3300025922 Unclassified 2166
82 Ga0207646_10958231 3300025922 Unclassified 757
83 Ga0207650_11167712 3300025925 Bacteria 655
84 Ga0207700_10054416 3300025928 Bacteria 3004
85 Ga0207664_10544017 3300025929 Bacteria 1042
86 Ga0207706_10232483 3300025933 Bacteria 1613
87 Ga0207670_10000072 3300025936 Bacteria 71361
88 Ga0207670_10280997 3300025936 Bacteria 1297
89 Ga0207665_10049336 3300025939 Bacteria 2828
90 Ga0207711_10003561 3300025941 Bacteria 13492
91 Ga0207661_10208381 3300025944 Unclassified 1722
92 Ga0207651_10683543 3300025960 Bacteria 903
93 Ga0207641_11019013 3300026088 Unclassified 825
94 Ga0207648_10002143 3300026089 Bacteria 21464
95 Ga0207675_100259397 3300026118 Bacteria 1684
96 Ga0207675_100924133 3300026118 Unclassified 889
97 Ga0268265_11405735 3300028380 Bacteria 700
98 Ga0373926_0031002 3300035083 Unclassified 1885
99 Ga0373934_0013905 3300035086 Bacteria 3046
100 Ga0373953_0286003 3300035117 Unclassified 719
101 Ga0373954_0137804 3300035118 Unclassified 1190
102 Ga0373957_0024177 3300035120 Bacteria 2180
103 Ga0373943_0915357 3300035170 Unclassified 524
104 Ga0373924_0101516 3300035410 Unclassified 1238
105 Ga0373924_0326245 3300035410 Unclassified 683
106 Ga0373935_0062102 3300035692 Bacteria 2393
107 Ga0373935_0169000 3300035692 Bacteria 1495
108 Ga0373937_0060349 3300036401 Bacteria 3485
109 Ga0373937_0218806 3300036401 Bacteria 1792
110 Ga0373937_0874438 3300036401 Unclassified 847
111 Ga0373925_0121452 3300037068 Viruses 2028
112 Ga0436360_0296261 3300039438 Bacteria 1837
113 Ga0436361_0022923 3300039447 Bacteria 4238
114 Ga0436361_0428412 3300039447 Bacteria 1689
115 Ga0436361_0816619 3300039447 Unclassified 2010
116 Ga0436363_1115442 3300039450 Bacteria 3950
117 Ga0436362_1078265 3300039453 Unclassified 1021
118 Ga0439463_201874 3300042016 Bacteria 516
119 Ga0466957_0288645 3300044842 Unclassified 1100
120 Ga0466957_0498813 3300044842 Bacteria 844
121 Ga0451576_0386020 3300045051 Bacteria 1468
122 Ga0451576_0542575 3300045051 Bacteria 1222
123 Ga0466967_0953654 3300045976 Unclassified 854
124 Ga0495627_000282 3300046453 Bacteria 51175
125 Ga0495629_0054387 3300046459 Bacteria 2800
126 Ga0495638_0042618 3300046460 Bacteria 2866
127 Ga0495651_0118817 3300046462 Bacteria 1945
128 Ga0495653_0287964 3300046463 Unclassified 1076
129 Ga0495580_0053108 3300046472 Bacteria 2860
130 Ga0495580_0097157 3300046472 Bacteria 2048
131 Ga0495662_0303192 3300046476 Unclassified 786
132 Ga0495594_0051613 3300046499 Bacteria 2263
133 Ga0495610_0003984 3300046512 Bacteria 11160
134 Ga0495630_0746022 3300046517 Unclassified 748
135 Ga0495663_0301002 3300046525 Bacteria 577
136 Ga0495652_0453123 3300046529 Unclassified 898
137 Ga0495665_0113168 3300046531 Bacteria 1423
138 Ga0495587_0007331 3300046536 Bacteria 7149
139 Ga0495645_0000200 3300046543 Bacteria 42743
140 Ga0495625_0000198 3300046660 Bacteria 95530
141 Ga0495625_0003180 3300046660 Bacteria 16710
142 Ga0495635_0044423 3300046663 Viruses 3066
143 Ga0495635_0252625 3300046663 Unclassified 1188
144 Ga0495635_0313852 3300046663 Unclassified 1050
145 Ga0495657_0141780 3300046675 Unclassified 1497
146 Ga0495599_0061548 3300046678 Bacteria 2346
147 Ga0495623_0014500 3300046679 Bacteria 5100
148 Ga0495623_0066989 3300046679 Bacteria 2242
149 Ga0495589_0010303 3300046794 Bacteria 4856
150 Ga0495600_0101866 3300046809 Bacteria 1871
151 Ga0495581_0221977 3300047315 Bacteria 1105
152 Ga0495680_0023773 3300047322 Bacteria 5093
153 Ga0495675_0457138 3300047444 Unclassified 738
154 Ga0495679_008827 3300047446 Bacteria 4069
155 Ga0495673_0000287 3300047469 Bacteria 67754
156 Ga0495686_0180158 3300047472 Bacteria 1224
157 Ga0496106_0001458 3300048909 Bacteria 17766
158 Ga0496107_0000038 3300048910 Bacteria 78077
159 Ga0496121_0004229 3300048924 Bacteria 19545
160 nmdc:mga03n38_454049_c1 3300050490 Bacteria 713
161 nmdc:mga00v17_6416_c1 3300050491 Bacteria 6238
162 nmdc:mga0yw44_577052_c1 3300050492 Bacteria 764
163 nmdc:mga0k408_2454_c1 3300050493 Bacteria 9857
164 nmdc:mga05p37_1618272_c1 3300050507 Bacteria 637
165 nmdc:mga06r32_866382_c1 3300050510 Bacteria 861
166 nmdc:mga08y16_85951_c1 3300050511 Bacteria 3278
167 nmdc:mga0n895_62690_c1 3300050512 Bacteria 3675
168 nmdc:mga0n895_965536_c1 3300050512 Bacteria 835
169 nmdc:mga08x19_322414_c1 3300050514 Bacteria 1075
170 nmdc:mga0a205_24068_c1 3300050515 Bacteria 5783
171 Ga0495601_0013036 3300053077 Bacteria 4995
172 Ga0495619_0031086 3300053085 Viruses 3458
173 Ga0495619_0221577 3300053085 Bacteria 1310
174 Ga0495619_0492347 3300053085 Unclassified 843
175 Ga0495619_1124829 3300053085 Bacteria 522
176 Ga0500643_039824 3300053087 Bacteria 1386
177 Ga0500559_0000087 3300053136 Bacteria 73682
178 Ga0500634_0207297 3300053161 Bacteria 855

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046460 Ga0495638_0042618 Ga0495638_0042618_2417_2833 132
2 3300046512 Ga0495610_0003984 Ga0495610_0003984_2735_3196 132
3 3300047472 Ga0495686_0180158 Ga0495686_0180158_254_715 132
4 3300053161 Ga0500634_0207297 Ga0500634_0207297_105_521 132
5 3300046453 Ga0495627_000282 Ga0495627_000282_43147_43566 133
6 3300046525 Ga0495663_0301002 Ga0495663_0301002_137_556 133
7 3300046660 Ga0495625_0000198 Ga0495625_0000198_38772_39194 133
8 3300046660 Ga0495625_0003180 Ga0495625_0003180_11164_11592 133
9 3300046794 Ga0495589_0010303 Ga0495589_0010303_1219_1638 133
10 3300047446 Ga0495679_008827 Ga0495679_008827_128_547 133
11 3300047469 Ga0495673_0000287 Ga0495673_0000287_26202_26621 133
12 3300048909 Ga0496106_0001458 Ga0496106_0001458_7883_8305 133
13 3300048910 Ga0496107_0000038 Ga0496107_0000038_43064_43486 133
14 3300048924 Ga0496121_0004229 Ga0496121_0004229_2458_2880 133
15 3300053136 Ga0500559_0000087 Ga0500559_0000087_39476_39895 133
16 iso_pu_bacteria 2510917020 2511120702 133
17 iso_pu_bacteria 2643221583 2643924136 133
18 3300045976 Ga0466967_0953654 Ga0466967_0953654_158_622 143
19 3300050507 nmdc:mga05p37_1618272_c1 nmdc:mga05p37_1618272_c1_15_452 144
20 3300005330 Ga0070690_100730493 Ga0070690_1007304931 145
21 3300005335 Ga0070666_10640878 Ga0070666_106408782 145
22 3300005355 Ga0070671_100283898 Ga0070671_1002838981 145
23 3300005364 Ga0070673_100427618 Ga0070673_1004276181 145
24 3300005367 Ga0070667_100624084 Ga0070667_1006240842 145
25 3300005841 Ga0068863_100483036 Ga0068863_1004830362 145
26 3300025903 Ga0207680_10401347 Ga0207680_104013472 145
27 3300025960 Ga0207651_10683543 Ga0207651_106835432 145
28 3300005577 Ga0068857_101117926 Ga0068857_1011179262 147
29 3300025936 Ga0207670_10280997 Ga0207670_102809972 147
30 3300021377 Ga0213874_10060850 Ga0213874_100608502 149
31 3300039450 Ga0436363_1115442 Ga0436363_1115442_3152_3604 149
32 3300005546 Ga0070696_101051169 Ga0070696_1010511691 151
33 3300005436 Ga0070713_100084342 Ga0070713_1000843424 152
34 3300025928 Ga0207700_10054416 Ga0207700_100544162 152
35 3300026118 Ga0207675_100259397 Ga0207675_1002593973 152
36 3300035170 Ga0373943_0915357 Ga0373943_0915357_36_497 152
37 3300044842 Ga0466957_0288645 Ga0466957_0288645_349_810 152
38 3300046472 Ga0495580_0053108 Ga0495580_0053108_1822_2283 152
39 3300046472 Ga0495580_0097157 Ga0495580_0097157_1120_1581 152
40 3300046531 Ga0495665_0113168 Ga0495665_0113168_126_587 152
41 3300046679 Ga0495623_0066989 Ga0495623_0066989_856_1335 152
42 3300047444 Ga0495675_0457138 Ga0495675_0457138_208_687 152
43 3300005345 Ga0070692_10355724 Ga0070692_103557242 153
44 3300005435 Ga0070714_100511297 Ga0070714_1005112972 153
45 3300005457 Ga0070662_100602330 Ga0070662_1006023302 153
46 3300020070 Ga0206356_11828742 Ga0206356_118287422 153
47 3300020081 Ga0206354_10049109 Ga0206354_100491091 153
48 3300025915 Ga0207693_10229250 Ga0207693_102292502 153
49 3300025929 Ga0207664_10544017 Ga0207664_105440171 153
50 3300025933 Ga0207706_10232483 Ga0207706_102324832 153
51 3300036401 Ga0373937_0060349 Ga0373937_0060349_1769_2311 153
52 3300036401 Ga0373937_0874438 Ga0373937_0874438_291_761 153
53 3300042016 Ga0439463_201874 Ga0439463_201874_40_501 153
54 3300046462 Ga0495651_0118817 Ga0495651_0118817_323_793 153
55 3300046663 Ga0495635_0313852 Ga0495635_0313852_522_992 153
56 3300053087 Ga0500643_039824 Ga0500643_039824_483_953 153
57 3300003579 Ga0007429J51699_1068041 Ga0007429J51699_10680411 154
58 3300004803 Ga0058862_11817544 Ga0058862_118175441 154
59 3300005331 Ga0070670_100550907 Ga0070670_1005509071 154
60 3300005335 Ga0070666_10542735 Ga0070666_105427351 154
61 3300005354 Ga0070675_100740066 Ga0070675_1007400661 154
62 3300005467 Ga0070706_101457443 Ga0070706_1014574432 154
63 3300005535 Ga0070684_100611964 Ga0070684_1006119642 154
64 3300006042 Ga0075368_10034420 Ga0075368_100344202 154
65 3300006051 Ga0075364_10025059 Ga0075364_100250592 154
66 3300006178 Ga0075367_10110091 Ga0075367_101100912 154
67 3300006353 Ga0075370_10026163 Ga0075370_100261632 154
68 3300009176 Ga0105242_11762599 Ga0105242_117625991 154
69 3300013306 Ga0163162_12317485 Ga0163162_123174851 154
70 3300020070 Ga0206356_10489863 Ga0206356_104898631 154
71 3300025903 Ga0207680_10351882 Ga0207680_103518822 154
72 3300025925 Ga0207650_11167712 Ga0207650_111677121 154
73 3300025944 Ga0207661_10208381 Ga0207661_102083811 154
74 3300035086 Ga0373934_0013905 Ga0373934_0013905_2465_2959 154
75 3300035118 Ga0373954_0137804 Ga0373954_0137804_599_1093 154
76 3300035120 Ga0373957_0024177 Ga0373957_0024177_1343_1837 154
77 3300035410 Ga0373924_0326245 Ga0373924_0326245_41_535 154
78 3300044842 Ga0466957_0498813 Ga0466957_0498813_315_800 154
79 3300046476 Ga0495662_0303192 Ga0495662_0303192_80_574 154
80 3300046536 Ga0495587_0007331 Ga0495587_0007331_571_1065 154
81 3300046543 Ga0495645_0000200 Ga0495645_0000200_4521_5015 154
82 3300046678 Ga0495599_0061548 Ga0495599_0061548_1283_1777 154
83 3300046679 Ga0495623_0014500 Ga0495623_0014500_1392_1886 154
84 3300046809 Ga0495600_0101866 Ga0495600_0101866_279_773 154
85 3300050490 nmdc:mga03n38_454049_c1 nmdc:mga03n38_454049_c1_195_692 154
86 3300050491 nmdc:mga00v17_6416_c1 nmdc:mga00v17_6416_c1_2242_2739 154
87 3300050492 nmdc:mga0yw44_577052_c1 nmdc:mga0yw44_577052_c1_178_675 154
88 3300050493 nmdc:mga0k408_2454_c1 nmdc:mga0k408_2454_c1_7940_8437 154
89 3300050510 nmdc:mga06r32_866382_c1 nmdc:mga06r32_866382_c1_281_802 154
90 3300053085 Ga0495619_0221577 Ga0495619_0221577_793_1284 154
91 3300005293 Ga0065715_10589119 Ga0065715_105891191 155
92 3300005330 Ga0070690_100000429 Ga0070690_10000042917 155
93 3300005340 Ga0070689_100000077 Ga0070689_10000007720 155
94 3300005343 Ga0070687_100001312 Ga0070687_10000131211 155
95 3300005364 Ga0070673_100975549 Ga0070673_1009755491 155
96 3300005365 Ga0070688_100000047 Ga0070688_10000004738 155
97 3300005444 Ga0070694_100092369 Ga0070694_1000923692 155
98 3300005445 Ga0070708_101357097 Ga0070708_1013570971 155
99 3300005459 Ga0068867_100001787 Ga0068867_10000178714 155
100 3300005466 Ga0070685_10000100 Ga0070685_1000010016 155
101 3300005467 Ga0070706_100818607 Ga0070706_1008186072 155
102 3300005518 Ga0070699_100069803 Ga0070699_1000698033 155
103 3300005536 Ga0070697_100007061 Ga0070697_1000070619 155
104 3300005544 Ga0070686_100000206 Ga0070686_1000002069 155
105 3300005549 Ga0070704_101454065 Ga0070704_1014540651 155
106 3300005549 Ga0070704_101538305 Ga0070704_1015383051 155
107 3300005617 Ga0068859_100000188 Ga0068859_10000018843 155
108 3300005618 Ga0068864_100672417 Ga0068864_1006724172 155
109 3300005719 Ga0068861_100273204 Ga0068861_1002732041 155
110 3300006844 Ga0075428_100008361 Ga0075428_1000083619 155
111 3300006844 Ga0075428_100528593 Ga0075428_1005285932 155
112 3300006847 Ga0075431_100240443 Ga0075431_1002404432 155
113 3300006871 Ga0075434_100888244 Ga0075434_1008882442 155
114 3300006931 Ga0097620_100000188 Ga0097620_10000018843 155
115 3300009094 Ga0111539_10034594 Ga0111539_100345946 155
116 3300009147 Ga0114129_10117708 Ga0114129_101177083 155
117 3300025918 Ga0207662_10015585 Ga0207662_100155854 155
118 3300025936 Ga0207670_10000072 Ga0207670_1000007245 155
119 3300025939 Ga0207665_10049336 Ga0207665_100493362 155
120 3300025941 Ga0207711_10003561 Ga0207711_1000356112 155
121 3300026088 Ga0207641_11019013 Ga0207641_110190132 155
122 3300026089 Ga0207648_10002143 Ga0207648_1000214315 155
123 3300026118 Ga0207675_100924133 Ga0207675_1009241332 155
124 3300028380 Ga0268265_11405735 Ga0268265_114057352 155
125 3300035692 Ga0373935_0169000 Ga0373935_0169000_218_685 155
126 3300045051 Ga0451576_0386020 Ga0451576_0386020_621_1115 155
127 3300050511 nmdc:mga08y16_85951_c1 nmdc:mga08y16_85951_c1_406_885 155
128 3300050512 nmdc:mga0n895_965536_c1 nmdc:mga0n895_965536_c1_240_719 155
129 3300050514 nmdc:mga08x19_322414_c1 nmdc:mga08x19_322414_c1_517_1029 155
130 3300053085 Ga0495619_1124829 Ga0495619_1124829_30_497 155
131 3300005293 Ga0065715_10134885 Ga0065715_101348852 156
132 3300005295 Ga0065707_10160944 Ga0065707_101609442 156
133 3300005330 Ga0070690_100165316 Ga0070690_1001653161 156
134 3300005340 Ga0070689_100710215 Ga0070689_1007102152 156
135 3300005467 Ga0070706_100347478 Ga0070706_1003474781 156
136 3300005468 Ga0070707_100179327 Ga0070707_1001793271 156
137 3300005468 Ga0070707_100472146 Ga0070707_1004721461 156
138 3300005471 Ga0070698_100577759 Ga0070698_1005777592 156
139 3300005549 Ga0070704_100007599 Ga0070704_10000759911 156
140 3300006028 Ga0070717_10134412 Ga0070717_101344121 156
141 3300006173 Ga0070716_101121806 Ga0070716_1011218061 156
142 3300006852 Ga0075433_10027632 Ga0075433_100276323 156
143 3300006871 Ga0075434_100019683 Ga0075434_1000196832 156
144 3300006914 Ga0075436_100102162 Ga0075436_1001021622 156
145 3300007076 Ga0075435_100640382 Ga0075435_1006403822 156
146 3300009094 Ga0111539_11483991 Ga0111539_114839911 156
147 3300020080 Ga0206350_10260252 Ga0206350_102602521 156
148 3300021361 Ga0213872_10001295 Ga0213872_100012958 156
149 3300021361 Ga0213872_10111850 Ga0213872_101118501 156
150 3300025910 Ga0207684_10089231 Ga0207684_100892313 156
151 3300025922 Ga0207646_10141618 Ga0207646_101416182 156
152 3300025922 Ga0207646_10958231 Ga0207646_109582311 156
153 3300035083 Ga0373926_0031002 Ga0373926_0031002_545_1033 156
154 3300035117 Ga0373953_0286003 Ga0373953_0286003_183_668 156
155 3300035410 Ga0373924_0101516 Ga0373924_0101516_292_777 156
156 3300035692 Ga0373935_0062102 Ga0373935_0062102_1072_1557 156
157 3300036401 Ga0373937_0218806 Ga0373937_0218806_1292_1780 156
158 3300037068 Ga0373925_0121452 Ga0373925_0121452_655_1143 156
159 3300039438 Ga0436360_0296261 Ga0436360_0296261_907_1392 156
160 3300039447 Ga0436361_0022923 Ga0436361_0022923_1221_1715 156
161 3300039447 Ga0436361_0428412 Ga0436361_0428412_631_1116 156
162 3300039447 Ga0436361_0816619 Ga0436361_0816619_991_1485 156
163 3300039453 Ga0436362_1078265 Ga0436362_1078265_484_969 156
164 3300045051 Ga0451576_0542575 Ga0451576_0542575_590_1066 156
165 3300046459 Ga0495629_0054387 Ga0495629_0054387_1756_2328 156
166 3300046463 Ga0495653_0287964 Ga0495653_0287964_27_515 156
167 3300046499 Ga0495594_0051613 Ga0495594_0051613_1298_1870 156
168 3300046517 Ga0495630_0746022 Ga0495630_0746022_183_671 156
169 3300046529 Ga0495652_0453123 Ga0495652_0453123_209_781 156
170 3300046663 Ga0495635_0044423 Ga0495635_0044423_1078_1566 156
171 3300046663 Ga0495635_0252625 Ga0495635_0252625_591_1163 156
172 3300046675 Ga0495657_0141780 Ga0495657_0141780_731_1219 156
173 3300047315 Ga0495581_0221977 Ga0495581_0221977_542_1030 156
174 3300047322 Ga0495680_0023773 Ga0495680_0023773_4038_4526 156
175 3300050512 nmdc:mga0n895_62690_c1 nmdc:mga0n895_62690_c1_2161_2649 156
176 3300050515 nmdc:mga0a205_24068_c1 nmdc:mga0a205_24068_c1_3130_3618 156
177 3300053077 Ga0495601_0013036 Ga0495601_0013036_1135_1707 156
178 3300053085 Ga0495619_0031086 Ga0495619_0031086_2140_2628 156
179 3300053085 Ga0495619_0492347 Ga0495619_0492347_285_773 156
180 3300003320 rootH2_10169614 rootH2_101696141 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

26

148

0.95

PF22656

At5g48480-like_N

Glyoxalase At5g48480-like, N-terminal domain

34

83

0.85

PF18029

Glyoxalase_6

Glyoxalase-like domain

33

149

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pav-assembly4.cif.gz_D structure of hypothetical protein sa1046 from s. aureus. 0.819 10 132
1xy7-assembly1.cif.gz_B x-ray structure of gene product from arabidopsis thaliana at5g48480 0.8058 10 131
1r9c-assembly1.cif.gz_B crystal structure of fosfomycin resistance protein fosx from mesorhizobium loti 0.7958 10 134
1xy7-assembly1.cif.gz_A x-ray structure of gene product from arabidopsis thaliana at5g48480 0.7927 10 130
3itw-assembly1.cif.gz_A-2 crystal structure of tiox from micromonospora sp. ml1 0.7905 10 134
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9862 80 146 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9581 80 146 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8578 79 134 3.30.720.110
af_Q5VMX8_15_124_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8521 15 134 3.10.180.10
2pjsB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8473 83 131 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A1F9NFM5-F1-model_v4 Glyoxalase 0.9868 3 133
AF-A0A2V9Z9R7-F1-model_v4 Glyoxalase 0.9866 3 128
AF-K0DJY8-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9865 3 149 GO:0051213
AF-A0A7L5XV51-F1-model_v4 VOC family protein 0.9838 11 152
AF-Q7NM17-F1-model_v4 Glr0952 protein 0.9826 10 149

Feature Viewer

pLDDT pTM Quality
91.8 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map