F276303
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 180 | 145 | 173 | 260 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0048378|Ga0501034_0048378_2268_3104 |
| Length | 278 |
| Sequence | LSEIRHQSVASAIRHALLTAEPTAKVFAARDVARRWRLGRLDWRFDAAMPERPAWPAEPELLSPGRMPRRGKAGSERGRIALWHALAHIEFVAIDLALDMAGRFGAEMGRAFVSDFLAVAADEAMHFALLDRKLRKLGSRYGALPAHDGLWEAANETRHDVRARLAVVPMVLEARGLDVTPATRDRARAQGDEDGARILERILDDEIRHVRLGTEHFIARCEAMGENPPDCWKMLVKSHFRGVLKPPFNDSARSAAGLSRDFYASLASRAQAPLPHNH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 2 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 3 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 4 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 5 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 6 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 7 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 35 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 36 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 52 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 55 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 86 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 87 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 88 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 89 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 90 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 91 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 92 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 93 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 94 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 95 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 96 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 97 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 98 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 99 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 100 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 101 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 102 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 103 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 104 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 105 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 106 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 107 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 108 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 117 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 118 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 119 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 120 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 121 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 122 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 123 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 124 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 125 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 126 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 127 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 129 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 130 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 131 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 132 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 133 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 134 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 135 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 136 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 137 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 138 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 139 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 140 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 141 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 142 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 143 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 144 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 145 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.11 |
| Metatranscriptomes | 0 |
| Isolates | 3.89 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 1.11 |
| Bulb | 0 |
| Endosphere | 15 |
| Nodule | 0 |
| Rhizoplane | 0.56 |
| Rhizosphere | 70 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10007879 | 3300001989 | Bacteria | 3986 |
| 2 | JGI24737J22298_10001855 | 3300001990 | Bacteria | 7552 |
| 3 | JGI24737J22298_10006510 | 3300001990 | Bacteria | 3986 |
| 4 | JGI24735J21928_10012949 | 3300002067 | Bacteria | 2631 |
| 5 | JGI24738J21930_10000191 | 3300002075 | Bacteria | 16065 |
| 6 | rootH1_10054557 | 3300003316 | Bacteria | 3654 |
| 7 | rootH1_10048414 | 3300003323 | Bacteria | 1987 |
| 8 | Ga0055542_1002329 | 3300003762 | Bacteria | 6526 |
| 9 | Ga0055536_1002483 | 3300003781 | Bacteria | 10345 |
| 10 | Ga0055534_1005372 | 3300003784 | Bacteria | 3442 |
| 11 | Ga0055530_10000083 | 3300003791 | Bacteria | 81772 |
| 12 | Ga0055531_10003248 | 3300003794 | Bacteria | 10438 |
| 13 | Ga0070658_10000416 | 3300005327 | Bacteria | 36945 |
| 14 | Ga0070658_10162004 | 3300005327 | Bacteria | 1877 |
| 15 | Ga0070676_10001153 | 3300005328 | Bacteria | 13201 |
| 16 | Ga0068869_100000060 | 3300005334 | Bacteria | 48712 |
| 17 | Ga0068868_100000278 | 3300005338 | Bacteria | 34336 |
| 18 | Ga0070660_100008065 | 3300005339 | Bacteria | 7360 |
| 19 | Ga0070660_100061443 | 3300005339 | Bacteria | 2917 |
| 20 | Ga0070674_100379793 | 3300005356 | Bacteria | 1149 |
| 21 | Ga0070673_100000019 | 3300005364 | Bacteria | 107024 |
| 22 | Ga0070659_100106971 | 3300005366 | Bacteria | 2255 |
| 23 | Ga0070667_100000051 | 3300005367 | Bacteria | 155117 |
| 24 | Ga0070663_100144610 | 3300005455 | Bacteria | 1818 |
| 25 | Ga0070662_100006590 | 3300005457 | Bacteria | 7493 |
| 26 | Ga0070662_100141910 | 3300005457 | Bacteria | 1862 |
| 27 | Ga0068867_100000014 | 3300005459 | Bacteria | 112097 |
| 28 | Ga0070679_100009737 | 3300005530 | Bacteria | 9089 |
| 29 | Ga0070679_100099787 | 3300005530 | Bacteria | 2890 |
| 30 | Ga0068857_100385641 | 3300005577 | Bacteria | 1302 |
| 31 | Ga0068852_100007362 | 3300005616 | Bacteria | 8029 |
| 32 | Ga0068852_100053480 | 3300005616 | Bacteria | 3476 |
| 33 | Ga0068860_100002843 | 3300005843 | Bacteria | 17969 |
| 34 | Ga0068860_100076475 | 3300005843 | Bacteria | 3184 |
| 35 | Ga0068865_100000018 | 3300006881 | Bacteria | 106975 |
| 36 | Ga0105245_10000635 | 3300009098 | Bacteria | 31928 |
| 37 | Ga0114129_10079310 | 3300009147 | Bacteria | 4566 |
| 38 | Ga0105243_10000076 | 3300009148 | Bacteria | 110445 |
| 39 | Ga0105243_10279461 | 3300009148 | Bacteria | 1503 |
| 40 | Ga0105242_10000783 | 3300009176 | Bacteria | 24671 |
| 41 | Ga0105246_10001209 | 3300011119 | Bacteria | 15110 |
| 42 | Ga0157371_10176607 | 3300013102 | Bacteria | 1527 |
| 43 | Ga0157370_10000201 | 3300013104 | Bacteria | 75437 |
| 44 | Ga0157370_10197784 | 3300013104 | Bacteria | 1865 |
| 45 | Ga0157370_10265845 | 3300013104 | Bacteria | 1585 |
| 46 | Ga0157369_10009403 | 3300013105 | Bacteria | 11174 |
| 47 | Ga0157374_10021034 | 3300013296 | Bacteria | 5798 |
| 48 | Ga0157378_10005339 | 3300013297 | Bacteria | 11274 |
| 49 | Ga0157372_10142208 | 3300013307 | Bacteria | 2765 |
| 50 | Ga0157375_10104109 | 3300013308 | Bacteria | 2926 |
| 51 | Ga0157377_10007395 | 3300014745 | Bacteria | 5301 |
| 52 | Ga0157376_10000091 | 3300014969 | Bacteria | 68377 |
| 53 | Ga0207427_100849 | 3300025231 | Bacteria | 13643 |
| 54 | Ga0209026_1001484 | 3300025250 | Bacteria | 10313 |
| 55 | Ga0209148_1000301 | 3300025254 | Bacteria | 71452 |
| 56 | Ga0209233_1000003 | 3300025261 | Bacteria | 1607366 |
| 57 | Ga0209675_1000184 | 3300025291 | Bacteria | 70175 |
| 58 | Ga0209676_1000133 | 3300025292 | Bacteria | 184430 |
| 59 | Ga0209025_1021511 | 3300025294 | Bacteria | 3470 |
| 60 | Ga0209050_1000067 | 3300025298 | Bacteria | 304206 |
| 61 | Ga0209257_1000132 | 3300025304 | Bacteria | 210870 |
| 62 | Ga0207647_10001397 | 3300025904 | Bacteria | 18543 |
| 63 | Ga0207645_10003552 | 3300025907 | Bacteria | 11800 |
| 64 | Ga0207705_10000007 | 3300025909 | Bacteria | 597387 |
| 65 | Ga0207705_10005106 | 3300025909 | Bacteria | 9841 |
| 66 | Ga0207705_10030996 | 3300025909 | Bacteria | 3816 |
| 67 | Ga0207695_10010515 | 3300025913 | Bacteria | 11317 |
| 68 | Ga0207657_10007179 | 3300025919 | Bacteria | 11437 |
| 69 | Ga0207657_10067095 | 3300025919 | Bacteria | 3052 |
| 70 | Ga0207652_10043388 | 3300025921 | Bacteria | 3829 |
| 71 | Ga0207652_10317793 | 3300025921 | Bacteria | 1406 |
| 72 | Ga0207681_10585236 | 3300025923 | Bacteria | 921 |
| 73 | Ga0207687_10009999 | 3300025927 | Bacteria | 6207 |
| 74 | Ga0207690_10042908 | 3300025932 | Bacteria | 2974 |
| 75 | Ga0207706_10011554 | 3300025933 | Bacteria | 8040 |
| 76 | Ga0207706_10718090 | 3300025933 | Bacteria | 853 |
| 77 | Ga0207686_10000531 | 3300025934 | Bacteria | 24671 |
| 78 | Ga0207709_10000114 | 3300025935 | Bacteria | 124672 |
| 79 | Ga0207669_10185464 | 3300025937 | Bacteria | 1496 |
| 80 | Ga0207704_10000008 | 3300025938 | Bacteria | 204682 |
| 81 | Ga0207689_10000086 | 3300025942 | Bacteria | 75369 |
| 82 | Ga0207661_10220066 | 3300025944 | Bacteria | 1678 |
| 83 | Ga0207667_10000024 | 3300025949 | Bacteria | 355874 |
| 84 | Ga0207651_10000008 | 3300025960 | Bacteria | 204538 |
| 85 | Ga0207677_10002827 | 3300026023 | Bacteria | 9151 |
| 86 | Ga0207678_10024686 | 3300026067 | Bacteria | 5249 |
| 87 | Ga0207708_10152266 | 3300026075 | Bacteria | 1822 |
| 88 | Ga0207702_10015092 | 3300026078 | Bacteria | 6404 |
| 89 | Ga0207648_10000009 | 3300026089 | Bacteria | 204229 |
| 90 | Ga0207674_10508721 | 3300026116 | Bacteria | 1163 |
| 91 | Ga0207698_10000214 | 3300026142 | Bacteria | 36073 |
| 92 | Ga0207698_10036024 | 3300026142 | Bacteria | 3627 |
| 93 | Ga0268264_10046516 | 3300028381 | Bacteria | 3604 |
| 94 | Ga0316576_10430616 | 3300031727 | Bacteria | 976 |
| 95 | Ga0307405_10011064 | 3300031731 | Bacteria | 4710 |
| 96 | Ga0307413_10009551 | 3300031824 | Bacteria | 4650 |
| 97 | Ga0307412_10006545 | 3300031911 | Bacteria | 6594 |
| 98 | Ga0307412_10067701 | 3300031911 | Bacteria | 2425 |
| 99 | Ga0307412_10431810 | 3300031911 | Bacteria | 1080 |
| 100 | Ga0307416_100268755 | 3300032002 | Bacteria | 1672 |
| 101 | Ga0307411_10061722 | 3300032005 | Bacteria | 2497 |
| 102 | Ga0307411_10141938 | 3300032005 | Bacteria | 1772 |
| 103 | Ga0316583_10008304 | 3300032133 | Bacteria | 3743 |
| 104 | Ga0395899_0017328 | 3300037312 | Bacteria | 5490 |
| 105 | Ga0395900_0345872 | 3300037418 | Bacteria | 1461 |
| 106 | Ga0395905_0341548 | 3300037471 | Bacteria | 1388 |
| 107 | Ga0439455_0003649 | 3300042012 | Bacteria | 2969 |
| 108 | Ga0439462_0006109 | 3300042015 | Bacteria | 2985 |
| 109 | Ga0439458_0013290 | 3300042157 | Bacteria | 1852 |
| 110 | Ga0466965_0005290 | 3300044683 | Bacteria | 5807 |
| 111 | Ga0466961_0002125 | 3300044693 | Bacteria | 12324 |
| 112 | Ga0466964_0026252 | 3300044706 | Bacteria | 2279 |
| 113 | Ga0466964_0035487 | 3300044706 | Bacteria | 1994 |
| 114 | Ga0466971_0022507 | 3300044719 | Bacteria | 2808 |
| 115 | Ga0466968_0050891 | 3300044735 | Bacteria | 1769 |
| 116 | Ga0466957_0026916 | 3300044842 | Bacteria | 3414 |
| 117 | Ga0466960_0041499 | 3300044901 | Bacteria | 2180 |
| 118 | Ga0466959_0009165 | 3300045049 | Bacteria | 7027 |
| 119 | Ga0466958_0019250 | 3300045836 | Bacteria | 3973 |
| 120 | Ga0466958_0034165 | 3300045836 | Bacteria | 3032 |
| 121 | Ga0466967_0215566 | 3300045976 | Bacteria | 1822 |
| 122 | Ga0495638_0036829 | 3300046460 | Bacteria | 3114 |
| 123 | Ga0495596_0010460 | 3300046500 | Bacteria | 4040 |
| 124 | Ga0495583_0000010 | 3300046506 | Bacteria | 353523 |
| 125 | Ga0495610_0003757 | 3300046512 | Bacteria | 11619 |
| 126 | Ga0495643_0022188 | 3300046522 | Bacteria | 3626 |
| 127 | Ga0495670_0008746 | 3300046691 | Bacteria | 4982 |
| 128 | Ga0495673_0003476 | 3300047469 | Bacteria | 10361 |
| 129 | Ga0495686_0000278 | 3300047472 | Bacteria | 90520 |
| 130 | Ga0495686_0001670 | 3300047472 | Bacteria | 23070 |
| 131 | Ga0495686_0002307 | 3300047472 | Bacteria | 18248 |
| 132 | Ga0495686_0071693 | 3300047472 | Bacteria | 2132 |
| 133 | Ga0496103_0000026 | 3300048906 | Bacteria | 213826 |
| 134 | Ga0496116_0002728 | 3300048919 | Bacteria | 18149 |
| 135 | Ga0496117_0000072 | 3300048920 | Bacteria | 238366 |
| 136 | Ga0496117_0018514 | 3300048920 | Bacteria | 5762 |
| 137 | Ga0496118_0000030 | 3300048921 | Bacteria | 339946 |
| 138 | Ga0496118_0124146 | 3300048921 | Bacteria | 1675 |
| 139 | Ga0496119_0023412 | 3300048922 | Bacteria | 4380 |
| 140 | Ga0496119_0033138 | 3300048922 | Bacteria | 3431 |
| 141 | Ga0496120_0051969 | 3300048923 | Bacteria | 2337 |
| 142 | Ga0496121_0000024 | 3300048924 | Bacteria | 462959 |
| 143 | Ga0496121_0030549 | 3300048924 | Bacteria | 4946 |
| 144 | Ga0496122_0010024 | 3300048925 | Bacteria | 9856 |
| 145 | Ga0496122_0011368 | 3300048925 | Bacteria | 9023 |
| 146 | Ga0496123_0001685 | 3300048926 | Bacteria | 29584 |
| 147 | Ga0496123_0008335 | 3300048926 | Bacteria | 9538 |
| 148 | Ga0496123_0090934 | 3300048926 | Bacteria | 1812 |
| 149 | Ga0496124_0000061 | 3300048927 | Bacteria | 238225 |
| 150 | Ga0496124_0078329 | 3300048927 | Bacteria | 2724 |
| 151 | Ga0496124_0293025 | 3300048927 | Bacteria | 1180 |
| 152 | Ga0496125_0010616 | 3300048928 | Bacteria | 9301 |
| 153 | Ga0496125_0123472 | 3300048928 | Bacteria | 1840 |
| 154 | Ga0495682_0070475 | 3300049460 | Bacteria | 1258 |
| 155 | Ga0501034_0048378 | 3300049571 | Bacteria | 4292 |
| 156 | Ga0501042_0408843 | 3300049578 | Bacteria | 983 |
| 157 | nmdc:mga05p37_132234_c1 | 3300050507 | Bacteria | 3061 |
| 158 | nmdc:mga0qj67_35400_c1 | 3300050509 | Bacteria | 3903 |
| 159 | Ga0500643_000555 | 3300053087 | Bacteria | 25933 |
| 160 | Ga0500566_0029914 | 3300053094 | Bacteria | 3179 |
| 161 | Ga0500555_000502 | 3300053103 | Bacteria | 15868 |
| 162 | Ga0500562_011475 | 3300053108 | Bacteria | 2250 |
| 163 | Ga0500592_000215 | 3300053116 | Bacteria | 10605 |
| 164 | Ga0500607_000001 | 3300053121 | Bacteria | 185408 |
| 165 | Ga0500559_0001383 | 3300053136 | Bacteria | 13830 |
| 166 | Ga0500559_0022285 | 3300053136 | Bacteria | 2686 |
| 167 | Ga0500568_0009797 | 3300053139 | Bacteria | 4529 |
| 168 | Ga0500588_0013008 | 3300053146 | Bacteria | 2079 |
| 169 | Ga0500604_0030916 | 3300053151 | Bacteria | 1569 |
| 170 | Ga0500637_0003151 | 3300053178 | Bacteria | 7540 |
| 171 | Ga0500611_027884 | 3300053727 | Bacteria | 1141 |
| 172 | Ga0500645_003318 | 3300053730 | Bacteria | 6607 |
| 173 | Ga0466962_0000844 | 3300061719 | Bacteria | 13832 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005339 | Ga0070660_100061443 | Ga0070660_1000614433 | 224 |
| 2 | 3300005455 | Ga0070663_100144610 | Ga0070663_1001446103 | 224 |
| 3 | 3300005530 | Ga0070679_100099787 | Ga0070679_1000997873 | 224 |
| 4 | 3300025909 | Ga0207705_10030996 | Ga0207705_100309965 | 224 |
| 5 | 3300025921 | Ga0207652_10043388 | Ga0207652_100433883 | 224 |
| 6 | 3300026067 | Ga0207678_10024686 | Ga0207678_100246863 | 224 |
| 7 | 3300005328 | Ga0070676_10001153 | Ga0070676_100011535 | 231 |
| 8 | 3300005334 | Ga0068869_100000060 | Ga0068869_10000006023 | 231 |
| 9 | 3300005338 | Ga0068868_100000278 | Ga0068868_10000027815 | 231 |
| 10 | 3300005364 | Ga0070673_100000019 | Ga0070673_10000001921 | 231 |
| 11 | 3300005459 | Ga0068867_100000014 | Ga0068867_10000001425 | 231 |
| 12 | 3300006881 | Ga0068865_100000018 | Ga0068865_10000001892 | 231 |
| 13 | 3300009098 | Ga0105245_10000635 | Ga0105245_1000063524 | 231 |
| 14 | 3300009148 | Ga0105243_10000076 | Ga0105243_10000076102 | 231 |
| 15 | 3300009176 | Ga0105242_10000783 | Ga0105242_1000078328 | 231 |
| 16 | 3300011119 | Ga0105246_10001209 | Ga0105246_1000120913 | 231 |
| 17 | 3300013296 | Ga0157374_10021034 | Ga0157374_100210345 | 231 |
| 18 | 3300013297 | Ga0157378_10005339 | Ga0157378_100053395 | 231 |
| 19 | 3300013308 | Ga0157375_10104109 | Ga0157375_101041092 | 231 |
| 20 | 3300014745 | Ga0157377_10007395 | Ga0157377_100073955 | 231 |
| 21 | 3300014969 | Ga0157376_10000091 | Ga0157376_1000009124 | 231 |
| 22 | 3300025907 | Ga0207645_10003552 | Ga0207645_1000355212 | 231 |
| 23 | 3300025927 | Ga0207687_10009999 | Ga0207687_100099997 | 231 |
| 24 | 3300025934 | Ga0207686_10000531 | Ga0207686_100005312 | 231 |
| 25 | 3300025935 | Ga0207709_10000114 | Ga0207709_10000114118 | 231 |
| 26 | 3300025938 | Ga0207704_10000008 | Ga0207704_1000000824 | 231 |
| 27 | 3300025942 | Ga0207689_10000086 | Ga0207689_1000008654 | 231 |
| 28 | 3300025960 | Ga0207651_10000008 | Ga0207651_10000008200 | 231 |
| 29 | 3300026023 | Ga0207677_10002827 | Ga0207677_100028277 | 231 |
| 30 | 3300026089 | Ga0207648_10000009 | Ga0207648_10000009200 | 231 |
| 31 | 3300032133 | Ga0316583_10008304 | Ga0316583_100083043 | 231 |
| 32 | 3300005367 | Ga0070667_100000051 | Ga0070667_10000005153 | 233 |
| 33 | 3300005843 | Ga0068860_100002843 | Ga0068860_1000028432 | 233 |
| 34 | 3300053087 | Ga0500643_000555 | Ga0500643_000555_5253_6032 | 234 |
| 35 | 3300048924 | Ga0496121_0000024 | Ga0496121_0000024_78648_79445 | 235 |
| 36 | 3300053094 | Ga0500566_0029914 | Ga0500566_0029914_1033_1839 | 235 |
| 37 | 3300053121 | Ga0500607_000001 | Ga0500607_000001_61458_62264 | 235 |
| 38 | 3300053136 | Ga0500559_0001383 | Ga0500559_0001383_6022_6828 | 235 |
| 39 | 3300053151 | Ga0500604_0030916 | Ga0500604_0030916_145_951 | 235 |
| 40 | 3300053178 | Ga0500637_0003151 | Ga0500637_0003151_4947_5753 | 235 |
| 41 | 3300053730 | Ga0500645_003318 | Ga0500645_003318_2247_3053 | 235 |
| 42 | 3300031824 | Ga0307413_10009551 | Ga0307413_100095512 | 236 |
| 43 | 3300031911 | Ga0307412_10067701 | Ga0307412_100677013 | 236 |
| 44 | 3300032002 | Ga0307416_100268755 | Ga0307416_1002687553 | 236 |
| 45 | 3300032005 | Ga0307411_10141938 | Ga0307411_101419383 | 236 |
| 46 | 3300048925 | Ga0496122_0011368 | Ga0496122_0011368_7969_8757 | 236 |
| 47 | 3300048926 | Ga0496123_0001685 | Ga0496123_0001685_10480_11268 | 236 |
| 48 | 3300048927 | Ga0496124_0078329 | Ga0496124_0078329_187_975 | 236 |
| 49 | 3300005530 | Ga0070679_100009737 | Ga0070679_1000097375 | 237 |
| 50 | 3300005843 | Ga0068860_100076475 | Ga0068860_1000764753 | 237 |
| 51 | 3300013104 | Ga0157370_10197784 | Ga0157370_101977843 | 237 |
| 52 | 3300025909 | Ga0207705_10005106 | Ga0207705_100051067 | 237 |
| 53 | 3300025919 | Ga0207657_10007179 | Ga0207657_100071798 | 237 |
| 54 | 3300025921 | Ga0207652_10317793 | Ga0207652_103177931 | 237 |
| 55 | 3300025944 | Ga0207661_10220066 | Ga0207661_102200661 | 237 |
| 56 | 3300028381 | Ga0268264_10046516 | Ga0268264_100465163 | 237 |
| 57 | 3300031727 | Ga0316576_10430616 | Ga0316576_104306161 | 237 |
| 58 | 3300042015 | Ga0439462_0006109 | Ga0439462_0006109_242_1030 | 237 |
| 59 | 3300046500 | Ga0495596_0010460 | Ga0495596_0010460_2052_2843 | 237 |
| 60 | 3300046512 | Ga0495610_0003757 | Ga0495610_0003757_8912_9703 | 237 |
| 61 | 3300046522 | Ga0495643_0022188 | Ga0495643_0022188_996_1787 | 237 |
| 62 | iso_pu_bacteria | 2643221588 | 2643951278 | 237 |
| 63 | iso_pu_bacteria | 3000865235 | 3000867305 | 237 |
| 64 | 3300001990 | JGI24737J22298_10001855 | JGI24737J22298_100018557 | 238 |
| 65 | 3300002067 | JGI24735J21928_10012949 | JGI24735J21928_100129493 | 238 |
| 66 | 3300002075 | JGI24738J21930_10000191 | JGI24738J21930_1000019114 | 238 |
| 67 | 3300003781 | Ga0055536_1002483 | Ga0055536_10024839 | 238 |
| 68 | 3300003784 | Ga0055534_1005372 | Ga0055534_10053723 | 238 |
| 69 | 3300003791 | Ga0055530_10000083 | Ga0055530_100000832 | 238 |
| 70 | 3300003794 | Ga0055531_10003248 | Ga0055531_100032482 | 238 |
| 71 | 3300005457 | Ga0070662_100006590 | Ga0070662_1000065908 | 238 |
| 72 | 3300009147 | Ga0114129_10079310 | Ga0114129_100793103 | 238 |
| 73 | 3300013102 | Ga0157371_10176607 | Ga0157371_101766072 | 238 |
| 74 | 3300025291 | Ga0209675_1000184 | Ga0209675_100018411 | 238 |
| 75 | 3300025292 | Ga0209676_1000133 | Ga0209676_100013339 | 238 |
| 76 | 3300025294 | Ga0209025_1021511 | Ga0209025_10215113 | 238 |
| 77 | 3300025298 | Ga0209050_1000067 | Ga0209050_100006733 | 238 |
| 78 | 3300025304 | Ga0209257_1000132 | Ga0209257_1000132148 | 238 |
| 79 | 3300025904 | Ga0207647_10001397 | Ga0207647_1000139718 | 238 |
| 80 | 3300025933 | Ga0207706_10011554 | Ga0207706_100115549 | 238 |
| 81 | 3300031731 | Ga0307405_10011064 | Ga0307405_100110643 | 238 |
| 82 | 3300031911 | Ga0307412_10006545 | Ga0307412_100065453 | 238 |
| 83 | 3300031911 | Ga0307412_10431810 | Ga0307412_104318102 | 238 |
| 84 | 3300032005 | Ga0307411_10061722 | Ga0307411_100617222 | 238 |
| 85 | 3300048906 | Ga0496103_0000026 | Ga0496103_0000026_95560_96399 | 238 |
| 86 | 3300048919 | Ga0496116_0002728 | Ga0496116_0002728_4511_5350 | 238 |
| 87 | 3300048920 | Ga0496117_0000072 | Ga0496117_0000072_120100_120939 | 238 |
| 88 | 3300048921 | Ga0496118_0000030 | Ga0496118_0000030_117428_118267 | 238 |
| 89 | 3300048922 | Ga0496119_0033138 | Ga0496119_0033138_2433_3272 | 238 |
| 90 | 3300048927 | Ga0496124_0000061 | Ga0496124_0000061_117428_118267 | 238 |
| 91 | 3300050507 | nmdc:mga05p37_132234_c1 | nmdc:mga05p37_132234_c1_1868_2677 | 238 |
| 92 | 3300050509 | nmdc:mga0qj67_35400_c1 | nmdc:mga0qj67_35400_c1_1215_2024 | 238 |
| 93 | 3300053116 | Ga0500592_000215 | Ga0500592_000215_6175_6972 | 238 |
| 94 | 3300053139 | Ga0500568_0009797 | Ga0500568_0009797_2322_3119 | 238 |
| 95 | 3300053146 | Ga0500588_0013008 | Ga0500588_0013008_876_1670 | 238 |
| 96 | 3300053727 | Ga0500611_027884 | Ga0500611_027884_62_859 | 238 |
| 97 | iso_pu_bacteria | 2882806704 | 2882809137 | 238 |
| 98 | iso_pu_bacteria | 2830075706 | 2830078110 | 239 |
| 99 | iso_pu_bacteria | 2990265787 | 2990268751 | 239 |
| 100 | iso_pu_bacteria | 2993693658 | 2993694542 | 239 |
| 101 | 3300005356 | Ga0070674_100379793 | Ga0070674_1003797932 | 240 |
| 102 | 3300009148 | Ga0105243_10279461 | Ga0105243_102794612 | 240 |
| 103 | 3300025923 | Ga0207681_10585236 | Ga0207681_105852361 | 240 |
| 104 | 3300025933 | Ga0207706_10718090 | Ga0207706_107180901 | 240 |
| 105 | 3300025937 | Ga0207669_10185464 | Ga0207669_101854641 | 240 |
| 106 | 3300026075 | Ga0207708_10152266 | Ga0207708_101522662 | 240 |
| 107 | 3300044735 | Ga0466968_0050891 | Ga0466968_0050891_289_1107 | 240 |
| 108 | 3300048928 | Ga0496125_0123472 | Ga0496125_0123472_342_1148 | 240 |
| 109 | iso_pu_bacteria | 2919138771 | 2919138968 | 240 |
| 110 | 3300025932 | Ga0207690_10042908 | Ga0207690_100429083 | 242 |
| 111 | 3300047472 | Ga0495686_0000278 | Ga0495686_0000278_52367_53236 | 242 |
| 112 | 3300053108 | Ga0500562_011475 | Ga0500562_011475_1370_2188 | 242 |
| 113 | 3300005327 | Ga0070658_10000416 | Ga0070658_1000041623 | 243 |
| 114 | 3300005616 | Ga0068852_100053480 | Ga0068852_1000534805 | 243 |
| 115 | 3300025909 | Ga0207705_10000007 | Ga0207705_10000007166 | 243 |
| 116 | 3300026142 | Ga0207698_10036024 | Ga0207698_100360244 | 245 |
| 117 | 3300047472 | Ga0495686_0001670 | Ga0495686_0001670_14740_15549 | 245 |
| 118 | 3300053136 | Ga0500559_0022285 | Ga0500559_0022285_687_1496 | 245 |
| 119 | 3300049571 | Ga0501034_0048378 | Ga0501034_0048378_2268_3104 | 248 |
| 120 | 3300049578 | Ga0501042_0408843 | Ga0501042_0408843_69_905 | 248 |
| 121 | 3300025949 | Ga0207667_10000024 | Ga0207667_10000024245 | 251 |
| 122 | 3300003762 | Ga0055542_1002329 | Ga0055542_10023295 | 255 |
| 123 | 3300013104 | Ga0157370_10265845 | Ga0157370_102658452 | 255 |
| 124 | 3300025254 | Ga0209148_1000301 | Ga0209148_100030126 | 255 |
| 125 | 3300013104 | Ga0157370_10000201 | Ga0157370_1000020127 | 256 |
| 126 | 3300013105 | Ga0157369_10009403 | Ga0157369_1000940313 | 256 |
| 127 | 3300013307 | Ga0157372_10142208 | Ga0157372_101422083 | 256 |
| 128 | 3300025231 | Ga0207427_100849 | Ga0207427_10084910 | 256 |
| 129 | 3300025250 | Ga0209026_1001484 | Ga0209026_10014843 | 256 |
| 130 | 3300025261 | Ga0209233_1000003 | Ga0209233_10000031050 | 256 |
| 131 | 3300025913 | Ga0207695_10010515 | Ga0207695_100105153 | 256 |
| 132 | 3300026078 | Ga0207702_10015092 | Ga0207702_100150921 | 256 |
| 133 | 3300037312 | Ga0395899_0017328 | Ga0395899_0017328_3405_4247 | 256 |
| 134 | 3300037418 | Ga0395900_0345872 | Ga0395900_0345872_326_1168 | 256 |
| 135 | 3300047472 | Ga0495686_0002307 | Ga0495686_0002307_16634_17530 | 256 |
| 136 | 3300005577 | Ga0068857_100385641 | Ga0068857_1003856412 | 257 |
| 137 | 3300026116 | Ga0207674_10508721 | Ga0207674_105087211 | 257 |
| 138 | 3300047469 | Ga0495673_0003476 | Ga0495673_0003476_2850_3713 | 257 |
| 139 | 3300048926 | Ga0496123_0090934 | Ga0496123_0090934_400_1263 | 257 |
| 140 | 3300048927 | Ga0496124_0293025 | Ga0496124_0293025_33_896 | 257 |
| 141 | 3300001990 | JGI24737J22298_10006510 | JGI24737J22298_100065103 | 258 |
| 142 | 3300005327 | Ga0070658_10162004 | Ga0070658_101620043 | 258 |
| 143 | 3300046460 | Ga0495638_0036829 | Ga0495638_0036829_1249_2205 | 258 |
| 144 | 3300046506 | Ga0495583_0000010 | Ga0495583_0000010_339826_340782 | 258 |
| 145 | 3300046691 | Ga0495670_0008746 | Ga0495670_0008746_2551_3507 | 258 |
| 146 | 3300047472 | Ga0495686_0071693 | Ga0495686_0071693_1125_1928 | 258 |
| 147 | 3300049460 | Ga0495682_0070475 | Ga0495682_0070475_138_941 | 258 |
| 148 | 3300053103 | Ga0500555_000502 | Ga0500555_000502_12741_13697 | 258 |
| 149 | 3300005339 | Ga0070660_100008065 | Ga0070660_1000080657 | 259 |
| 150 | 3300005366 | Ga0070659_100106971 | Ga0070659_1001069712 | 259 |
| 151 | 3300025919 | Ga0207657_10067095 | Ga0207657_100670953 | 259 |
| 152 | 3300042012 | Ga0439455_0003649 | Ga0439455_0003649_1563_2363 | 259 |
| 153 | 3300042157 | Ga0439458_0013290 | Ga0439458_0013290_945_1745 | 259 |
| 154 | 3300044683 | Ga0466965_0005290 | Ga0466965_0005290_962_1762 | 259 |
| 155 | 3300044693 | Ga0466961_0002125 | Ga0466961_0002125_11265_12065 | 259 |
| 156 | 3300044706 | Ga0466964_0026252 | Ga0466964_0026252_958_1758 | 259 |
| 157 | 3300044706 | Ga0466964_0035487 | Ga0466964_0035487_722_1522 | 259 |
| 158 | 3300044719 | Ga0466971_0022507 | Ga0466971_0022507_750_1550 | 259 |
| 159 | 3300044842 | Ga0466957_0026916 | Ga0466957_0026916_1167_1967 | 259 |
| 160 | 3300044901 | Ga0466960_0041499 | Ga0466960_0041499_116_916 | 259 |
| 161 | 3300045049 | Ga0466959_0009165 | Ga0466959_0009165_524_1324 | 259 |
| 162 | 3300045836 | Ga0466958_0019250 | Ga0466958_0019250_1500_2300 | 259 |
| 163 | 3300045836 | Ga0466958_0034165 | Ga0466958_0034165_512_1312 | 259 |
| 164 | 3300048922 | Ga0496119_0023412 | Ga0496119_0023412_1568_2365 | 259 |
| 165 | 3300048923 | Ga0496120_0051969 | Ga0496120_0051969_1234_2031 | 259 |
| 166 | 3300048928 | Ga0496125_0010616 | Ga0496125_0010616_7287_8084 | 259 |
| 167 | 3300061719 | Ga0466962_0000844 | Ga0466962_0000844_9589_10389 | 259 |
| 168 | 3300003316 | rootH1_10054557 | rootH1_100545572 | 260 |
| 169 | 3300003323 | rootH1_10048414 | rootH1_100484142 | 260 |
| 170 | 3300005616 | Ga0068852_100007362 | Ga0068852_1000073622 | 260 |
| 171 | 3300026142 | Ga0207698_10000214 | Ga0207698_1000021424 | 260 |
| 172 | 3300037471 | Ga0395905_0341548 | Ga0395905_0341548_127_927 | 260 |
| 173 | 3300045976 | Ga0466967_0215566 | Ga0466967_0215566_814_1614 | 260 |
| 174 | 3300048920 | Ga0496117_0018514 | Ga0496117_0018514_3493_4350 | 260 |
| 175 | 3300048921 | Ga0496118_0124146 | Ga0496118_0124146_123_980 | 260 |
| 176 | 3300048924 | Ga0496121_0030549 | Ga0496121_0030549_243_1043 | 260 |
| 177 | 3300048925 | Ga0496122_0010024 | Ga0496122_0010024_4424_5281 | 260 |
| 178 | 3300048926 | Ga0496123_0008335 | Ga0496123_0008335_4386_5243 | 260 |
| 179 | 3300001989 | JGI24739J22299_10007879 | JGI24739J22299_100078793 | 261 |
| 180 | 3300005457 | Ga0070662_100141910 | Ga0070662_1001419102 | 261 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hiu-assembly2.cif.gz_D | the crystal structure of protein (xcc3681) from xanthomonas campestris pv. campestris str. atcc 33913 | 0.8105 | 50 | 193 |
| 4cvt-assembly1.cif.gz_A-2 | structure of apobacterioferritin y58f variant | 0.7499 | 44 | 205 |
| 2ib0-assembly1.cif.gz_B | crystal structure of a conserved hypothetical protein, rv2844, from mycobacterium tuberculosis | 0.7479 | 44 | 185 |
| 3hiu-assembly2.cif.gz_D | the crystal structure of protein (xcc3681) from xanthomonas campestris pv. campestris str. atcc 33913 | 0.7436 | 50 | 193 |
| 4zlw-assembly1.cif.gz_G | crystal structure of the pmftn variant e130a soaked in iron (overnight) | 0.7433 | 50 | 189 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_F1QLM2_162_414_1.20.910.10 | Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like | 0.9243 | 2 | 233 | 1.20.910.10 |
| af_Q9LZ73_15_282_1.20.910.10 | Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like | 0.9211 | 2 | 233 | 1.20.910.10 |
| af_Q8H109_91_338_1.20.1260.10 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9173 | 2 | 233 | 1.20.1260.10 |
| af_Q10L10_32_358_1.20.910.10 | Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like | 0.9159 | 2 | 233 | 1.20.910.10 |
| af_B4FIR6_31_254_1.20.1260.10 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9104 | 2 | 198 | 1.20.1260.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H8FMC7-F1-model_v4 | Uncharacterized conserved protein, contains ferritin-like DUF455 domain | 0.964 | 4 | 237 |
|
| AF-A0A430DSH2-F1-model_v4 | DUF455 family protein | 0.9639 | 2 | 237 |
|
| AF-A0A7W7EYZ8-F1-model_v4 | Uncharacterized ferritin-like protein (DUF455 family) | 0.9636 | 4 | 237 |
|
| AF-A0A219B141-F1-model_v4 | Rhamnosyltransferase | 0.9616 | 2 | 236 |
GO:0016740
|
| AF-A0A0A7PIA5-F1-model_v4 | Rhamnosyltransferase | 0.9614 | 2 | 237 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar