F276303

General Info

Members Datasets Scaffolds Average Seq Length
180 145 173 260

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0048378|Ga0501034_0048378_2268_3104
Length 278
Sequence LSEIRHQSVASAIRHALLTAEPTAKVFAARDVARRWRLGRLDWRFDAAMPERPAWPAEPELLSPGRMPRRGKAGSERGRIALWHALAHIEFVAIDLALDMAGRFGAEMGRAFVSDFLAVAADEAMHFALLDRKLRKLGSRYGALPAHDGLWEAANETRHDVRARLAVVPMVLEARGLDVTPATRDRARAQGDEDGARILERILDDEIRHVRLGTEHFIARCEAMGENPPDCWKMLVKSHFRGVLKPPFNDSARSAAGLSRDFYASLASRAQAPLPHNH

Samples

Sample ID Description Type Environment
1 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
2 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
3 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
4 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
5 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
6 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
7 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
51 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
52 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
54 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
86 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
87 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
88 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
96 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
97 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
98 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
99 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
100 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
101 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
102 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
109 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
110 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
111 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
112 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
113 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
114 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
115 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
116 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
117 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
118 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
119 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
120 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
121 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
122 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
123 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
124 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
125 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
126 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
127 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
132 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
133 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
134 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
135 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
136 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
137 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
138 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
139 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
140 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
141 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
142 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
143 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
144 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
145 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.11
Metatranscriptomes 0
Isolates 3.89

Biome Distribution

Category Percentage (%)
Aerial Root 1.11
Bulb 0
Endosphere 15
Nodule 0
Rhizoplane 0.56
Rhizosphere 70
Stem 0
Stem Tuber 0
Unclassified 13.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10007879 3300001989 Bacteria 3986
2 JGI24737J22298_10001855 3300001990 Bacteria 7552
3 JGI24737J22298_10006510 3300001990 Bacteria 3986
4 JGI24735J21928_10012949 3300002067 Bacteria 2631
5 JGI24738J21930_10000191 3300002075 Bacteria 16065
6 rootH1_10054557 3300003316 Bacteria 3654
7 rootH1_10048414 3300003323 Bacteria 1987
8 Ga0055542_1002329 3300003762 Bacteria 6526
9 Ga0055536_1002483 3300003781 Bacteria 10345
10 Ga0055534_1005372 3300003784 Bacteria 3442
11 Ga0055530_10000083 3300003791 Bacteria 81772
12 Ga0055531_10003248 3300003794 Bacteria 10438
13 Ga0070658_10000416 3300005327 Bacteria 36945
14 Ga0070658_10162004 3300005327 Bacteria 1877
15 Ga0070676_10001153 3300005328 Bacteria 13201
16 Ga0068869_100000060 3300005334 Bacteria 48712
17 Ga0068868_100000278 3300005338 Bacteria 34336
18 Ga0070660_100008065 3300005339 Bacteria 7360
19 Ga0070660_100061443 3300005339 Bacteria 2917
20 Ga0070674_100379793 3300005356 Bacteria 1149
21 Ga0070673_100000019 3300005364 Bacteria 107024
22 Ga0070659_100106971 3300005366 Bacteria 2255
23 Ga0070667_100000051 3300005367 Bacteria 155117
24 Ga0070663_100144610 3300005455 Bacteria 1818
25 Ga0070662_100006590 3300005457 Bacteria 7493
26 Ga0070662_100141910 3300005457 Bacteria 1862
27 Ga0068867_100000014 3300005459 Bacteria 112097
28 Ga0070679_100009737 3300005530 Bacteria 9089
29 Ga0070679_100099787 3300005530 Bacteria 2890
30 Ga0068857_100385641 3300005577 Bacteria 1302
31 Ga0068852_100007362 3300005616 Bacteria 8029
32 Ga0068852_100053480 3300005616 Bacteria 3476
33 Ga0068860_100002843 3300005843 Bacteria 17969
34 Ga0068860_100076475 3300005843 Bacteria 3184
35 Ga0068865_100000018 3300006881 Bacteria 106975
36 Ga0105245_10000635 3300009098 Bacteria 31928
37 Ga0114129_10079310 3300009147 Bacteria 4566
38 Ga0105243_10000076 3300009148 Bacteria 110445
39 Ga0105243_10279461 3300009148 Bacteria 1503
40 Ga0105242_10000783 3300009176 Bacteria 24671
41 Ga0105246_10001209 3300011119 Bacteria 15110
42 Ga0157371_10176607 3300013102 Bacteria 1527
43 Ga0157370_10000201 3300013104 Bacteria 75437
44 Ga0157370_10197784 3300013104 Bacteria 1865
45 Ga0157370_10265845 3300013104 Bacteria 1585
46 Ga0157369_10009403 3300013105 Bacteria 11174
47 Ga0157374_10021034 3300013296 Bacteria 5798
48 Ga0157378_10005339 3300013297 Bacteria 11274
49 Ga0157372_10142208 3300013307 Bacteria 2765
50 Ga0157375_10104109 3300013308 Bacteria 2926
51 Ga0157377_10007395 3300014745 Bacteria 5301
52 Ga0157376_10000091 3300014969 Bacteria 68377
53 Ga0207427_100849 3300025231 Bacteria 13643
54 Ga0209026_1001484 3300025250 Bacteria 10313
55 Ga0209148_1000301 3300025254 Bacteria 71452
56 Ga0209233_1000003 3300025261 Bacteria 1607366
57 Ga0209675_1000184 3300025291 Bacteria 70175
58 Ga0209676_1000133 3300025292 Bacteria 184430
59 Ga0209025_1021511 3300025294 Bacteria 3470
60 Ga0209050_1000067 3300025298 Bacteria 304206
61 Ga0209257_1000132 3300025304 Bacteria 210870
62 Ga0207647_10001397 3300025904 Bacteria 18543
63 Ga0207645_10003552 3300025907 Bacteria 11800
64 Ga0207705_10000007 3300025909 Bacteria 597387
65 Ga0207705_10005106 3300025909 Bacteria 9841
66 Ga0207705_10030996 3300025909 Bacteria 3816
67 Ga0207695_10010515 3300025913 Bacteria 11317
68 Ga0207657_10007179 3300025919 Bacteria 11437
69 Ga0207657_10067095 3300025919 Bacteria 3052
70 Ga0207652_10043388 3300025921 Bacteria 3829
71 Ga0207652_10317793 3300025921 Bacteria 1406
72 Ga0207681_10585236 3300025923 Bacteria 921
73 Ga0207687_10009999 3300025927 Bacteria 6207
74 Ga0207690_10042908 3300025932 Bacteria 2974
75 Ga0207706_10011554 3300025933 Bacteria 8040
76 Ga0207706_10718090 3300025933 Bacteria 853
77 Ga0207686_10000531 3300025934 Bacteria 24671
78 Ga0207709_10000114 3300025935 Bacteria 124672
79 Ga0207669_10185464 3300025937 Bacteria 1496
80 Ga0207704_10000008 3300025938 Bacteria 204682
81 Ga0207689_10000086 3300025942 Bacteria 75369
82 Ga0207661_10220066 3300025944 Bacteria 1678
83 Ga0207667_10000024 3300025949 Bacteria 355874
84 Ga0207651_10000008 3300025960 Bacteria 204538
85 Ga0207677_10002827 3300026023 Bacteria 9151
86 Ga0207678_10024686 3300026067 Bacteria 5249
87 Ga0207708_10152266 3300026075 Bacteria 1822
88 Ga0207702_10015092 3300026078 Bacteria 6404
89 Ga0207648_10000009 3300026089 Bacteria 204229
90 Ga0207674_10508721 3300026116 Bacteria 1163
91 Ga0207698_10000214 3300026142 Bacteria 36073
92 Ga0207698_10036024 3300026142 Bacteria 3627
93 Ga0268264_10046516 3300028381 Bacteria 3604
94 Ga0316576_10430616 3300031727 Bacteria 976
95 Ga0307405_10011064 3300031731 Bacteria 4710
96 Ga0307413_10009551 3300031824 Bacteria 4650
97 Ga0307412_10006545 3300031911 Bacteria 6594
98 Ga0307412_10067701 3300031911 Bacteria 2425
99 Ga0307412_10431810 3300031911 Bacteria 1080
100 Ga0307416_100268755 3300032002 Bacteria 1672
101 Ga0307411_10061722 3300032005 Bacteria 2497
102 Ga0307411_10141938 3300032005 Bacteria 1772
103 Ga0316583_10008304 3300032133 Bacteria 3743
104 Ga0395899_0017328 3300037312 Bacteria 5490
105 Ga0395900_0345872 3300037418 Bacteria 1461
106 Ga0395905_0341548 3300037471 Bacteria 1388
107 Ga0439455_0003649 3300042012 Bacteria 2969
108 Ga0439462_0006109 3300042015 Bacteria 2985
109 Ga0439458_0013290 3300042157 Bacteria 1852
110 Ga0466965_0005290 3300044683 Bacteria 5807
111 Ga0466961_0002125 3300044693 Bacteria 12324
112 Ga0466964_0026252 3300044706 Bacteria 2279
113 Ga0466964_0035487 3300044706 Bacteria 1994
114 Ga0466971_0022507 3300044719 Bacteria 2808
115 Ga0466968_0050891 3300044735 Bacteria 1769
116 Ga0466957_0026916 3300044842 Bacteria 3414
117 Ga0466960_0041499 3300044901 Bacteria 2180
118 Ga0466959_0009165 3300045049 Bacteria 7027
119 Ga0466958_0019250 3300045836 Bacteria 3973
120 Ga0466958_0034165 3300045836 Bacteria 3032
121 Ga0466967_0215566 3300045976 Bacteria 1822
122 Ga0495638_0036829 3300046460 Bacteria 3114
123 Ga0495596_0010460 3300046500 Bacteria 4040
124 Ga0495583_0000010 3300046506 Bacteria 353523
125 Ga0495610_0003757 3300046512 Bacteria 11619
126 Ga0495643_0022188 3300046522 Bacteria 3626
127 Ga0495670_0008746 3300046691 Bacteria 4982
128 Ga0495673_0003476 3300047469 Bacteria 10361
129 Ga0495686_0000278 3300047472 Bacteria 90520
130 Ga0495686_0001670 3300047472 Bacteria 23070
131 Ga0495686_0002307 3300047472 Bacteria 18248
132 Ga0495686_0071693 3300047472 Bacteria 2132
133 Ga0496103_0000026 3300048906 Bacteria 213826
134 Ga0496116_0002728 3300048919 Bacteria 18149
135 Ga0496117_0000072 3300048920 Bacteria 238366
136 Ga0496117_0018514 3300048920 Bacteria 5762
137 Ga0496118_0000030 3300048921 Bacteria 339946
138 Ga0496118_0124146 3300048921 Bacteria 1675
139 Ga0496119_0023412 3300048922 Bacteria 4380
140 Ga0496119_0033138 3300048922 Bacteria 3431
141 Ga0496120_0051969 3300048923 Bacteria 2337
142 Ga0496121_0000024 3300048924 Bacteria 462959
143 Ga0496121_0030549 3300048924 Bacteria 4946
144 Ga0496122_0010024 3300048925 Bacteria 9856
145 Ga0496122_0011368 3300048925 Bacteria 9023
146 Ga0496123_0001685 3300048926 Bacteria 29584
147 Ga0496123_0008335 3300048926 Bacteria 9538
148 Ga0496123_0090934 3300048926 Bacteria 1812
149 Ga0496124_0000061 3300048927 Bacteria 238225
150 Ga0496124_0078329 3300048927 Bacteria 2724
151 Ga0496124_0293025 3300048927 Bacteria 1180
152 Ga0496125_0010616 3300048928 Bacteria 9301
153 Ga0496125_0123472 3300048928 Bacteria 1840
154 Ga0495682_0070475 3300049460 Bacteria 1258
155 Ga0501034_0048378 3300049571 Bacteria 4292
156 Ga0501042_0408843 3300049578 Bacteria 983
157 nmdc:mga05p37_132234_c1 3300050507 Bacteria 3061
158 nmdc:mga0qj67_35400_c1 3300050509 Bacteria 3903
159 Ga0500643_000555 3300053087 Bacteria 25933
160 Ga0500566_0029914 3300053094 Bacteria 3179
161 Ga0500555_000502 3300053103 Bacteria 15868
162 Ga0500562_011475 3300053108 Bacteria 2250
163 Ga0500592_000215 3300053116 Bacteria 10605
164 Ga0500607_000001 3300053121 Bacteria 185408
165 Ga0500559_0001383 3300053136 Bacteria 13830
166 Ga0500559_0022285 3300053136 Bacteria 2686
167 Ga0500568_0009797 3300053139 Bacteria 4529
168 Ga0500588_0013008 3300053146 Bacteria 2079
169 Ga0500604_0030916 3300053151 Bacteria 1569
170 Ga0500637_0003151 3300053178 Bacteria 7540
171 Ga0500611_027884 3300053727 Bacteria 1141
172 Ga0500645_003318 3300053730 Bacteria 6607
173 Ga0466962_0000844 3300061719 Bacteria 13832

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005339 Ga0070660_100061443 Ga0070660_1000614433 224
2 3300005455 Ga0070663_100144610 Ga0070663_1001446103 224
3 3300005530 Ga0070679_100099787 Ga0070679_1000997873 224
4 3300025909 Ga0207705_10030996 Ga0207705_100309965 224
5 3300025921 Ga0207652_10043388 Ga0207652_100433883 224
6 3300026067 Ga0207678_10024686 Ga0207678_100246863 224
7 3300005328 Ga0070676_10001153 Ga0070676_100011535 231
8 3300005334 Ga0068869_100000060 Ga0068869_10000006023 231
9 3300005338 Ga0068868_100000278 Ga0068868_10000027815 231
10 3300005364 Ga0070673_100000019 Ga0070673_10000001921 231
11 3300005459 Ga0068867_100000014 Ga0068867_10000001425 231
12 3300006881 Ga0068865_100000018 Ga0068865_10000001892 231
13 3300009098 Ga0105245_10000635 Ga0105245_1000063524 231
14 3300009148 Ga0105243_10000076 Ga0105243_10000076102 231
15 3300009176 Ga0105242_10000783 Ga0105242_1000078328 231
16 3300011119 Ga0105246_10001209 Ga0105246_1000120913 231
17 3300013296 Ga0157374_10021034 Ga0157374_100210345 231
18 3300013297 Ga0157378_10005339 Ga0157378_100053395 231
19 3300013308 Ga0157375_10104109 Ga0157375_101041092 231
20 3300014745 Ga0157377_10007395 Ga0157377_100073955 231
21 3300014969 Ga0157376_10000091 Ga0157376_1000009124 231
22 3300025907 Ga0207645_10003552 Ga0207645_1000355212 231
23 3300025927 Ga0207687_10009999 Ga0207687_100099997 231
24 3300025934 Ga0207686_10000531 Ga0207686_100005312 231
25 3300025935 Ga0207709_10000114 Ga0207709_10000114118 231
26 3300025938 Ga0207704_10000008 Ga0207704_1000000824 231
27 3300025942 Ga0207689_10000086 Ga0207689_1000008654 231
28 3300025960 Ga0207651_10000008 Ga0207651_10000008200 231
29 3300026023 Ga0207677_10002827 Ga0207677_100028277 231
30 3300026089 Ga0207648_10000009 Ga0207648_10000009200 231
31 3300032133 Ga0316583_10008304 Ga0316583_100083043 231
32 3300005367 Ga0070667_100000051 Ga0070667_10000005153 233
33 3300005843 Ga0068860_100002843 Ga0068860_1000028432 233
34 3300053087 Ga0500643_000555 Ga0500643_000555_5253_6032 234
35 3300048924 Ga0496121_0000024 Ga0496121_0000024_78648_79445 235
36 3300053094 Ga0500566_0029914 Ga0500566_0029914_1033_1839 235
37 3300053121 Ga0500607_000001 Ga0500607_000001_61458_62264 235
38 3300053136 Ga0500559_0001383 Ga0500559_0001383_6022_6828 235
39 3300053151 Ga0500604_0030916 Ga0500604_0030916_145_951 235
40 3300053178 Ga0500637_0003151 Ga0500637_0003151_4947_5753 235
41 3300053730 Ga0500645_003318 Ga0500645_003318_2247_3053 235
42 3300031824 Ga0307413_10009551 Ga0307413_100095512 236
43 3300031911 Ga0307412_10067701 Ga0307412_100677013 236
44 3300032002 Ga0307416_100268755 Ga0307416_1002687553 236
45 3300032005 Ga0307411_10141938 Ga0307411_101419383 236
46 3300048925 Ga0496122_0011368 Ga0496122_0011368_7969_8757 236
47 3300048926 Ga0496123_0001685 Ga0496123_0001685_10480_11268 236
48 3300048927 Ga0496124_0078329 Ga0496124_0078329_187_975 236
49 3300005530 Ga0070679_100009737 Ga0070679_1000097375 237
50 3300005843 Ga0068860_100076475 Ga0068860_1000764753 237
51 3300013104 Ga0157370_10197784 Ga0157370_101977843 237
52 3300025909 Ga0207705_10005106 Ga0207705_100051067 237
53 3300025919 Ga0207657_10007179 Ga0207657_100071798 237
54 3300025921 Ga0207652_10317793 Ga0207652_103177931 237
55 3300025944 Ga0207661_10220066 Ga0207661_102200661 237
56 3300028381 Ga0268264_10046516 Ga0268264_100465163 237
57 3300031727 Ga0316576_10430616 Ga0316576_104306161 237
58 3300042015 Ga0439462_0006109 Ga0439462_0006109_242_1030 237
59 3300046500 Ga0495596_0010460 Ga0495596_0010460_2052_2843 237
60 3300046512 Ga0495610_0003757 Ga0495610_0003757_8912_9703 237
61 3300046522 Ga0495643_0022188 Ga0495643_0022188_996_1787 237
62 iso_pu_bacteria 2643221588 2643951278 237
63 iso_pu_bacteria 3000865235 3000867305 237
64 3300001990 JGI24737J22298_10001855 JGI24737J22298_100018557 238
65 3300002067 JGI24735J21928_10012949 JGI24735J21928_100129493 238
66 3300002075 JGI24738J21930_10000191 JGI24738J21930_1000019114 238
67 3300003781 Ga0055536_1002483 Ga0055536_10024839 238
68 3300003784 Ga0055534_1005372 Ga0055534_10053723 238
69 3300003791 Ga0055530_10000083 Ga0055530_100000832 238
70 3300003794 Ga0055531_10003248 Ga0055531_100032482 238
71 3300005457 Ga0070662_100006590 Ga0070662_1000065908 238
72 3300009147 Ga0114129_10079310 Ga0114129_100793103 238
73 3300013102 Ga0157371_10176607 Ga0157371_101766072 238
74 3300025291 Ga0209675_1000184 Ga0209675_100018411 238
75 3300025292 Ga0209676_1000133 Ga0209676_100013339 238
76 3300025294 Ga0209025_1021511 Ga0209025_10215113 238
77 3300025298 Ga0209050_1000067 Ga0209050_100006733 238
78 3300025304 Ga0209257_1000132 Ga0209257_1000132148 238
79 3300025904 Ga0207647_10001397 Ga0207647_1000139718 238
80 3300025933 Ga0207706_10011554 Ga0207706_100115549 238
81 3300031731 Ga0307405_10011064 Ga0307405_100110643 238
82 3300031911 Ga0307412_10006545 Ga0307412_100065453 238
83 3300031911 Ga0307412_10431810 Ga0307412_104318102 238
84 3300032005 Ga0307411_10061722 Ga0307411_100617222 238
85 3300048906 Ga0496103_0000026 Ga0496103_0000026_95560_96399 238
86 3300048919 Ga0496116_0002728 Ga0496116_0002728_4511_5350 238
87 3300048920 Ga0496117_0000072 Ga0496117_0000072_120100_120939 238
88 3300048921 Ga0496118_0000030 Ga0496118_0000030_117428_118267 238
89 3300048922 Ga0496119_0033138 Ga0496119_0033138_2433_3272 238
90 3300048927 Ga0496124_0000061 Ga0496124_0000061_117428_118267 238
91 3300050507 nmdc:mga05p37_132234_c1 nmdc:mga05p37_132234_c1_1868_2677 238
92 3300050509 nmdc:mga0qj67_35400_c1 nmdc:mga0qj67_35400_c1_1215_2024 238
93 3300053116 Ga0500592_000215 Ga0500592_000215_6175_6972 238
94 3300053139 Ga0500568_0009797 Ga0500568_0009797_2322_3119 238
95 3300053146 Ga0500588_0013008 Ga0500588_0013008_876_1670 238
96 3300053727 Ga0500611_027884 Ga0500611_027884_62_859 238
97 iso_pu_bacteria 2882806704 2882809137 238
98 iso_pu_bacteria 2830075706 2830078110 239
99 iso_pu_bacteria 2990265787 2990268751 239
100 iso_pu_bacteria 2993693658 2993694542 239
101 3300005356 Ga0070674_100379793 Ga0070674_1003797932 240
102 3300009148 Ga0105243_10279461 Ga0105243_102794612 240
103 3300025923 Ga0207681_10585236 Ga0207681_105852361 240
104 3300025933 Ga0207706_10718090 Ga0207706_107180901 240
105 3300025937 Ga0207669_10185464 Ga0207669_101854641 240
106 3300026075 Ga0207708_10152266 Ga0207708_101522662 240
107 3300044735 Ga0466968_0050891 Ga0466968_0050891_289_1107 240
108 3300048928 Ga0496125_0123472 Ga0496125_0123472_342_1148 240
109 iso_pu_bacteria 2919138771 2919138968 240
110 3300025932 Ga0207690_10042908 Ga0207690_100429083 242
111 3300047472 Ga0495686_0000278 Ga0495686_0000278_52367_53236 242
112 3300053108 Ga0500562_011475 Ga0500562_011475_1370_2188 242
113 3300005327 Ga0070658_10000416 Ga0070658_1000041623 243
114 3300005616 Ga0068852_100053480 Ga0068852_1000534805 243
115 3300025909 Ga0207705_10000007 Ga0207705_10000007166 243
116 3300026142 Ga0207698_10036024 Ga0207698_100360244 245
117 3300047472 Ga0495686_0001670 Ga0495686_0001670_14740_15549 245
118 3300053136 Ga0500559_0022285 Ga0500559_0022285_687_1496 245
119 3300049571 Ga0501034_0048378 Ga0501034_0048378_2268_3104 248
120 3300049578 Ga0501042_0408843 Ga0501042_0408843_69_905 248
121 3300025949 Ga0207667_10000024 Ga0207667_10000024245 251
122 3300003762 Ga0055542_1002329 Ga0055542_10023295 255
123 3300013104 Ga0157370_10265845 Ga0157370_102658452 255
124 3300025254 Ga0209148_1000301 Ga0209148_100030126 255
125 3300013104 Ga0157370_10000201 Ga0157370_1000020127 256
126 3300013105 Ga0157369_10009403 Ga0157369_1000940313 256
127 3300013307 Ga0157372_10142208 Ga0157372_101422083 256
128 3300025231 Ga0207427_100849 Ga0207427_10084910 256
129 3300025250 Ga0209026_1001484 Ga0209026_10014843 256
130 3300025261 Ga0209233_1000003 Ga0209233_10000031050 256
131 3300025913 Ga0207695_10010515 Ga0207695_100105153 256
132 3300026078 Ga0207702_10015092 Ga0207702_100150921 256
133 3300037312 Ga0395899_0017328 Ga0395899_0017328_3405_4247 256
134 3300037418 Ga0395900_0345872 Ga0395900_0345872_326_1168 256
135 3300047472 Ga0495686_0002307 Ga0495686_0002307_16634_17530 256
136 3300005577 Ga0068857_100385641 Ga0068857_1003856412 257
137 3300026116 Ga0207674_10508721 Ga0207674_105087211 257
138 3300047469 Ga0495673_0003476 Ga0495673_0003476_2850_3713 257
139 3300048926 Ga0496123_0090934 Ga0496123_0090934_400_1263 257
140 3300048927 Ga0496124_0293025 Ga0496124_0293025_33_896 257
141 3300001990 JGI24737J22298_10006510 JGI24737J22298_100065103 258
142 3300005327 Ga0070658_10162004 Ga0070658_101620043 258
143 3300046460 Ga0495638_0036829 Ga0495638_0036829_1249_2205 258
144 3300046506 Ga0495583_0000010 Ga0495583_0000010_339826_340782 258
145 3300046691 Ga0495670_0008746 Ga0495670_0008746_2551_3507 258
146 3300047472 Ga0495686_0071693 Ga0495686_0071693_1125_1928 258
147 3300049460 Ga0495682_0070475 Ga0495682_0070475_138_941 258
148 3300053103 Ga0500555_000502 Ga0500555_000502_12741_13697 258
149 3300005339 Ga0070660_100008065 Ga0070660_1000080657 259
150 3300005366 Ga0070659_100106971 Ga0070659_1001069712 259
151 3300025919 Ga0207657_10067095 Ga0207657_100670953 259
152 3300042012 Ga0439455_0003649 Ga0439455_0003649_1563_2363 259
153 3300042157 Ga0439458_0013290 Ga0439458_0013290_945_1745 259
154 3300044683 Ga0466965_0005290 Ga0466965_0005290_962_1762 259
155 3300044693 Ga0466961_0002125 Ga0466961_0002125_11265_12065 259
156 3300044706 Ga0466964_0026252 Ga0466964_0026252_958_1758 259
157 3300044706 Ga0466964_0035487 Ga0466964_0035487_722_1522 259
158 3300044719 Ga0466971_0022507 Ga0466971_0022507_750_1550 259
159 3300044842 Ga0466957_0026916 Ga0466957_0026916_1167_1967 259
160 3300044901 Ga0466960_0041499 Ga0466960_0041499_116_916 259
161 3300045049 Ga0466959_0009165 Ga0466959_0009165_524_1324 259
162 3300045836 Ga0466958_0019250 Ga0466958_0019250_1500_2300 259
163 3300045836 Ga0466958_0034165 Ga0466958_0034165_512_1312 259
164 3300048922 Ga0496119_0023412 Ga0496119_0023412_1568_2365 259
165 3300048923 Ga0496120_0051969 Ga0496120_0051969_1234_2031 259
166 3300048928 Ga0496125_0010616 Ga0496125_0010616_7287_8084 259
167 3300061719 Ga0466962_0000844 Ga0466962_0000844_9589_10389 259
168 3300003316 rootH1_10054557 rootH1_100545572 260
169 3300003323 rootH1_10048414 rootH1_100484142 260
170 3300005616 Ga0068852_100007362 Ga0068852_1000073622 260
171 3300026142 Ga0207698_10000214 Ga0207698_1000021424 260
172 3300037471 Ga0395905_0341548 Ga0395905_0341548_127_927 260
173 3300045976 Ga0466967_0215566 Ga0466967_0215566_814_1614 260
174 3300048920 Ga0496117_0018514 Ga0496117_0018514_3493_4350 260
175 3300048921 Ga0496118_0124146 Ga0496118_0124146_123_980 260
176 3300048924 Ga0496121_0030549 Ga0496121_0030549_243_1043 260
177 3300048925 Ga0496122_0010024 Ga0496122_0010024_4424_5281 260
178 3300048926 Ga0496123_0008335 Ga0496123_0008335_4386_5243 260
179 3300001989 JGI24739J22299_10007879 JGI24739J22299_100078793 261
180 3300005457 Ga0070662_100141910 Ga0070662_1001419102 261

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04305

DUF455

Protein of unknown function (DUF455)

18

264

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hiu-assembly2.cif.gz_D the crystal structure of protein (xcc3681) from xanthomonas campestris pv. campestris str. atcc 33913 0.8105 50 193
4cvt-assembly1.cif.gz_A-2 structure of apobacterioferritin y58f variant 0.7499 44 205
2ib0-assembly1.cif.gz_B crystal structure of a conserved hypothetical protein, rv2844, from mycobacterium tuberculosis 0.7479 44 185
3hiu-assembly2.cif.gz_D the crystal structure of protein (xcc3681) from xanthomonas campestris pv. campestris str. atcc 33913 0.7436 50 193
4zlw-assembly1.cif.gz_G crystal structure of the pmftn variant e130a soaked in iron (overnight) 0.7433 50 189
ID Description Score Start End Superfamily
af_F1QLM2_162_414_1.20.910.10 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.9243 2 233 1.20.910.10
af_Q9LZ73_15_282_1.20.910.10 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.9211 2 233 1.20.910.10
af_Q8H109_91_338_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9173 2 233 1.20.1260.10
af_Q10L10_32_358_1.20.910.10 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.9159 2 233 1.20.910.10
af_B4FIR6_31_254_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9104 2 198 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A1H8FMC7-F1-model_v4 Uncharacterized conserved protein, contains ferritin-like DUF455 domain 0.964 4 237
AF-A0A430DSH2-F1-model_v4 DUF455 family protein 0.9639 2 237
AF-A0A7W7EYZ8-F1-model_v4 Uncharacterized ferritin-like protein (DUF455 family) 0.9636 4 237
AF-A0A219B141-F1-model_v4 Rhamnosyltransferase 0.9616 2 236 GO:0016740
AF-A0A0A7PIA5-F1-model_v4 Rhamnosyltransferase 0.9614 2 237

Feature Viewer

pLDDT pTM Quality
74.84 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map