F276278

General Info

Members Datasets Scaffolds Average Seq Length
180 139 168 700

Family's Representative Sequence

Representative Sequence 3300048928|Ga0496125_0003043|Ga0496125_0003043_11646_13988
Length 780
Sequence MGEKQVNQQSINLMITSQTIKKLIEERLTLIDRCFLLENMPHGPVRRPLPRRSSPYPKIKTGDHMTTAVLPDATDHPGASFAQTGEPHSAIASAWDDAYAATLDEAQLLLYRSNLLGADKAITNFGGGNTSAKIAMQDPLSGEQVEVLWVKGSGGDLGSIKLDGFSTLYMDKLQALRSRYRGLEHEDEMVGYLPHCTFNLNPRAASIDTPLHAYIPRSHVDHMHPDAVIAIAACKNSKALTASVFNGELGWLPWQRPGYDLGLKLEKMAREQPALKGIVLEGHGLFTWGDTAKSCYETTLDIIRRADDWLTANSKAPAFGGKRHAALPAGDRAALAARLMPLLRGKISQHEFKLGHFDDSPGVLEFVCSRDLAPLAALGTSCPDHFLRTKIRPLVLDFSPEAPDFERLIGSLDKALEDYRQDYSAYYERCRRANSPAMRDANPIIYLIPGVGMLSFAKDKATARIAGEFYLNAINVMRGANSVDAYVGLPEQEAFDIEYWLLEEAKLQRMPKPKSLAGRVALVTGGGGGIGQAVARQLLAEGACVMLTDIDQSAIDSAYQSLLKHAGPDAIGVVRADITNEQDVENVISNVALRFGGIDLLVSNAGIASASPLEDTSLEVWQRNMSVLATGYFLISRSAFRSMTAQAMGGSIVFVASKNGLVASAGASAYCTAKAAEIHLARCIALEGAPHGIRVNVVNPDAVIRGSRIWDGKWKEERAASNKIDSDNIEEFYRQRSLLKRSVLPEDIAEAVYFFVSEKSAKSTGNILNVDAGNAAAFTR

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
3 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
4 2643221645 Massilia sp. Root351 Isolate Unclassified
5 2643221664 Massilia sp. Root418 Isolate Unclassified
6 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
7 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
8 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
9 2857553236 Duganella sp. R-74557 Isolate Unclassified
10 2909042592 Labrys sp. LIt4 Isolate Nodule
11 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
12 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
13 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
42 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
43 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
45 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
47 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
48 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
57 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
60 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
61 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
62 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
63 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
64 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
65 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
66 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
67 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
68 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
69 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
70 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
71 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
72 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
73 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
74 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
75 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
76 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
77 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
78 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
79 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
80 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
81 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
82 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
83 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
84 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
85 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
86 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
87 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
88 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
89 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
90 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
91 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
92 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
93 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
94 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
95 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
96 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
97 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
98 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
99 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
100 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
101 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
102 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
103 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
104 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
105 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
106 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
107 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
108 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
109 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
110 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
111 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
112 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
113 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
114 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
115 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
116 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
117 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
118 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
121 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
122 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
125 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
126 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
127 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
128 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
129 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
130 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
131 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
132 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
133 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
134 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
135 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
136 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
137 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
138 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
139 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.33
Metatranscriptomes 0
Isolates 6.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.44
Nodule 1.67
Rhizoplane 0.56
Rhizosphere 72.78
Stem 0
Stem Tuber 0
Unclassified 10.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10012521 3300001979 Bacteria 3196
2 JGI25150J39212_1000080 3300002774 Bacteria 58442
3 JGI25153J46596_10000011 3300003215 Bacteria 319992
4 JGI25153J46596_10000025 3300003215 Bacteria 237813
5 Ga0055531_10000955 3300003794 Bacteria 23220
6 Ga0065707_10082041 3300005295 Bacteria 23822
7 Ga0065707_10082461 3300005295 Bacteria 14876
8 Ga0070706_100015675 3300005467 Bacteria 7001
9 Ga0070707_100021071 3300005468 Bacteria 6157
10 Ga0070698_100004345 3300005471 Bacteria 15581
11 Ga0070698_100044696 3300005471 Bacteria 4533
12 Ga0070698_100072146 3300005471 Bacteria 3461
13 Ga0070697_100006577 3300005536 Bacteria 9007
14 Ga0070665_100010802 3300005548 Bacteria 9235
15 Ga0070704_100016375 3300005549 Bacteria 4682
16 Ga0068855_100000220 3300005563 Bacteria 72936
17 Ga0068859_100040652 3300005617 Bacteria 4668
18 Ga0068861_100010560 3300005719 Bacteria 6411
19 Ga0068863_100005566 3300005841 Bacteria 12380
20 Ga0068860_100000928 3300005843 Bacteria 32413
21 Ga0068862_100000023 3300005844 Bacteria 203389
22 Ga0081538_10009289 3300005981 Bacteria 8228
23 Ga0075436_100052269 3300006914 Bacteria 2820
24 Ga0097620_100040652 3300006931 Bacteria 4668
25 Ga0105250_10000014 3300009092 Bacteria 268458
26 Ga0105240_10038115 3300009093 Bacteria 6169
27 Ga0105240_10040229 3300009093 Bacteria 5982
28 Ga0105240_10049772 3300009093 Bacteria 5286
29 Ga0111539_10000050 3300009094 Bacteria 118845
30 Ga0111539_10019864 3300009094 Bacteria 8278
31 Ga0105247_10007589 3300009101 Bacteria 6645
32 Ga0105247_10012495 3300009101 Bacteria 5100
33 Ga0114129_10049278 3300009147 Bacteria 5918
34 Ga0114129_10092285 3300009147 Bacteria 4195
35 Ga0105248_10043434 3300009177 Bacteria 5039
36 Ga0105249_10000004 3300009553 Bacteria 368014
37 Ga0157380_10000271 3300014326 Bacteria 31211
38 Ga0157379_10000618 3300014968 Bacteria 28738
39 Ga0213872_10002595 3300021361 Bacteria 10512
40 Ga0207425_1000027 3300025245 Bacteria 299995
41 Ga0209677_100643 3300025253 Bacteria 18518
42 Ga0209129_1002044 3300025258 Bacteria 10420
43 Ga0209676_1003889 3300025292 Bacteria 8708
44 Ga0209025_1000818 3300025294 Bacteria 49773
45 Ga0209758_1000007 3300025297 Bacteria 1270410
46 Ga0209758_1000009 3300025297 Bacteria 1123483
47 Ga0209050_1001633 3300025298 Bacteria 22962
48 Ga0209257_1001362 3300025304 Bacteria 29534
49 Ga0207696_1000087 3300025711 Bacteria 194367
50 Ga0207684_10002300 3300025910 Bacteria 19431
51 Ga0207646_10006553 3300025922 Bacteria 12015
52 Ga0207646_10020153 3300025922 Bacteria 6183
53 Ga0207667_10000044 3300025949 Bacteria 248251
54 Ga0207712_10000008 3300025961 Bacteria 527957
55 Ga0209588_1002309 3300027671 Bacteria 5162
56 Ga0207428_10000937 3300027907 Bacteria 32446
57 Ga0207428_10097599 3300027907 Bacteria 2274
58 Ga0268265_10000035 3300028380 Bacteria 207267
59 Ga0268264_10035808 3300028381 Bacteria 4087
60 Ga0265338_10017723 3300028800 Bacteria 7658
61 Ga0307511_10002924 3300030521 Bacteria 17683
62 Ga0436361_0021023 3300039447 Bacteria 16456
63 Ga0436361_0749514 3300039447 Bacteria 3290
64 Ga0451853_2904839 3300041512 Bacteria 4574
65 Ga0466969_0062326 3300044656 Bacteria 1809
66 Ga0466966_0007682 3300044684 Bacteria 7144
67 Ga0466961_0022293 3300044693 Bacteria 4074
68 Ga0466961_0048561 3300044693 Bacteria 2712
69 Ga0466963_0048116 3300044694 Bacteria 2816
70 Ga0466959_0018231 3300045049 Bacteria 5153
71 Ga0495627_000001 3300046453 Bacteria 1104709
72 Ga0495638_0002960 3300046460 Bacteria 13557
73 Ga0495638_0011306 3300046460 Bacteria 6151
74 Ga0495580_0016123 3300046472 Bacteria 5616
75 Ga0495584_0000317 3300046491 Bacteria 33691
76 Ga0495584_0008771 3300046491 Bacteria 5228
77 Ga0495594_0007632 3300046499 Bacteria 5564
78 Ga0495607_0007861 3300046501 Bacteria 7337
79 Ga0495607_0008137 3300046501 Bacteria 7191
80 Ga0495607_0022395 3300046501 Bacteria 3968
81 Ga0495583_0000098 3300046506 Bacteria 148776
82 Ga0495606_0001330 3300046507 Bacteria 33737
83 Ga0495606_0038375 3300046507 Bacteria 3241
84 Ga0495616_0008563 3300046513 Bacteria 6044
85 Ga0495630_0002965 3300046517 Bacteria 11784
86 Ga0495631_0000647 3300046518 Bacteria 22571
87 Ga0495632_0005429 3300046519 Bacteria 8429
88 Ga0495643_0000172 3300046522 Bacteria 102566
89 Ga0495644_0000478 3300046523 Bacteria 17302
90 Ga0495644_0000862 3300046523 Bacteria 12537
91 Ga0495644_0003733 3300046523 Bacteria 5994
92 Ga0495648_0000401 3300046524 Bacteria 47662
93 Ga0495648_0027258 3300046524 Bacteria 3828
94 Ga0495652_0001226 3300046529 Bacteria 28763
95 Ga0495665_0005839 3300046531 Bacteria 6640
96 Ga0495609_0000180 3300046538 Bacteria 63952
97 Ga0495609_0000653 3300046538 Bacteria 26973
98 Ga0495597_0000073 3300046542 Bacteria 87767
99 Ga0495633_0000047 3300046558 Bacteria 165890
100 Ga0495633_0010666 3300046558 Bacteria 5003
101 Ga0495633_0016145 3300046558 Bacteria 3858
102 Ga0495656_0011540 3300046615 Bacteria 3245
103 Ga0495634_0012602 3300046642 Bacteria 6121
104 Ga0495625_0003331 3300046660 Bacteria 16181
105 Ga0495659_0000375 3300046664 Bacteria 17343
106 Ga0495661_0005236 3300046665 Bacteria 9228
107 Ga0495661_0010354 3300046665 Bacteria 6363
108 Ga0495588_0005894 3300046674 Bacteria 5493
109 Ga0495623_0006366 3300046679 Bacteria 7677
110 Ga0495646_0001427 3300046680 Bacteria 14209
111 Ga0495624_0038060 3300046690 Bacteria 3092
112 Ga0495671_0000119 3300046692 Bacteria 71430
113 Ga0495589_0006927 3300046794 Bacteria 5951
114 Ga0495589_0007121 3300046794 Bacteria 5861
115 Ga0495660_0000024 3300046810 Bacteria 268209
116 Ga0495604_0008330 3300047317 Bacteria 8201
117 Ga0495636_0026135 3300047318 Bacteria 2373
118 Ga0495672_0000023 3300047320 Bacteria 419080
119 Ga0495672_0019174 3300047320 Bacteria 4520
120 Ga0495683_0007716 3300047323 Bacteria 5780
121 Ga0495687_000509 3300047443 Bacteria 46803
122 Ga0495677_0001096 3300047445 Bacteria 10837
123 Ga0495677_0002597 3300047445 Bacteria 7066
124 Ga0495685_000447 3300047447 Bacteria 12977
125 Ga0495673_0017288 3300047469 Bacteria 3668
126 Ga0495686_0012629 3300047472 Bacteria 5901
127 Ga0495615_0000018 3300048090 Bacteria 54585
128 Ga0496118_0027720 3300048921 Bacteria 4786
129 Ga0496118_0037865 3300048921 Bacteria 3874
130 Ga0496121_0010928 3300048924 Bacteria 10141
131 Ga0496121_0017056 3300048924 Bacteria 7448
132 Ga0496122_0003067 3300048925 Bacteria 22531
133 Ga0496122_0006209 3300048925 Bacteria 13861
134 Ga0496123_0000503 3300048926 Bacteria 67921
135 Ga0496123_0002101 3300048926 Bacteria 25616
136 Ga0496124_0055029 3300048927 Bacteria 3365
137 Ga0496125_0003043 3300048928 Bacteria 20963
138 Ga0496126_0000952 3300048929 Bacteria 49599
139 Ga0495678_000002 3300049459 Bacteria 999613
140 Ga0495678_001177 3300049459 Bacteria 21547
141 Ga0495678_002370 3300049459 Bacteria 12922
142 Ga0495682_0000041 3300049460 Bacteria 119154
143 Ga0501047_0018494 3300049581 Bacteria 6683
144 Ga0501072_0062356 3300049588 Bacteria 2941
145 Ga0501076_0071432 3300049592 Bacteria 2777
146 Ga0501081_0061968 3300049743 Bacteria 2593
147 nmdc:mga05p37_111094_c1 3300050507 Bacteria 3371
148 nmdc:mga05p37_126976_c1 3300050507 Bacteria 3131
149 nmdc:mga05p37_49098_c1 3300050507 Bacteria 5191
150 nmdc:mga0qj67_151427_c1 3300050509 Bacteria 1882
151 nmdc:mga08y16_10388_c1 3300050511 Bacteria 9766
152 nmdc:mga08y16_33_c1 3300050511 Bacteria 172528
153 nmdc:mga0a205_40160_c1 3300050515 Bacteria 4504
154 Ga0500643_000173 3300053087 Bacteria 63279
155 Ga0500556_0000378 3300053104 Bacteria 32489
156 Ga0500572_000165 3300053111 Bacteria 22976
157 Ga0500608_003613 3300053122 Bacteria 5833
158 Ga0500618_000149 3300053125 Bacteria 57395
159 Ga0500559_0000241 3300053136 Bacteria 43480
160 Ga0500616_0000902 3300053153 Bacteria 32595
161 Ga0500616_0005162 3300053153 Bacteria 8963
162 Ga0500630_001600 3300053159 Bacteria 10834
163 Ga0500639_000023 3300053163 Bacteria 85696
164 Ga0500639_005725 3300053163 Bacteria 6383
165 Ga0500596_000073 3300053735 Bacteria 13548
166 Ga0500596_001721 3300053735 Bacteria 4437
167 Ga0590071_000519 3300059421 Bacteria 11238
168 Ga0590077_000519 3300059426 Bacteria 10643

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050509 nmdc:mga0qj67_151427_c1 nmdc:mga0qj67_151427_c1_82_1860 574
2 3300044656 Ga0466969_0062326 Ga0466969_0062326_18_1784 583
3 3300053159 Ga0500630_001600 Ga0500630_001600_7021_8958 623
4 3300050511 nmdc:mga08y16_10388_c1 nmdc:mga08y16_10388_c1_5926_8004 639
5 3300050507 nmdc:mga05p37_126976_c1 nmdc:mga05p37_126976_c1_462_2576 646
6 3300002774 JGI25150J39212_1000080 JGI25150J39212_100008030 649
7 3300003794 Ga0055531_10000955 Ga0055531_100009554 649
8 3300053087 Ga0500643_000173 Ga0500643_000173_23896_26010 652
9 3300028381 Ga0268264_10035808 Ga0268264_100358082 661
10 3300048921 Ga0496118_0037865 Ga0496118_0037865_1004_3097 665
11 3300048924 Ga0496121_0010928 Ga0496121_0010928_4990_7083 665
12 3300003215 JGI25153J46596_10000025 JGI25153J46596_1000002558 666
13 3300025245 Ga0207425_1000027 Ga0207425_10000277 666
14 3300025258 Ga0209129_1002044 Ga0209129_10020443 666
15 3300025292 Ga0209676_1003889 Ga0209676_10038892 666
16 3300025294 Ga0209025_1000818 Ga0209025_10008187 666
17 3300025297 Ga0209758_1000009 Ga0209758_1000009236 666
18 3300025298 Ga0209050_1001633 Ga0209050_100163314 666
19 3300025304 Ga0209257_1001362 Ga0209257_100136214 666
20 3300044694 Ga0466963_0048116 Ga0466963_0048116_714_2798 669
21 3300046491 Ga0495584_0000317 Ga0495584_0000317_9371_11572 670
22 3300046524 Ga0495648_0000401 Ga0495648_0000401_43423_45624 670
23 3300046558 Ga0495633_0016145 Ga0495633_0016145_914_3013 670
24 3300047469 Ga0495673_0017288 Ga0495673_0017288_910_3009 670
25 3300046523 Ga0495644_0000862 Ga0495644_0000862_8326_10425 671
26 3300009101 Ga0105247_10012495 Ga0105247_100124954 672
27 3300048090 Ga0495615_0000018 Ga0495615_0000018_50389_52515 672
28 3300048925 Ga0496122_0003067 Ga0496122_0003067_2329_4443 672
29 3300048925 Ga0496122_0006209 Ga0496122_0006209_225_2351 672
30 3300048926 Ga0496123_0000503 Ga0496123_0000503_2300_4414 672
31 3300048926 Ga0496123_0002101 Ga0496123_0002101_10452_12578 672
32 3300005471 Ga0070698_100072146 Ga0070698_1000721461 673
33 3300025253 Ga0209677_100643 Ga0209677_10064315 673
34 3300048921 Ga0496118_0027720 Ga0496118_0027720_669_2756 673
35 3300053111 Ga0500572_000165 Ga0500572_000165_7184_9280 673
36 3300053122 Ga0500608_003613 Ga0500608_003613_1649_3745 673
37 3300053163 Ga0500639_000023 Ga0500639_000023_74679_76775 673
38 3300053735 Ga0500596_001721 Ga0500596_001721_1087_3183 673
39 3300021361 Ga0213872_10002595 Ga0213872_100025957 675
40 3300027671 Ga0209588_1002309 Ga0209588_10023092 675
41 3300039447 Ga0436361_0021023 Ga0436361_0021023_10293_12398 675
42 3300044693 Ga0466961_0022293 Ga0466961_0022293_722_2830 675
43 3300045049 Ga0466959_0018231 Ga0466959_0018231_239_2347 675
44 3300053136 Ga0500559_0000241 Ga0500559_0000241_37454_39613 675
45 3300053163 Ga0500639_005725 Ga0500639_005725_3806_5965 675
46 3300030521 Ga0307511_10002924 Ga0307511_1000292414 677
47 3300046692 Ga0495671_0000119 Ga0495671_0000119_53430_55658 677
48 3300047320 Ga0495672_0000023 Ga0495672_0000023_334892_337120 677
49 3300049592 Ga0501076_0071432 Ga0501076_0071432_75_2231 677
50 3300049743 Ga0501081_0061968 Ga0501081_0061968_246_2402 677
51 3300005563 Ga0068855_100000220 Ga0068855_10000022049 679
52 3300025949 Ga0207667_10000044 Ga0207667_1000004498 679
53 3300046460 Ga0495638_0002960 Ga0495638_0002960_1587_3677 680
54 3300053153 Ga0500616_0000902 Ga0500616_0000902_27690_29786 680
55 3300003215 JGI25153J46596_10000011 JGI25153J46596_1000001125 681
56 3300025297 Ga0209758_1000007 Ga0209758_1000007289 681
57 3300046507 Ga0495606_0001330 Ga0495606_0001330_1443_3560 681
58 3300046558 Ga0495633_0010666 Ga0495633_0010666_396_2495 681
59 3300047445 Ga0495677_0001096 Ga0495677_0001096_4880_6997 681
60 3300006914 Ga0075436_100052269 Ga0075436_1000522692 682
61 3300009147 Ga0114129_10049278 Ga0114129_100492782 683
62 3300050507 nmdc:mga05p37_111094_c1 nmdc:mga05p37_111094_c1_888_2999 683
63 3300050515 nmdc:mga0a205_40160_c1 nmdc:mga0a205_40160_c1_1648_3759 683
64 3300053104 Ga0500556_0000378 Ga0500556_0000378_27320_29419 683
65 3300053125 Ga0500618_000149 Ga0500618_000149_53672_55798 683
66 3300053153 Ga0500616_0005162 Ga0500616_0005162_3804_5903 683
67 3300028800 Ga0265338_10017723 Ga0265338_100177233 684
68 3300059421 Ga0590071_000519 Ga0590071_000519_2156_4300 684
69 3300059426 Ga0590077_000519 Ga0590077_000519_920_3028 684
70 3300005467 Ga0070706_100015675 Ga0070706_1000156754 685
71 3300005468 Ga0070707_100021071 Ga0070707_1000210711 685
72 3300005471 Ga0070698_100004345 Ga0070698_1000043458 685
73 3300005536 Ga0070697_100006577 Ga0070697_1000065774 685
74 3300005549 Ga0070704_100016375 Ga0070704_1000163753 685
75 3300025910 Ga0207684_10002300 Ga0207684_1000230012 685
76 3300025922 Ga0207646_10006553 Ga0207646_100065535 685
77 3300025922 Ga0207646_10020153 Ga0207646_100201534 685
78 3300046460 Ga0495638_0011306 Ga0495638_0011306_3209_5293 685
79 3300046660 Ga0495625_0003331 Ga0495625_0003331_8594_10678 685
80 3300005295 Ga0065707_10082041 Ga0065707_1008204118 686
81 3300005295 Ga0065707_10082461 Ga0065707_100824612 686
82 3300005471 Ga0070698_100044696 Ga0070698_1000446963 686
83 3300005548 Ga0070665_100010802 Ga0070665_1000108024 686
84 3300005617 Ga0068859_100040652 Ga0068859_1000406523 686
85 3300005841 Ga0068863_100005566 Ga0068863_1000055666 686
86 3300005843 Ga0068860_100000928 Ga0068860_1000009285 686
87 3300005844 Ga0068862_100000023 Ga0068862_100000023122 686
88 3300006931 Ga0097620_100040652 Ga0097620_1000406523 686
89 3300009092 Ga0105250_10000014 Ga0105250_1000001480 686
90 3300009093 Ga0105240_10038115 Ga0105240_100381153 686
91 3300009093 Ga0105240_10049772 Ga0105240_100497722 686
92 3300009094 Ga0111539_10019864 Ga0111539_100198644 686
93 3300009101 Ga0105247_10007589 Ga0105247_100075893 686
94 3300009177 Ga0105248_10043434 Ga0105248_100434343 686
95 3300009553 Ga0105249_10000004 Ga0105249_10000004248 686
96 3300014326 Ga0157380_10000271 Ga0157380_1000027126 686
97 3300014968 Ga0157379_10000618 Ga0157379_1000061819 686
98 3300025711 Ga0207696_1000087 Ga0207696_100008780 686
99 3300025961 Ga0207712_10000008 Ga0207712_10000008379 686
100 3300027907 Ga0207428_10097599 Ga0207428_100975991 686
101 3300028380 Ga0268265_10000035 Ga0268265_10000035116 686
102 3300041512 Ga0451853_2904839 Ga0451853_2904839_524_2641 686
103 3300044684 Ga0466966_0007682 Ga0466966_0007682_613_2733 686
104 3300044693 Ga0466961_0048561 Ga0466961_0048561_567_2687 686
105 3300046794 Ga0495589_0007121 Ga0495589_0007121_977_3082 686
106 3300048929 Ga0496126_0000952 Ga0496126_0000952_10176_12293 686
107 3300049581 Ga0501047_0018494 Ga0501047_0018494_821_2986 686
108 3300053735 Ga0500596_000073 Ga0500596_000073_2226_4343 686
109 iso_pu_bacteria 2510917020 2511123627 686
110 iso_pu_bacteria 8054302542 8054302982 686
111 iso_pu_bacteria 2909042592 2909044652 688
112 3300009147 Ga0114129_10092285 Ga0114129_100922852 691
113 3300046524 Ga0495648_0027258 Ga0495648_0027258_762_2867 691
114 3300046542 Ga0495597_0000073 Ga0495597_0000073_30549_32654 691
115 3300050507 nmdc:mga05p37_49098_c1 nmdc:mga05p37_49098_c1_1683_3794 691
116 iso_pu_bacteria 2857553236 2857555253 691
117 3300001979 JGI24740J21852_10012521 JGI24740J21852_100125211 692
118 3300005719 Ga0068861_100010560 Ga0068861_1000105605 692
119 3300005981 Ga0081538_10009289 Ga0081538_100092893 692
120 3300009093 Ga0105240_10040229 Ga0105240_100402292 692
121 3300009094 Ga0111539_10000050 Ga0111539_10000050102 692
122 3300027907 Ga0207428_10000937 Ga0207428_1000093727 692
123 3300039447 Ga0436361_0749514 Ga0436361_0749514_160_2286 692
124 3300046453 Ga0495627_000001 Ga0495627_000001_303185_305281 692
125 3300046472 Ga0495580_0016123 Ga0495580_0016123_1557_3800 692
126 3300046491 Ga0495584_0008771 Ga0495584_0008771_854_2962 692
127 3300046499 Ga0495594_0007632 Ga0495594_0007632_2050_4293 692
128 3300046501 Ga0495607_0007861 Ga0495607_0007861_1776_3875 692
129 3300046501 Ga0495607_0008137 Ga0495607_0008137_1152_3260 692
130 3300046501 Ga0495607_0022395 Ga0495607_0022395_660_2759 692
131 3300046506 Ga0495583_0000098 Ga0495583_0000098_67857_69965 692
132 3300046507 Ga0495606_0038375 Ga0495606_0038375_836_2935 692
133 3300046513 Ga0495616_0008563 Ga0495616_0008563_3413_5521 692
134 3300046517 Ga0495630_0002965 Ga0495630_0002965_7470_9713 692
135 3300046518 Ga0495631_0000647 Ga0495631_0000647_934_3042 692
136 3300046519 Ga0495632_0005429 Ga0495632_0005429_1830_3929 692
137 3300046522 Ga0495643_0000172 Ga0495643_0000172_2356_4455 692
138 3300046523 Ga0495644_0000478 Ga0495644_0000478_12994_15195 692
139 3300046523 Ga0495644_0003733 Ga0495644_0003733_3235_5343 692
140 3300046529 Ga0495652_0001226 Ga0495652_0001226_10238_12424 692
141 3300046531 Ga0495665_0005839 Ga0495665_0005839_2784_5027 692
142 3300046538 Ga0495609_0000180 Ga0495609_0000180_22593_24794 692
143 3300046538 Ga0495609_0000653 Ga0495609_0000653_24745_26841 692
144 3300046558 Ga0495633_0000047 Ga0495633_0000047_39471_41570 692
145 3300046615 Ga0495656_0011540 Ga0495656_0011540_1000_3099 692
146 3300046642 Ga0495634_0012602 Ga0495634_0012602_467_2710 692
147 3300046664 Ga0495659_0000375 Ga0495659_0000375_14438_16639 692
148 3300046665 Ga0495661_0005236 Ga0495661_0005236_4810_6909 692
149 3300046665 Ga0495661_0010354 Ga0495661_0010354_3840_5948 692
150 3300046674 Ga0495588_0005894 Ga0495588_0005894_1002_3245 692
151 3300046679 Ga0495623_0006366 Ga0495623_0006366_3310_5553 692
152 3300046680 Ga0495646_0001427 Ga0495646_0001427_10814_13000 692
153 3300046690 Ga0495624_0038060 Ga0495624_0038060_219_2501 692
154 3300046794 Ga0495589_0006927 Ga0495589_0006927_3193_5301 692
155 3300046810 Ga0495660_0000024 Ga0495660_0000024_38060_40156 692
156 3300047317 Ga0495604_0008330 Ga0495604_0008330_4097_6340 692
157 3300047318 Ga0495636_0026135 Ga0495636_0026135_179_2278 692
158 3300047320 Ga0495672_0019174 Ga0495672_0019174_1172_3373 692
159 3300047323 Ga0495683_0007716 Ga0495683_0007716_652_2760 692
160 3300047443 Ga0495687_000509 Ga0495687_000509_44522_46723 692
161 3300047445 Ga0495677_0002597 Ga0495677_0002597_875_2983 692
162 3300047447 Ga0495685_000447 Ga0495685_000447_8682_10883 692
163 3300047472 Ga0495686_0012629 Ga0495686_0012629_1147_3246 692
164 3300048924 Ga0496121_0017056 Ga0496121_0017056_3857_6004 692
165 3300048927 Ga0496124_0055029 Ga0496124_0055029_30_2126 692
166 3300048928 Ga0496125_0003043 Ga0496125_0003043_11646_13988 692
167 3300049459 Ga0495678_000002 Ga0495678_000002_244606_246702 692
168 3300049459 Ga0495678_001177 Ga0495678_001177_672_2873 692
169 3300049459 Ga0495678_002370 Ga0495678_002370_4029_6137 692
170 3300049460 Ga0495682_0000041 Ga0495682_0000041_97225_99426 692
171 3300049588 Ga0501072_0062356 Ga0501072_0062356_254_2350 692
172 3300050511 nmdc:mga08y16_33_c1 nmdc:mga08y16_33_c1_1637_3739 692
173 iso_pu_bacteria 2548876994 2550696114 692
174 iso_pu_bacteria 2600255292 2601671517 692
175 iso_pu_bacteria 2643221645 2644252921 692
176 iso_pu_bacteria 2643221664 2644355032 692
177 iso_pu_bacteria 2765235838 2765567919 692
178 iso_pu_bacteria 2839094727 2839097793 692
179 iso_pu_bacteria 2857547612 2857548649 692
180 iso_pu_bacteria 2928130867 2928132848 692

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

519

713

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

526

775

0.91

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

521

627

0.84

PF08659

KR

KR domain

520

698

0.81

PF00596

Aldolase_II

Class II Aldolase and Adducin N-terminal domain

107

310

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ni5-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase from brucella suis 0.9559 431 687
5itv-assembly1.cif.gz_A crystal structure of bacillus subtilis bacc dihydroanticapsin 7-dehydrogenase in complex with nadh 0.9535 428 685
7djs-assembly1.cif.gz_C crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9532 428 685
5itv-assembly3.cif.gz_D crystal structure of bacillus subtilis bacc dihydroanticapsin 7-dehydrogenase in complex with nadh 0.953 428 685
7djs-assembly1.cif.gz_B crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9529 431 685
ID Description Score Start End Superfamily
4ni5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9559 431 687 3.40.50.720
5k9zA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9536 426 685 3.40.50.720
5itvA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9535 428 685 3.40.50.720
5itvD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.953 428 685 3.40.50.720
af_A0A0P0X9U1_21_128_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9525 425 520 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4Q3E978-F1-model_v4 Bifunctional rhamnulose-1-phosphate aldolase/short-chain dehydrogenase (EC 4.1.2.19) 0.9774 216 692 GO:0008994
AF-A0A6L7ECE3-F1-model_v4 deleted 0.9677 427 596
AF-A0A1Q6KX94-F1-model_v4 deleted 0.962 431 606
AF-A0A4Q2Z4J9-F1-model_v4 Bifunctional rhamnulose-1-phosphate aldolase/short-chain dehydrogenase 0.9612 114 692 GO:0050664
AF-A0A3D4A6D1-F1-model_v4 Ketoacyl reductase 0.9612 427 618 GO:0016020
GO:0016491

Feature Viewer

pLDDT pTM Quality
90.82 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map