F275934

General Info

Members Datasets Scaffolds Average Seq Length
180 122 360 229

Family's Representative Sequence

Representative Sequence 3300035695|Ga0373927_0000698|Ga0373927_0000698_2242_3033
Length 263
Sequence MRGAKTRRKTVGGITQISPGRFIVRSFAIGQNRSVRVLLVEDEPRVAGFIAKGLREQAYAVDIAPDGQEALYHAGVNQYDLIILDVMLPLKDGYAVCRELRGAGLRTPILMLTARDAVEDRVTGLDCGADDYLTKPFDFKELLARLRALARRSADIRPELIRVADLTLDTGSHAVTRAGKSVTLTAKEYSLLEFLMRNQNRVVNREQIAQHVWDENFDPFSNIIDVYIRRLRTKIDAGFAPALIYTRRGAGYILTAEPVTADD

Samples

Sample ID Description Type Environment
1 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
49 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
73 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
74 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
75 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
76 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
77 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
78 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
79 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
80 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
85 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
86 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
87 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
88 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
89 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
90 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
91 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
92 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
93 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
94 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
95 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
96 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
97 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
98 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
99 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
100 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
101 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
102 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
103 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
104 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
105 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
106 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
107 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
108 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
109 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
110 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
111 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
112 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
113 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
114 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
119 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
120 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
121 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
122 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.89
Rhizosphere 93.89
Stem 0
Stem Tuber 0
Unclassified 6.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373927_0000698 3300035695 Bacteria 25694
2 Ga0070683_100137247 3300005329 Bacteria 2317
3 Ga0070683_100178759 3300005329 Bacteria 2014
4 Ga0070670_100074494 3300005331 Bacteria 2916
5 Ga0070670_100217463 3300005331 Bacteria 1662
6 Ga0070675_100001450 3300005354 Bacteria 17452
7 Ga0070675_100371681 3300005354 Bacteria 1271
8 Ga0070709_10188081 3300005434 Bacteria 1455
9 Ga0070709_10338141 3300005434 Bacteria 1109
10 Ga0070711_100014301 3300005439 Bacteria 4998
11 Ga0070705_100149778 3300005440 Bacteria 1546
12 Ga0070694_100579085 3300005444 Unclassified 902
13 Ga0070708_100046546 3300005445 Bacteria 3828
14 Ga0070708_100140873 3300005445 Bacteria 2236
15 Ga0070681_10021388 3300005458 Bacteria 6487
16 Ga0068867_100774414 3300005459 Unclassified 853
17 Ga0070706_100464701 3300005467 Bacteria 1177
18 Ga0070707_100187387 3300005468 Bacteria 2017
19 Ga0070679_100218865 3300005530 Bacteria 1866
20 Ga0070684_100482713 3300005535 Bacteria 1147
21 Ga0068853_100461831 3300005539 Bacteria 1195
22 Ga0070695_100550733 3300005545 Bacteria 899
23 Ga0070664_100070019 3300005564 Bacteria 3003
24 Ga0068857_100710966 3300005577 Bacteria 955
25 Ga0068852_100684268 3300005616 Bacteria 1035
26 Ga0068863_100046124 3300005841 Bacteria 4136
27 Ga0068858_100014169 3300005842 Bacteria 7519
28 Ga0068860_100427263 3300005843 Bacteria 1314
29 Ga0081539_10010016 3300005985 Bacteria 7803
30 Ga0097621_100123302 3300006237 Bacteria 2200
31 Ga0068871_100108430 3300006358 Bacteria 2334
32 Ga0075433_10113173 3300006852 Bacteria 2407
33 Ga0075433_10164649 3300006852 Bacteria 1974
34 Ga0075433_10569555 3300006852 Bacteria 995
35 Ga0075433_10814131 3300006852 Bacteria 816
36 Ga0075434_100117659 3300006871 Bacteria 2671
37 Ga0075434_100364095 3300006871 Bacteria 1467
38 Ga0075436_100027243 3300006914 Bacteria 3934
39 Ga0075436_100056022 3300006914 Bacteria 2723
40 Ga0075435_100955072 3300007076 Bacteria 748
41 Ga0105240_10312483 3300009093 Bacteria 1794
42 Ga0105240_10411558 3300009093 Bacteria 1521
43 Ga0105245_10010175 3300009098 Bacteria 8190
44 Ga0105247_10066019 3300009101 Bacteria 2252
45 Ga0114129_10000922 3300009147 Bacteria 38366
46 Ga0114129_10002932 3300009147 Bacteria 23862
47 Ga0114129_10025378 3300009147 Bacteria 8397
48 Ga0114129_10043634 3300009147 Bacteria 6309
49 Ga0105241_10317700 3300009174 Bacteria 1342
50 Ga0105242_10010590 3300009176 Bacteria 7080
51 Ga0105248_10005040 3300009177 Bacteria 14589
52 Ga0105248_10023282 3300009177 Bacteria 6879
53 Ga0105248_10151347 3300009177 Bacteria 2618
54 Ga0105248_10153962 3300009177 Bacteria 2594
55 Ga0105248_10219881 3300009177 Bacteria 2138
56 Ga0105248_10453473 3300009177 Bacteria 1445
57 Ga0105246_10017788 3300011119 Bacteria 4521
58 Ga0105246_10279454 3300011119 Bacteria 1338
59 Ga0157374_10039485 3300013296 Bacteria 4344
60 Ga0157374_10144021 3300013296 Bacteria 2314
61 Ga0157374_10947794 3300013296 Bacteria 879
62 Ga0157378_10156168 3300013297 Bacteria 2130
63 Ga0163162_10044443 3300013306 Bacteria 4449
64 Ga0157372_10351117 3300013307 Bacteria 1718
65 Ga0163163_10028417 3300014325 Bacteria 5369
66 Ga0163163_10098181 3300014325 Bacteria 2950
67 Ga0163163_10232902 3300014325 Unclassified 1891
68 Ga0163163_10343329 3300014325 Bacteria 1548
69 Ga0157379_10005893 3300014968 Bacteria 10547
70 Ga0157379_10015318 3300014968 Bacteria 6726
71 Ga0157376_10003506 3300014969 Bacteria 10822
72 Ga0157376_10179659 3300014969 Bacteria 1933
73 Ga0213872_10007013 3300021361 Bacteria 5584
74 Ga0213876_10193281 3300021384 Bacteria 1082
75 Ga0213875_10022854 3300021388 Bacteria 2990
76 Ga0207710_10051870 3300025900 Bacteria 1843
77 Ga0207684_10259954 3300025910 Bacteria 1498
78 Ga0207684_10370730 3300025910 Bacteria 1232
79 Ga0207707_10016276 3300025912 Bacteria 6487
80 Ga0207707_10205738 3300025912 Bacteria 1715
81 Ga0207695_10287454 3300025913 Bacteria 1537
82 Ga0207663_10048324 3300025916 Bacteria 2633
83 Ga0207652_10273089 3300025921 Bacteria 1525
84 Ga0207646_10298134 3300025922 Bacteria 1457
85 Ga0207659_10000080 3300025926 Bacteria 60332
86 Ga0207687_10017567 3300025927 Bacteria 4712
87 Ga0207644_10542813 3300025931 Bacteria 962
88 Ga0207686_10021213 3300025934 Bacteria 3724
89 Ga0207704_10049952 3300025938 Bacteria 2520
90 Ga0207711_10046330 3300025941 Bacteria 3715
91 Ga0207711_10215040 3300025941 Bacteria 1757
92 Ga0207711_10465874 3300025941 Unclassified 1177
93 Ga0207661_10164714 3300025944 Bacteria 1926
94 Ga0207661_10207855 3300025944 Bacteria 1724
95 Ga0207679_10058190 3300025945 Bacteria 2862
96 Ga0207703_10520948 3300026035 Bacteria 1118
97 Ga0207708_10222041 3300026075 Bacteria 1514
98 Ga0207641_10045101 3300026088 Bacteria 3711
99 Ga0207641_10131011 3300026088 Bacteria 2252
100 Ga0207676_10375096 3300026095 Bacteria 1323
101 Ga0207676_10519037 3300026095 Bacteria 1134
102 Ga0207674_10954177 3300026116 Bacteria 826
103 Ga0209971_1045749 3300027682 Bacteria 1056
104 Ga0268266_10002380 3300028379 Bacteria 20327
105 Ga0268264_11135461 3300028381 Bacteria 790
106 Ga0265323_10003010 3300028653 Bacteria 7527
107 Ga0265323_10008447 3300028653 Bacteria 4245
108 Ga0265331_10032364 3300031250 Bacteria 2592
109 Ga0265316_10010408 3300031344 Bacteria 8478
110 Ga0265316_10029363 3300031344 Bacteria 4523
111 Ga0316579_10061129 3300031691 Bacteria 1773
112 Ga0373926_0038989 3300035083 Bacteria 1693
113 Ga0373943_0083400 3300035170 Bacteria 1643
114 Ga0316574_0019827 3300035398 Bacteria 3974
115 Ga0373935_0276056 3300035692 Bacteria 1182
116 Ga0373927_0406577 3300035695 Bacteria 898
117 Ga0373927_0507288 3300035695 Bacteria 797
118 Ga0373937_0335822 3300036401 Bacteria 1431
119 Ga0373925_0563409 3300037068 Unclassified 937
120 Ga0436364_0021199 3300037853 Bacteria 1926
121 Ga0436365_0137842 3300039437 Bacteria 5694
122 Ga0436361_0264165 3300039447 Unclassified 3380
123 Ga0451793_1554342 3300041452 Bacteria 1527
124 Ga0466966_0167802 3300044684 Bacteria 1335
125 Ga0451576_0026567 3300045051 Bacteria 6226
126 Ga0495603_0131678 3300046455 Unclassified 1456
127 Ga0495651_0011842 3300046462 Bacteria 6707
128 Ga0495653_0113609 3300046463 Bacteria 1942
129 Ga0495580_0018240 3300046472 Bacteria 5228
130 Ga0495580_0036762 3300046472 Bacteria 3515
131 Ga0495580_0043022 3300046472 Bacteria 3216
132 Ga0495582_0293507 3300046473 Bacteria 934
133 Ga0495594_0069120 3300046499 Unclassified 1962
134 Ga0495594_0069378 3300046499 Unclassified 1958
135 Ga0495594_0133939 3300046499 Bacteria 1404
136 Ga0495628_0125686 3300046516 Bacteria 1965
137 Ga0495630_0393409 3300046517 Unclassified 1062
138 Ga0495652_0124040 3300046529 Bacteria 2055
139 Ga0495652_0404732 3300046529 Bacteria 965
140 Ga0495665_0015721 3300046531 Bacteria 4075
141 Ga0495640_0058071 3300046533 Bacteria 2640
142 Ga0495587_0039783 3300046536 Bacteria 2813
143 Ga0495587_0103314 3300046536 Unclassified 1641
144 Ga0495645_0187807 3300046543 Bacteria 1411
145 Ga0495645_0452597 3300046543 Unclassified 809
146 Ga0495667_0052092 3300046559 Bacteria 2698
147 Ga0495667_0076993 3300046559 Bacteria 2170
148 Ga0495634_0016881 3300046642 Bacteria 5215
149 Ga0495634_0126513 3300046642 Bacteria 1633
150 Ga0495657_0083263 3300046675 Bacteria 2065
151 Ga0495623_0006736 3300046679 Bacteria 7476
152 Ga0495669_0172555 3300046684 Bacteria 1029
153 Ga0495613_0076747 3300046689 Bacteria 2431
154 Ga0495600_0178246 3300046809 Bacteria 1370
155 Ga0495674_0020039 3300047319 Bacteria 6200
156 Ga0495674_0056927 3300047319 Bacteria 3423
157 Ga0495674_0140075 3300047319 Bacteria 2034
158 Ga0495680_0061852 3300047322 Bacteria 2879
159 Ga0495675_0082702 3300047444 Bacteria 2021
160 Ga0495684_0009128 3300047471 Bacteria 7659
161 Ga0495684_0108708 3300047471 Bacteria 2094
162 Ga0495593_0072821 3300047673 Bacteria 1783
163 Ga0495602_0009910 3300048088 Bacteria 9884
164 Ga0495602_0076484 3300048088 Bacteria 2836
165 Ga0496104_0044746 3300048907 Bacteria 4160
166 Ga0496109_0000067 3300048912 Bacteria 110821
167 Ga0496110_0828818 3300048913 Bacteria 830
168 Ga0496114_0050090 3300048917 Bacteria 3476
169 Ga0496114_0343347 3300048917 Bacteria 1320
170 Ga0496114_0426622 3300048917 Bacteria 1175
171 Ga0501067_0323582 3300049583 Bacteria 859
172 Ga0501069_0428029 3300049585 Bacteria 785
173 nmdc:mga05p37_1443_c1 3300050507 Bacteria 27640
174 nmdc:mga05p37_22580_c1 3300050507 Bacteria 7630
175 nmdc:mga05p37_45986_c1 3300050507 Bacteria 5368
176 nmdc:mga05p37_581116_c1 3300050507 Bacteria 1269
177 nmdc:mga08x19_241975_c1 3300050514 Bacteria 1244
178 nmdc:mga08x19_4564_c1 3300050514 Bacteria 8219
179 nmdc:mga0a205_312523_c1 3300050515 Bacteria 1443
180 nmdc:mga0a205_46914_c1 3300050515 Bacteria 4167
181 Ga0373927_0000698
182 Ga0070683_100137247
183 Ga0070683_100178759
184 Ga0070670_100074494
185 Ga0070670_100217463
186 Ga0070675_100001450
187 Ga0070675_100371681
188 Ga0070709_10188081
189 Ga0070709_10338141
190 Ga0070711_100014301
191 Ga0070705_100149778
192 Ga0070694_100579085
193 Ga0070708_100046546
194 Ga0070708_100140873
195 Ga0070681_10021388
196 Ga0068867_100774414
197 Ga0070706_100464701
198 Ga0070707_100187387
199 Ga0070679_100218865
200 Ga0070684_100482713
201 Ga0068853_100461831
202 Ga0070695_100550733
203 Ga0070664_100070019
204 Ga0068857_100710966
205 Ga0068852_100684268
206 Ga0068863_100046124
207 Ga0068858_100014169
208 Ga0068860_100427263
209 Ga0081539_10010016
210 Ga0097621_100123302
211 Ga0068871_100108430
212 Ga0075433_10113173
213 Ga0075433_10164649
214 Ga0075433_10569555
215 Ga0075433_10814131
216 Ga0075434_100117659
217 Ga0075434_100364095
218 Ga0075436_100027243
219 Ga0075436_100056022
220 Ga0075435_100955072
221 Ga0105240_10312483
222 Ga0105240_10411558
223 Ga0105245_10010175
224 Ga0105247_10066019
225 Ga0114129_10000922
226 Ga0114129_10002932
227 Ga0114129_10025378
228 Ga0114129_10043634
229 Ga0105241_10317700
230 Ga0105242_10010590
231 Ga0105248_10005040
232 Ga0105248_10023282
233 Ga0105248_10151347
234 Ga0105248_10153962
235 Ga0105248_10219881
236 Ga0105248_10453473
237 Ga0105246_10017788
238 Ga0105246_10279454
239 Ga0157374_10039485
240 Ga0157374_10144021
241 Ga0157374_10947794
242 Ga0157378_10156168
243 Ga0163162_10044443
244 Ga0157372_10351117
245 Ga0163163_10028417
246 Ga0163163_10098181
247 Ga0163163_10232902
248 Ga0163163_10343329
249 Ga0157379_10005893
250 Ga0157379_10015318
251 Ga0157376_10003506
252 Ga0157376_10179659
253 Ga0213872_10007013
254 Ga0213876_10193281
255 Ga0213875_10022854
256 Ga0207710_10051870
257 Ga0207684_10259954
258 Ga0207684_10370730
259 Ga0207707_10016276
260 Ga0207707_10205738
261 Ga0207695_10287454
262 Ga0207663_10048324
263 Ga0207652_10273089
264 Ga0207646_10298134
265 Ga0207659_10000080
266 Ga0207687_10017567
267 Ga0207644_10542813
268 Ga0207686_10021213
269 Ga0207704_10049952
270 Ga0207711_10046330
271 Ga0207711_10215040
272 Ga0207711_10465874
273 Ga0207661_10164714
274 Ga0207661_10207855
275 Ga0207679_10058190
276 Ga0207703_10520948
277 Ga0207708_10222041
278 Ga0207641_10045101
279 Ga0207641_10131011
280 Ga0207676_10375096
281 Ga0207676_10519037
282 Ga0207674_10954177
283 Ga0209971_1045749
284 Ga0268266_10002380
285 Ga0268264_11135461
286 Ga0265323_10003010
287 Ga0265323_10008447
288 Ga0265331_10032364
289 Ga0265316_10010408
290 Ga0265316_10029363
291 Ga0316579_10061129
292 Ga0373926_0038989
293 Ga0373943_0083400
294 Ga0316574_0019827
295 Ga0373935_0276056
296 Ga0373927_0406577
297 Ga0373927_0507288
298 Ga0373937_0335822
299 Ga0373925_0563409
300 Ga0436364_0021199
301 Ga0436365_0137842
302 Ga0436361_0264165
303 Ga0451793_1554342
304 Ga0466966_0167802
305 Ga0451576_0026567
306 Ga0495603_0131678
307 Ga0495651_0011842
308 Ga0495653_0113609
309 Ga0495580_0018240
310 Ga0495580_0036762
311 Ga0495580_0043022
312 Ga0495582_0293507
313 Ga0495594_0069120
314 Ga0495594_0069378
315 Ga0495594_0133939
316 Ga0495628_0125686
317 Ga0495630_0393409
318 Ga0495652_0124040
319 Ga0495652_0404732
320 Ga0495665_0015721
321 Ga0495640_0058071
322 Ga0495587_0039783
323 Ga0495587_0103314
324 Ga0495645_0187807
325 Ga0495645_0452597
326 Ga0495667_0052092
327 Ga0495667_0076993
328 Ga0495634_0016881
329 Ga0495634_0126513
330 Ga0495657_0083263
331 Ga0495623_0006736
332 Ga0495669_0172555
333 Ga0495613_0076747
334 Ga0495600_0178246
335 Ga0495674_0020039
336 Ga0495674_0056927
337 Ga0495674_0140075
338 Ga0495680_0061852
339 Ga0495675_0082702
340 Ga0495684_0009128
341 Ga0495684_0108708
342 Ga0495593_0072821
343 Ga0495602_0009910
344 Ga0495602_0076484
345 Ga0496104_0044746
346 Ga0496109_0000067
347 Ga0496110_0828818
348 Ga0496114_0050090
349 Ga0496114_0343347
350 Ga0496114_0426622
351 Ga0501067_0323582
352 Ga0501069_0428029
353 nmdc:mga05p37_1443_c1
354 nmdc:mga05p37_22580_c1
355 nmdc:mga05p37_45986_c1
356 nmdc:mga05p37_581116_c1
357 nmdc:mga08x19_241975_c1
358 nmdc:mga08x19_4564_c1
359 nmdc:mga0a205_312523_c1
360 nmdc:mga0a205_46914_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

37

147

0.99

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

179

254

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9881 1 118
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.988 1 118
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9853 2 119
6is2-assembly1.cif.gz_A crystal structure of staphylococcus aureus response regulator arlr receiver domain in complex with mg 0.9824 1 118
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.981 1 118
ID Description Score Start End Superfamily
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9956 1 80 3.40.50.2300
af_P30843_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.985 1 80 3.40.50.2300
af_Q9KJN4_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9841 1 80 3.40.50.2300
af_Q2FY79_1_81_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9822 2 80 3.40.50.2300
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9808 1 82 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1Y5GIU6-F1-model_v4 DNA-binding response regulator 0.9366 1 221 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A1Y5GIU6-F1-model_v4 DNA-binding response regulator 0.9283 1 221 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A2R2W5S8-F1-model_v4 Transcriptional regulatory protein TcrA 0.9194 1 227 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A2R2W5S8-F1-model_v4 Transcriptional regulatory protein TcrA 0.9156 1 227 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A0Q4JC24-F1-model_v4 Two-component system response regulator 0.9123 1 223 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Map