F275420

General Info

Members Datasets Scaffolds Average Seq Length
180 111 360 301

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100113083|Ga0075429_1001130832
Length 315
Sequence MSLGPEEFRLHLELSAATAGIALPRIVLPDAHDVVLGRMRLHYLDWGIAGQPPVLFLHGGGLNAHTWDLVCASLRTERHCLAMDQRGHGESEWSPTMDYSTESQVADLDAFVERLGLGSATGSALGRFVLVGMSLGGVNAMAWAARNSRRLAGLVVVDVGPEIRTDGVRKIQAFTSEATPLASVDEYIERAMSFNPRRNRELLRRSLLHNLRQMPDGRWMWKYDQRHRGKVDPGAQARRRELLWAAVDAVECPTLVVRGAESDVFHDEDAEKMVARFRQARWVKIPRAGHTVQGDNPADLIRELRPFLDEVAPRG

Samples

Sample ID Description Type Environment
1 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
40 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
41 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
42 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
62 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
65 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
66 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
67 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
68 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
69 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
70 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
71 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
72 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
75 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
76 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
77 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
78 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
79 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
80 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
83 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
84 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
85 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
86 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
87 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
88 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
94 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
95 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
96 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
97 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
98 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
99 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
100 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
101 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
102 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
103 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
104 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
105 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
106 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
107 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
108 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
109 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
110 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
111 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 1.67
Rhizosphere 94.44
Stem 0
Stem Tuber 0
Unclassified 6.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075429_100113083 3300006880 Bacteria 2373
2 Ga0070680_100055114 3300005336 Unclassified 3248
3 Ga0070668_100277995 3300005347 Bacteria 1397
4 Ga0070669_100019256 3300005353 Bacteria 4875
5 Ga0070714_100023047 3300005435 Bacteria 5111
6 Ga0070713_100027508 3300005436 Bacteria 4478
7 Ga0070713_100281245 3300005436 Bacteria 1527
8 Ga0070713_100569417 3300005436 Bacteria 1074
9 Ga0070701_10129771 3300005438 Bacteria 1431
10 Ga0070705_100032399 3300005440 Bacteria 2903
11 Ga0070694_100208673 3300005444 Unclassified 1460
12 Ga0070708_100020655 3300005445 Bacteria 5558
13 Ga0070708_100037976 3300005445 Bacteria 4204
14 Ga0070708_100089954 3300005445 Bacteria 2794
15 Ga0070681_10253801 3300005458 Unclassified 1671
16 Ga0070706_100032778 3300005467 Bacteria 4793
17 Ga0070706_100085464 3300005467 Unclassified 2923
18 Ga0070707_100006005 3300005468 Bacteria 11331
19 Ga0070707_100034426 3300005468 Bacteria 4830
20 Ga0070698_100218900 3300005471 Bacteria 1838
21 Ga0070698_100721510 3300005471 Unclassified 939
22 Ga0070699_100229136 3300005518 Bacteria 1657
23 Ga0070699_100245243 3300005518 Bacteria 1600
24 Ga0070672_100137837 3300005543 Bacteria 2010
25 Ga0070696_100024896 3300005546 Bacteria 4068
26 Ga0070696_100052064 3300005546 Bacteria 2848
27 Ga0070704_100015401 3300005549 Bacteria 4802
28 Ga0070704_100139422 3300005549 Bacteria 1891
29 Ga0070704_100349599 3300005549 Bacteria 1247
30 Ga0068855_100262893 3300005563 Bacteria 1922
31 Ga0068857_100150110 3300005577 Bacteria 2111
32 Ga0068859_100086659 3300005617 Bacteria 3179
33 Ga0068859_100237246 3300005617 Bacteria 1912
34 Ga0068859_100262236 3300005617 Bacteria 1819
35 Ga0068859_100399807 3300005617 Bacteria 1470
36 Ga0068862_100029767 3300005844 Bacteria 4601
37 Ga0081538_10040737 3300005981 Bacteria 2958
38 Ga0070717_10070187 3300006028 Bacteria 2919
39 Ga0075428_100000367 3300006844 Bacteria 44787
40 Ga0075428_100018013 3300006844 Bacteria 7805
41 Ga0075428_100263901 3300006844 Bacteria 1854
42 Ga0075430_100000036 3300006846 Bacteria 68655
43 Ga0075430_100000577 3300006846 Bacteria 27863
44 Ga0075430_100017550 3300006846 Bacteria 6096
45 Ga0075431_100000847 3300006847 Bacteria 26809
46 Ga0075431_100005295 3300006847 Bacteria 12717
47 Ga0075431_100024850 3300006847 Bacteria 6142
48 Ga0075431_100048763 3300006847 Bacteria 4368
49 Ga0075431_100273644 3300006847 Bacteria 1711
50 Ga0075431_100339926 3300006847 Bacteria 1511
51 Ga0075434_100156193 3300006871 Bacteria 2300
52 Ga0075429_100000001 3300006880 Bacteria 139031
53 Ga0097620_100086659 3300006931 Bacteria 3179
54 Ga0097620_100262229 3300006931 Bacteria 1819
55 Ga0097620_100399825 3300006931 Bacteria 1470
56 Ga0075435_100015756 3300007076 Bacteria 5687
57 Ga0075435_100307261 3300007076 Bacteria 1357
58 Ga0111539_10021877 3300009094 Bacteria 7862
59 Ga0111539_10054073 3300009094 Bacteria 4778
60 Ga0111539_10357680 3300009094 Bacteria 1699
61 Ga0111539_10486116 3300009094 Bacteria 1438
62 Ga0114129_10031995 3300009147 Bacteria 7436
63 Ga0114129_10055811 3300009147 Bacteria 5536
64 Ga0114129_10081369 3300009147 Bacteria 4501
65 Ga0114129_10087700 3300009147 Bacteria 4314
66 Ga0114129_10125665 3300009147 Bacteria 3526
67 Ga0114129_10256818 3300009147 Bacteria 2344
68 Ga0114129_10310802 3300009147 Bacteria 2098
69 Ga0114129_10445758 3300009147 Unclassified 1698
70 Ga0114129_10527049 3300009147 Bacteria 1539
71 Ga0105242_10300180 3300009176 Bacteria 1466
72 Ga0105238_10054710 3300009551 Bacteria 4007
73 Ga0157378_10368628 3300013297 Bacteria 1407
74 Ga0163162_10023969 3300013306 Bacteria 6022
75 Ga0157375_10083579 3300013308 Bacteria 3238
76 Ga0157375_10593795 3300013308 Bacteria 1267
77 Ga0157379_10253370 3300014968 Bacteria 1598
78 Ga0163161_10158149 3300017792 Bacteria 1726
79 Ga0213876_10010306 3300021384 Bacteria 5019
80 Ga0213876_10109681 3300021384 Bacteria 1465
81 Ga0213875_10146753 3300021388 Bacteria 1105
82 Ga0207699_10107561 3300025906 Bacteria 1782
83 Ga0207643_10147733 3300025908 Bacteria 1407
84 Ga0207707_10124433 3300025912 Bacteria 2255
85 Ga0207660_10058523 3300025917 Unclassified 2764
86 Ga0207646_10143877 3300025922 Bacteria 2148
87 Ga0207681_10027517 3300025923 Bacteria 3677
88 Ga0207694_10041441 3300025924 Bacteria 3548
89 Ga0207700_10089263 3300025928 Bacteria 2429
90 Ga0207664_10021897 3300025929 Bacteria 4763
91 Ga0207686_10075074 3300025934 Bacteria 2187
92 Ga0207691_10143437 3300025940 Bacteria 2103
93 Ga0207689_10088898 3300025942 Bacteria 2538
94 Ga0207712_10082280 3300025961 Bacteria 2347
95 Ga0207668_10093894 3300025972 Bacteria 2211
96 Ga0207703_10196834 3300026035 Bacteria 1789
97 Ga0207639_10169136 3300026041 Bacteria 1849
98 Ga0207648_10056296 3300026089 Bacteria 3432
99 Ga0207648_10424298 3300026089 Bacteria 1208
100 Ga0207674_10082994 3300026116 Bacteria 3204
101 Ga0207675_100009840 3300026118 Bacteria 8946
102 Ga0207428_10000049 3300027907 Bacteria 179267
103 Ga0207428_10062657 3300027907 Bacteria 2940
104 Ga0268265_10014997 3300028380 Bacteria 5291
105 Ga0268264_10027185 3300028381 Bacteria 4673
106 Ga0307408_100026281 3300031548 Bacteria 3997
107 Ga0307405_10275688 3300031731 Bacteria 1263
108 Ga0373932_0069136 3300035112 Bacteria 1091
109 Ga0373936_0042587 3300035113 Bacteria 1823
110 Ga0373957_0133653 3300035120 Unclassified 1011
111 Ga0373962_0038525 3300035242 Bacteria 1338
112 Ga0373931_0006064 3300035691 Bacteria 5630
113 Ga0373931_0020282 3300035691 Bacteria 3324
114 Ga0373935_0036616 3300035692 Bacteria 3069
115 Ga0395899_0007332 3300037312 Bacteria 8532
116 Ga0395900_0030228 3300037418 Bacteria 5561
117 Ga0395898_0039128 3300037466 Bacteria 4695
118 Ga0436365_0843534 3300039437 Bacteria 5092
119 Ga0436365_1536298 3300039437 Bacteria 1606
120 Ga0436361_1113559 3300039447 Bacteria 6973
121 Ga0436363_0073490 3300039450 Bacteria 1550
122 Ga0451577_0034369 3300042876 Bacteria 4570
123 Ga0453683_0038534 3300044673 Bacteria 3005
124 Ga0453683_0230063 3300044673 Bacteria 1180
125 Ga0451576_0203641 3300045051 Bacteria 2067
126 Ga0451576_0332793 3300045051 Bacteria 1589
127 Ga0466967_0276977 3300045976 Bacteria 1609
128 Ga0495603_0019336 3300046455 Bacteria 4123
129 Ga0495656_0002289 3300046615 Bacteria 6324
130 Ga0495669_0064716 3300046684 Bacteria 1659
131 Ga0496102_0039005 3300048905 Bacteria 4290
132 Ga0496103_0055372 3300048906 Bacteria 2460
133 Ga0496110_0133727 3300048913 Unclassified 2241
134 Ga0501039_0157791 3300049575 Bacteria 1783
135 Ga0501039_0290233 3300049575 Bacteria 1286
136 Ga0501040_0110061 3300049576 Bacteria 1926
137 Ga0501040_0277151 3300049576 Bacteria 1198
138 Ga0501041_0357624 3300049577 Unclassified 923
139 Ga0501042_0087676 3300049578 Bacteria 2233
140 Ga0501046_0508658 3300049580 Bacteria 862
141 Ga0501068_0344517 3300049584 Bacteria 957
142 Ga0501071_0282158 3300049587 Unclassified 1257
143 Ga0501072_0001275 3300049588 Bacteria 18814
144 Ga0501075_0083088 3300049591 Bacteria 2426
145 Ga0501075_0182496 3300049591 Bacteria 1601
146 Ga0501076_0229814 3300049592 Bacteria 1516
147 Ga0501076_0237817 3300049592 Bacteria 1489
148 Ga0501077_0136840 3300049593 Bacteria 1553
149 Ga0501079_0322705 3300049741 Bacteria 1209
150 Ga0501045_0196945 3300049824 Bacteria 1501
151 nmdc:mga05p37_228851_c1 3300050507 Bacteria 2241
152 nmdc:mga05p37_24015_c1 3300050507 Bacteria 7405
153 nmdc:mga05p37_36990_c1 3300050507 Bacteria 5987
154 nmdc:mga05p37_427011_c1 3300050507 Bacteria 1541
155 nmdc:mga09592_101615_c1 3300050508 Bacteria 2463
156 nmdc:mga09592_137799_c1 3300050508 Bacteria 2103
157 nmdc:mga09592_342590_c1 3300050508 Bacteria 1294
158 nmdc:mga09592_66_c1 3300050508 Bacteria 59617
159 nmdc:mga0qj67_171705_c1 3300050509 Bacteria 1761
160 nmdc:mga0qj67_21175_c1 3300050509 Bacteria 4986
161 nmdc:mga0qj67_214857_c1 3300050509 Unclassified 1561
162 nmdc:mga0qj67_9017_c1 3300050509 Bacteria 7402
163 nmdc:mga06r32_21946_c1 3300050510 Bacteria 5896
164 nmdc:mga06r32_3135_c1 3300050510 Bacteria 14812
165 nmdc:mga06r32_46521_c1 3300050510 Bacteria 4140
166 nmdc:mga06r32_570166_c1 3300050510 Bacteria 1105
167 nmdc:mga06r32_602859_c1 3300050510 Bacteria 1069
168 nmdc:mga08y16_1496_c1 3300050511 Bacteria 23521
169 nmdc:mga08y16_39263_c1 3300050511 Bacteria 4967
170 nmdc:mga0n895_352990_c1 3300050512 Bacteria 1489
171 nmdc:mga0n895_7592_c1 3300050512 Bacteria 9323
172 nmdc:mga0rr50_14777_c1 3300050513 Bacteria 5134
173 nmdc:mga0rr50_173739_c1 3300050513 Bacteria 1757
174 nmdc:mga0rr50_36096_c1 3300050513 Bacteria 3556
175 nmdc:mga0a205_75837_c1 3300050515 Bacteria 3249
176 Ga0495601_0154118 3300053077 Bacteria 1500
177 Ga0500568_0004956 3300053139 Bacteria 6997
178 Ga0530510_0116527 3300061734 Bacteria 1959
179 Ga0530510_0193224 3300061734 Bacteria 1511
180 Ga0530510_0378671 3300061734 Bacteria 1065
181 Ga0075429_100113083
182 Ga0070680_100055114
183 Ga0070668_100277995
184 Ga0070669_100019256
185 Ga0070714_100023047
186 Ga0070713_100027508
187 Ga0070713_100281245
188 Ga0070713_100569417
189 Ga0070701_10129771
190 Ga0070705_100032399
191 Ga0070694_100208673
192 Ga0070708_100020655
193 Ga0070708_100037976
194 Ga0070708_100089954
195 Ga0070681_10253801
196 Ga0070706_100032778
197 Ga0070706_100085464
198 Ga0070707_100006005
199 Ga0070707_100034426
200 Ga0070698_100218900
201 Ga0070698_100721510
202 Ga0070699_100229136
203 Ga0070699_100245243
204 Ga0070672_100137837
205 Ga0070696_100024896
206 Ga0070696_100052064
207 Ga0070704_100015401
208 Ga0070704_100139422
209 Ga0070704_100349599
210 Ga0068855_100262893
211 Ga0068857_100150110
212 Ga0068859_100086659
213 Ga0068859_100237246
214 Ga0068859_100262236
215 Ga0068859_100399807
216 Ga0068862_100029767
217 Ga0081538_10040737
218 Ga0070717_10070187
219 Ga0075428_100000367
220 Ga0075428_100018013
221 Ga0075428_100263901
222 Ga0075430_100000036
223 Ga0075430_100000577
224 Ga0075430_100017550
225 Ga0075431_100000847
226 Ga0075431_100005295
227 Ga0075431_100024850
228 Ga0075431_100048763
229 Ga0075431_100273644
230 Ga0075431_100339926
231 Ga0075434_100156193
232 Ga0075429_100000001
233 Ga0097620_100086659
234 Ga0097620_100262229
235 Ga0097620_100399825
236 Ga0075435_100015756
237 Ga0075435_100307261
238 Ga0111539_10021877
239 Ga0111539_10054073
240 Ga0111539_10357680
241 Ga0111539_10486116
242 Ga0114129_10031995
243 Ga0114129_10055811
244 Ga0114129_10081369
245 Ga0114129_10087700
246 Ga0114129_10125665
247 Ga0114129_10256818
248 Ga0114129_10310802
249 Ga0114129_10445758
250 Ga0114129_10527049
251 Ga0105242_10300180
252 Ga0105238_10054710
253 Ga0157378_10368628
254 Ga0163162_10023969
255 Ga0157375_10083579
256 Ga0157375_10593795
257 Ga0157379_10253370
258 Ga0163161_10158149
259 Ga0213876_10010306
260 Ga0213876_10109681
261 Ga0213875_10146753
262 Ga0207699_10107561
263 Ga0207643_10147733
264 Ga0207707_10124433
265 Ga0207660_10058523
266 Ga0207646_10143877
267 Ga0207681_10027517
268 Ga0207694_10041441
269 Ga0207700_10089263
270 Ga0207664_10021897
271 Ga0207686_10075074
272 Ga0207691_10143437
273 Ga0207689_10088898
274 Ga0207712_10082280
275 Ga0207668_10093894
276 Ga0207703_10196834
277 Ga0207639_10169136
278 Ga0207648_10056296
279 Ga0207648_10424298
280 Ga0207674_10082994
281 Ga0207675_100009840
282 Ga0207428_10000049
283 Ga0207428_10062657
284 Ga0268265_10014997
285 Ga0268264_10027185
286 Ga0307408_100026281
287 Ga0307405_10275688
288 Ga0373932_0069136
289 Ga0373936_0042587
290 Ga0373957_0133653
291 Ga0373962_0038525
292 Ga0373931_0006064
293 Ga0373931_0020282
294 Ga0373935_0036616
295 Ga0395899_0007332
296 Ga0395900_0030228
297 Ga0395898_0039128
298 Ga0436365_0843534
299 Ga0436365_1536298
300 Ga0436361_1113559
301 Ga0436363_0073490
302 Ga0451577_0034369
303 Ga0453683_0038534
304 Ga0453683_0230063
305 Ga0451576_0203641
306 Ga0451576_0332793
307 Ga0466967_0276977
308 Ga0495603_0019336
309 Ga0495656_0002289
310 Ga0495669_0064716
311 Ga0496102_0039005
312 Ga0496103_0055372
313 Ga0496110_0133727
314 Ga0501039_0157791
315 Ga0501039_0290233
316 Ga0501040_0110061
317 Ga0501040_0277151
318 Ga0501041_0357624
319 Ga0501042_0087676
320 Ga0501046_0508658
321 Ga0501068_0344517
322 Ga0501071_0282158
323 Ga0501072_0001275
324 Ga0501075_0083088
325 Ga0501075_0182496
326 Ga0501076_0229814
327 Ga0501076_0237817
328 Ga0501077_0136840
329 Ga0501079_0322705
330 Ga0501045_0196945
331 nmdc:mga05p37_228851_c1
332 nmdc:mga05p37_24015_c1
333 nmdc:mga05p37_36990_c1
334 nmdc:mga05p37_427011_c1
335 nmdc:mga09592_101615_c1
336 nmdc:mga09592_137799_c1
337 nmdc:mga09592_342590_c1
338 nmdc:mga09592_66_c1
339 nmdc:mga0qj67_171705_c1
340 nmdc:mga0qj67_21175_c1
341 nmdc:mga0qj67_214857_c1
342 nmdc:mga0qj67_9017_c1
343 nmdc:mga06r32_21946_c1
344 nmdc:mga06r32_3135_c1
345 nmdc:mga06r32_46521_c1
346 nmdc:mga06r32_570166_c1
347 nmdc:mga06r32_602859_c1
348 nmdc:mga08y16_1496_c1
349 nmdc:mga08y16_39263_c1
350 nmdc:mga0n895_352990_c1
351 nmdc:mga0n895_7592_c1
352 nmdc:mga0rr50_14777_c1
353 nmdc:mga0rr50_173739_c1
354 nmdc:mga0rr50_36096_c1
355 nmdc:mga0a205_75837_c1
356 Ga0495601_0154118
357 Ga0500568_0004956
358 Ga0530510_0116527
359 Ga0530510_0193224
360 Ga0530510_0378671

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

52

297

0.81

PF12146

Hydrolase_4

Serine aminopeptidase, S33

51

297

0.74

PF02129

Peptidase_S15

X-Pro dipeptidyl-peptidase (S15 family)

79

292

0.73

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

54

303

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b6p-assembly2.cif.gz_B x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.9312 29 148
3kxp-assembly1.cif.gz_A crystal structure of e-2-(acetamidomethylene)succinate hydrolase 0.8796 29 302
3kxp-assembly1.cif.gz_A crystal structure of e-2-(acetamidomethylene)succinate hydrolase 0.8702 29 302
3bwx-assembly1.cif.gz_A crystal structure of an alpha/beta hydrolase (yp_496220.1) from novosphingobium aromaticivorans dsm 12444 at 1.50 a resolution 0.8535 25 302
8b6o-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 0.8465 11 148
ID Description Score Start End Superfamily
af_O06575_15_300_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9167 29 302 3.40.50.1820
af_O06338_1_258_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9048 55 304 3.40.50.1820
3kxpG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8849 29 302 3.40.50.1820
af_O06575_15_300_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8767 29 302 3.40.50.1820
3kxpG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8755 29 302 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A5N9DQP5-F1-model_v4 Alpha/beta hydrolase 0.9557 2 303 GO:0016787
AF-A0A354NWJ3-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9545 15 265 GO:0016787
AF-A0A2H5ZLT0-F1-model_v4 Tropinesterase (EC 3.1.1.10) 0.9538 30 303 GO:0050357
AF-A0A2V7DFB5-F1-model_v4 Alpha/beta hydrolase 0.9436 22 119 GO:0016020
GO:0046464
GO:0047372
AF-A0A2H5ZLT0-F1-model_v4 Tropinesterase (EC 3.1.1.10) 0.9436 30 303 GO:0050357

Map