F275390

General Info

Members Datasets Scaffolds Average Seq Length
180 106 169 349

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100398547|Ga0075428_1003985471
Length 383
Sequence MTSAVFAIPGDIDLRTGGYTYDRRVLALLPQFGVGVQHLALPGGYPAPSPEDLAATARVLAQVPKEAVLLIDGLAYGAMPPDIVAAARGPIVALVHHPLCLETGLSPERQTELRASETVALALARHVVVTSATTXAALAAQFGVPADRITVAEPGTDAAPRAKAKTSPTGNRARQGLHLLAVGSIVPRKGYDLLVRALDRLGYLDWELVIAGDRERSPETTASLVYQIERSRVRDRIRLAGPLDERALAALYARTDLFVMSSLYEGYGMVLGEALVRGLPIVATTGGAAAATAPDRAALKVPPGNVDALSRALRRAMTDAALRRKLAGAAWAAGQKLPRWEDTARIVAGAIERAAQGDSPPPCGEGPGAGGTPTSDGLGGTLP

Samples

Sample ID Description Type Environment
1 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
2 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
3 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
4 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
5 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
6 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
7 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
8 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
9 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
53 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
56 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
57 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
58 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
59 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
60 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
61 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
62 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
63 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
64 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
65 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
66 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
67 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
68 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
69 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
70 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
71 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
72 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
73 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
80 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
81 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
82 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
83 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
84 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
85 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
86 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
87 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
88 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
89 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
90 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
92 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
93 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
94 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
95 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
96 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
97 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
98 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
99 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
100 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
101 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
102 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
103 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
104 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
105 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
106 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.89
Metatranscriptomes 0
Isolates 6.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10
Nodule 2.78
Rhizoplane 1.67
Rhizosphere 80.56
Stem 0
Stem Tuber 0
Unclassified 5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070701_10003103 3300005438 Bacteria 6512
2 Ga0070705_100000027 3300005440 Bacteria 77032
3 Ga0070700_100076744 3300005441 Bacteria 2147
4 Ga0070694_100001651 3300005444 Bacteria 13115
5 Ga0070681_10030529 3300005458 Bacteria 5407
6 Ga0070699_100000454 3300005518 Bacteria 39303
7 Ga0070695_100001187 3300005545 Bacteria 14328
8 Ga0070696_100000051 3300005546 Bacteria 54480
9 Ga0070704_100002193 3300005549 Bacteria 10879
10 Ga0070704_100111372 3300005549 Bacteria 2083
11 Ga0070664_100195058 3300005564 Bacteria 1805
12 Ga0068857_100009967 3300005577 Bacteria 8248
13 Ga0070702_100005127 3300005615 Bacteria 6063
14 Ga0068859_100007259 3300005617 Bacteria 11241
15 Ga0068864_100028795 3300005618 Bacteria 4700
16 Ga0068861_100022533 3300005719 Bacteria 4540
17 Ga0068860_100003821 3300005843 Bacteria 15492
18 Ga0068860_100261442 3300005843 Bacteria 1687
19 Ga0068862_100001513 3300005844 Bacteria 21315
20 Ga0081539_10077987 3300005985 Bacteria 1750
21 Ga0075368_10036152 3300006042 Bacteria 1929
22 Ga0075368_10066161 3300006042 Bacteria 1453
23 Ga0075363_100007351 3300006048 Bacteria 5055
24 Ga0075363_100021522 3300006048 Bacteria 3250
25 Ga0075367_10023207 3300006178 Bacteria 3488
26 Ga0075367_10085727 3300006178 Bacteria 1911
27 Ga0075367_10232898 3300006178 Bacteria 1153
28 Ga0075428_100030684 3300006844 Bacteria 5943
29 Ga0075428_100084579 3300006844 Bacteria 3461
30 Ga0075428_100085554 3300006844 Bacteria 3439
31 Ga0075428_100114836 3300006844 Bacteria 2933
32 Ga0075428_100126579 3300006844 Bacteria 2780
33 Ga0075428_100398547 3300006844 Bacteria 1475
34 Ga0075430_100076362 3300006846 Bacteria 2808
35 Ga0075431_100000050 3300006847 Bacteria 63805
36 Ga0075431_100087121 3300006847 Bacteria 3223
37 Ga0075431_100110998 3300006847 Bacteria 2830
38 Ga0075431_100138258 3300006847 Bacteria 2511
39 Ga0075429_100012050 3300006880 Bacteria 7494
40 Ga0097620_100007259 3300006931 Bacteria 11241
41 Ga0105240_10022570 3300009093 Bacteria 8340
42 Ga0111539_10089938 3300009094 Bacteria 3608
43 Ga0114129_10025299 3300009147 Bacteria 8410
44 Ga0114129_10037006 3300009147 Bacteria 6890
45 Ga0114129_10264352 3300009147 Bacteria 2304
46 Ga0114129_10597771 3300009147 Bacteria 1430
47 Ga0105246_10028689 3300011119 Bacteria 3658
48 Ga0207707_10054090 3300025912 Bacteria 3494
49 Ga0207695_10095093 3300025913 Bacteria 2985
50 Ga0207660_10006612 3300025917 Bacteria 7524
51 Ga0207694_10000942 3300025924 Bacteria 25665
52 Ga0207694_10053398 3300025924 Bacteria 3133
53 Ga0207689_10037087 3300025942 Bacteria 4045
54 Ga0207679_10275526 3300025945 Bacteria 1441
55 Ga0207712_10015639 3300025961 Bacteria 4899
56 Ga0207658_10228395 3300025986 Bacteria 1570
57 Ga0207648_10295927 3300026089 Unclassified 1450
58 Ga0207676_10054587 3300026095 Bacteria 3132
59 Ga0207674_10002717 3300026116 Bacteria 22070
60 Ga0207675_100053792 3300026118 Bacteria 3755
61 Ga0207675_100410215 3300026118 Unclassified 1336
62 Ga0209813_10021575 3300027866 Bacteria 1812
63 Ga0268265_10000493 3300028380 Bacteria 41060
64 Ga0268264_10007270 3300028381 Bacteria 9268
65 Ga0268264_10136681 3300028381 Bacteria 2180
66 Ga0265330_10035786 3300031235 Bacteria 2215
67 Ga0265328_10000006 3300031239 Bacteria 227698
68 Ga0265328_10000055 3300031239 Bacteria 72155
69 Ga0265328_10001005 3300031239 Bacteria 12948
70 Ga0265328_10004405 3300031239 Bacteria 6117
71 Ga0265328_10013426 3300031239 Bacteria 3243
72 Ga0265328_10047789 3300031239 Bacteria 1573
73 Ga0265329_10020202 3300031242 Bacteria 2252
74 Ga0265331_10000178 3300031250 Bacteria 77277
75 Ga0265331_10000661 3300031250 Bacteria 29792
76 Ga0265331_10000990 3300031250 Bacteria 22356
77 Ga0265331_10003829 3300031250 Bacteria 9542
78 Ga0265327_10016160 3300031251 Bacteria 4762
79 Ga0265327_10052591 3300031251 Bacteria 2120
80 Ga0265327_10065934 3300031251 Bacteria 1829
81 Ga0265316_10000350 3300031344 Bacteria 51827
82 Ga0265313_10000374 3300031595 Bacteria 48486
83 Ga0307510_10214710 3300033180 Bacteria 1442
84 Ga0395900_0013284 3300037418 Bacteria 8418
85 Ga0395900_0104984 3300037418 Bacteria 2903
86 Ga0395898_0007521 3300037466 Bacteria 11580
87 Ga0395901_0212522 3300038443 Bacteria 2024
88 Ga0400483_154198 3300039062 Bacteria 2250
89 Ga0495632_0083124 3300046519 Unclassified 1525
90 Ga0495625_0151340 3300046660 Bacteria 1559
91 Ga0496106_0002468 3300048909 Bacteria 13788
92 Ga0496113_0283525 3300048916 Bacteria 1325
93 Ga0496115_0146424 3300048918 Bacteria 1949
94 Ga0496121_0000253 3300048924 Bacteria 113655
95 Ga0496121_0053965 3300048924 Bacteria 3363
96 Ga0501034_0058308 3300049571 Bacteria 3880
97 Ga0501036_0225383 3300049572 Bacteria 1573
98 Ga0501036_0274680 3300049572 Unclassified 1411
99 Ga0501038_0077724 3300049574 Bacteria 2801
100 Ga0501040_0006452 3300049576 Bacteria 7618
101 Ga0501040_0150909 3300049576 Bacteria 1639
102 Ga0501046_0213188 3300049580 Bacteria 1432
103 Ga0501048_0092442 3300049582 Bacteria 2133
104 Ga0501048_0103369 3300049582 Bacteria 2010
105 Ga0501048_0174991 3300049582 Bacteria 1521
106 Ga0501067_0049104 3300049583 Bacteria 2339
107 Ga0501071_0016883 3300049587 Bacteria 5022
108 Ga0501071_0100201 3300049587 Bacteria 2135
109 Ga0501072_0008620 3300049588 Bacteria 7740
110 Ga0501072_0080131 3300049588 Bacteria 2586
111 Ga0501072_0197077 3300049588 Bacteria 1606
112 Ga0501074_0022007 3300049590 Bacteria 4631
113 Ga0501074_0051412 3300049590 Bacteria 2974
114 Ga0501075_0003556 3300049591 Bacteria 10433
115 Ga0501075_0021391 3300049591 Bacteria 4715
116 Ga0501075_0099347 3300049591 Bacteria 2210
117 Ga0501076_0000337 3300049592 Bacteria 28949
118 Ga0501076_0009511 3300049592 Bacteria 7179
119 Ga0501076_0093591 3300049592 Unclassified 2419
120 Ga0501077_0004496 3300049593 Bacteria 8471
121 Ga0501077_0012684 3300049593 Bacteria 5278
122 Ga0501077_0082076 3300049593 Bacteria 2043
123 Ga0501077_0141630 3300049593 Bacteria 1525
124 Ga0501079_0008964 3300049741 Bacteria 7575
125 Ga0501079_0024077 3300049741 Bacteria 4671
126 Ga0501079_0051269 3300049741 Bacteria 3186
127 Ga0501079_0124214 3300049741 Bacteria 2008
128 Ga0501080_0007284 3300049742 Bacteria 9981
129 Ga0501080_0019468 3300049742 Bacteria 6286
130 Ga0501081_0006905 3300049743 Bacteria 7377
131 Ga0501081_0015528 3300049743 Bacteria 5026
132 Ga0501081_0020638 3300049743 Bacteria 4392
133 Ga0501081_0035697 3300049743 Bacteria 3385
134 Ga0501083_0037501 3300049744 Bacteria 3301
135 Ga0501044_0083425 3300049823 Bacteria 3232
136 Ga0501045_0003147 3300049824 Bacteria 11286
137 Ga0501045_0032465 3300049824 Bacteria 3783
138 Ga0501045_0057504 3300049824 Bacteria 2846
139 nmdc:mga03n38_793_c1 3300050490 Bacteria 8393
140 nmdc:mga00v17_115176_c1 3300050491 Bacteria 1708
141 nmdc:mga0yw44_43336_c1 3300050492 Bacteria 2686
142 nmdc:mga06z11_11655_c1 3300050494 Bacteria 3799
143 nmdc:mga06z11_3967_c1 3300050494 Bacteria 5771
144 nmdc:mga06z11_4120_c1 3300050494 Bacteria 5681
145 nmdc:mga06z11_5829_c1 3300050494 Bacteria 4465
146 nmdc:mga04h51_25831_c1 3300050495 Bacteria 1812
147 nmdc:mga04h51_3528_c1 3300050495 Bacteria 3805
148 nmdc:mga05p37_175305_c1 3300050507 Bacteria 2612
149 nmdc:mga05p37_288187_c1 3300050507 Bacteria 1955
150 nmdc:mga05p37_402811_c1 3300050507 Bacteria 1597
151 nmdc:mga05p37_406416_c1 3300050507 Bacteria 1588
152 nmdc:mga09592_15701_c1 3300050508 Bacteria 6187
153 nmdc:mga06r32_100105_c1 3300050510 Bacteria 2843
154 nmdc:mga06r32_139821_c1 3300050510 Bacteria 2397
155 nmdc:mga06r32_1897_c1 3300050510 Bacteria 18623
156 nmdc:mga06r32_404616_c1 3300050510 Bacteria 1347
157 nmdc:mga06r32_69432_c1 3300050510 Bacteria 3405
158 nmdc:mga06r32_91583_c1 3300050510 Bacteria 2972
159 nmdc:mga08y16_169891_c1 3300050511 Bacteria 2265
160 Ga0500618_000048 3300053125 Bacteria 106392
161 Ga0501084_0000417 3300054114 Bacteria 32966
162 Ga0501084_0000907 3300054114 Bacteria 22887
163 Ga0501084_0136315 3300054114 Bacteria 2066
164 Ga0501082_0041798 3300060353 Bacteria 3953
165 Ga0501082_0052111 3300060353 Bacteria 3527
166 Ga0501082_0286674 3300060353 Bacteria 1433
167 Ga0530510_0001617 3300061734 Bacteria 15209
168 Ga0530510_0034781 3300061734 Bacteria 3630
169 Ga0530510_0171850 3300061734 Bacteria 1605

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049744 Ga0501083_0037501 Ga0501083_0037501_2439_3278 268
2 3300048924 Ga0496121_0000253 Ga0496121_0000253_61868_62926 299
3 3300050510 nmdc:mga06r32_404616_c1 nmdc:mga06r32_404616_c1_29_970 301
4 3300005441 Ga0070700_100076744 Ga0070700_1000767443 305
5 3300037418 Ga0395900_0013284 Ga0395900_0013284_6359_7405 307
6 3300037466 Ga0395898_0007521 Ga0395898_0007521_7569_8615 307
7 3300049588 Ga0501072_0197077 Ga0501072_0197077_119_1195 311
8 3300049592 Ga0501076_0093591 Ga0501076_0093591_1255_2331 311
9 3300061734 Ga0530510_0171850 Ga0530510_0171850_139_1170 313
10 3300005549 Ga0070704_100111372 Ga0070704_1001113723 314
11 3300005843 Ga0068860_100261442 Ga0068860_1002614421 314
12 3300006844 Ga0075428_100114836 Ga0075428_1001148361 314
13 3300026089 Ga0207648_10295927 Ga0207648_102959272 314
14 3300028381 Ga0268264_10136681 Ga0268264_101366812 314
15 3300006042 Ga0075368_10066161 Ga0075368_100661612 320
16 3300050492 nmdc:mga0yw44_43336_c1 nmdc:mga0yw44_43336_c1_903_1952 320
17 3300050494 nmdc:mga06z11_11655_c1 nmdc:mga06z11_11655_c1_1105_2151 320
18 3300050495 nmdc:mga04h51_3528_c1 nmdc:mga04h51_3528_c1_2655_3701 320
19 3300025924 Ga0207694_10000942 Ga0207694_1000094220 321
20 3300031239 Ga0265328_10047789 Ga0265328_100477892 323
21 3300048916 Ga0496113_0283525 Ga0496113_0283525_268_1275 323
22 3300031239 Ga0265328_10001005 Ga0265328_100010057 325
23 3300006844 Ga0075428_100030684 Ga0075428_1000306845 326
24 3300006846 Ga0075430_100076362 Ga0075430_1000763622 326
25 3300009094 Ga0111539_10089938 Ga0111539_100899384 326
26 3300009147 Ga0114129_10025299 Ga0114129_100252997 326
27 3300026118 Ga0207675_100410215 Ga0207675_1004102152 326
28 3300050507 nmdc:mga05p37_288187_c1 nmdc:mga05p37_288187_c1_761_1813 326
29 3300050510 nmdc:mga06r32_100105_c1 nmdc:mga06r32_100105_c1_396_1448 326
30 3300005985 Ga0081539_10077987 Ga0081539_100779871 327
31 3300031235 Ga0265330_10035786 Ga0265330_100357862 328
32 3300031239 Ga0265328_10000006 Ga0265328_1000000688 328
33 3300031242 Ga0265329_10020202 Ga0265329_100202022 328
34 3300031250 Ga0265331_10000990 Ga0265331_1000099019 328
35 3300031251 Ga0265327_10065934 Ga0265327_100659343 328
36 3300031344 Ga0265316_10000350 Ga0265316_1000035025 328
37 3300049823 Ga0501044_0083425 Ga0501044_0083425_481_1554 328
38 3300006847 Ga0075431_100087121 Ga0075431_1000871214 331
39 3300050510 nmdc:mga06r32_69432_c1 nmdc:mga06r32_69432_c1_1607_2692 331
40 iso_pu_bacteria 2894232714 2894242487 331
41 3300006048 Ga0075363_100021522 Ga0075363_1000215225 332
42 3300006178 Ga0075367_10023207 Ga0075367_100232072 332
43 3300025986 Ga0207658_10228395 Ga0207658_102283951 332
44 3300031250 Ga0265331_10000178 Ga0265331_1000017851 332
45 3300039062 Ga0400483_154198 Ga0400483_154198_99_1133 332
46 3300050491 nmdc:mga00v17_115176_c1 nmdc:mga00v17_115176_c1_579_1625 332
47 3300050494 nmdc:mga06z11_4120_c1 nmdc:mga06z11_4120_c1_499_1545 332
48 iso_pu_bacteria 3003665799 3003669492 332
49 iso_pu_bacteria 643348564 643602306 333
50 3300009093 Ga0105240_10022570 Ga0105240_100225703 334
51 3300025913 Ga0207695_10095093 Ga0207695_100950933 334
52 3300025924 Ga0207694_10053398 Ga0207694_100533983 334
53 3300038443 Ga0395901_0212522 Ga0395901_0212522_827_1888 334
54 3300046519 Ga0495632_0083124 Ga0495632_0083124_347_1408 334
55 3300046660 Ga0495625_0151340 Ga0495625_0151340_164_1237 334
56 3300048924 Ga0496121_0053965 Ga0496121_0053965_1282_2355 334
57 3300053125 Ga0500618_000048 Ga0500618_000048_36271_37344 334
58 iso_pu_bacteria 2821123053 2821126653 334
59 iso_pu_bacteria 2838736955 2838740260 334
60 iso_pu_bacteria 2841840854 2841843615 334
61 iso_pu_bacteria 2842140634 2842143335 334
62 iso_pu_bacteria 2857531043 2857536745 334
63 3300031239 Ga0265328_10004405 Ga0265328_100044058 336
64 iso_pu_bacteria 2891088606 2891090480 336
65 iso_pu_bacteria 8002060224 8002062663 336
66 3300006042 Ga0075368_10036152 Ga0075368_100361522 337
67 3300006048 Ga0075363_100007351 Ga0075363_1000073515 337
68 3300006178 Ga0075367_10085727 Ga0075367_100857272 337
69 3300006178 Ga0075367_10232898 Ga0075367_102328981 337
70 3300006844 Ga0075428_100084579 Ga0075428_1000845793 337
71 3300006844 Ga0075428_100126579 Ga0075428_1001265793 337
72 3300009147 Ga0114129_10597771 Ga0114129_105977712 337
73 3300027866 Ga0209813_10021575 Ga0209813_100215751 337
74 3300033180 Ga0307510_10214710 Ga0307510_102147101 337
75 3300037418 Ga0395900_0104984 Ga0395900_0104984_1376_2422 337
76 3300049571 Ga0501034_0058308 Ga0501034_0058308_2462_3508 337
77 3300049572 Ga0501036_0225383 Ga0501036_0225383_268_1359 337
78 3300049576 Ga0501040_0150909 Ga0501040_0150909_194_1264 337
79 3300049582 Ga0501048_0103369 Ga0501048_0103369_65_1156 337
80 3300049582 Ga0501048_0174991 Ga0501048_0174991_336_1382 337
81 3300049583 Ga0501067_0049104 Ga0501067_0049104_1234_2280 337
82 3300049587 Ga0501071_0100201 Ga0501071_0100201_866_1957 337
83 3300049588 Ga0501072_0080131 Ga0501072_0080131_957_2003 337
84 3300049590 Ga0501074_0022007 Ga0501074_0022007_485_1531 337
85 3300049591 Ga0501075_0021391 Ga0501075_0021391_3166_4212 337
86 3300049592 Ga0501076_0009511 Ga0501076_0009511_4410_5456 337
87 3300049593 Ga0501077_0012684 Ga0501077_0012684_4153_5199 337
88 3300049593 Ga0501077_0082076 Ga0501077_0082076_107_1177 337
89 3300049741 Ga0501079_0008964 Ga0501079_0008964_4620_5666 337
90 3300049741 Ga0501079_0124214 Ga0501079_0124214_414_1484 337
91 3300049742 Ga0501080_0007284 Ga0501080_0007284_4394_5440 337
92 3300049743 Ga0501081_0006905 Ga0501081_0006905_1104_2150 337
93 3300049824 Ga0501045_0057504 Ga0501045_0057504_677_1723 337
94 3300050490 nmdc:mga03n38_793_c1 nmdc:mga03n38_793_c1_7262_8314 337
95 3300050494 nmdc:mga06z11_3967_c1 nmdc:mga06z11_3967_c1_71_1123 337
96 3300050494 nmdc:mga06z11_5829_c1 nmdc:mga06z11_5829_c1_10_1128 337
97 3300050495 nmdc:mga04h51_25831_c1 nmdc:mga04h51_25831_c1_18_1070 337
98 3300050507 nmdc:mga05p37_175305_c1 nmdc:mga05p37_175305_c1_997_2043 337
99 3300050507 nmdc:mga05p37_406416_c1 nmdc:mga05p37_406416_c1_91_1137 337
100 3300050510 nmdc:mga06r32_91583_c1 nmdc:mga06r32_91583_c1_694_1740 337
101 3300054114 Ga0501084_0000417 Ga0501084_0000417_20315_21361 337
102 3300060353 Ga0501082_0286674 Ga0501082_0286674_45_1091 337
103 3300061734 Ga0530510_0034781 Ga0530510_0034781_1596_2666 337
104 3300049593 Ga0501077_0004496 Ga0501077_0004496_927_2003 338
105 3300049741 Ga0501079_0051269 Ga0501079_0051269_300_1376 338
106 3300049743 Ga0501081_0020638 Ga0501081_0020638_335_1411 338
107 3300049824 Ga0501045_0032465 Ga0501045_0032465_1161_2237 338
108 3300054114 Ga0501084_0136315 Ga0501084_0136315_181_1257 338
109 3300060353 Ga0501082_0041798 Ga0501082_0041798_1439_2515 338
110 3300031239 Ga0265328_10000055 Ga0265328_1000005525 340
111 3300031239 Ga0265328_10013426 Ga0265328_100134262 340
112 3300031250 Ga0265331_10003829 Ga0265331_100038296 340
113 3300031251 Ga0265327_10016160 Ga0265327_100161601 340
114 3300031251 Ga0265327_10052591 Ga0265327_100525913 340
115 3300006847 Ga0075431_100110998 Ga0075431_1001109982 341
116 3300009147 Ga0114129_10037006 Ga0114129_100370062 341
117 3300050511 nmdc:mga08y16_169891_c1 nmdc:mga08y16_169891_c1_395_1456 341
118 3300006844 Ga0075428_100398547 Ga0075428_1003985471 342
119 3300006847 Ga0075431_100000050 Ga0075431_10000005042 342
120 3300006880 Ga0075429_100012050 Ga0075429_1000120506 342
121 3300031250 Ga0265331_10000661 Ga0265331_100006616 342
122 3300031595 Ga0265313_10000374 Ga0265313_1000037420 342
123 3300050508 nmdc:mga09592_15701_c1 nmdc:mga09592_15701_c1_2626_3777 342
124 3300050510 nmdc:mga06r32_1897_c1 nmdc:mga06r32_1897_c1_8679_9830 342
125 3300049574 Ga0501038_0077724 Ga0501038_0077724_403_1473 343
126 3300049576 Ga0501040_0006452 Ga0501040_0006452_1738_2808 343
127 3300049582 Ga0501048_0092442 Ga0501048_0092442_132_1202 343
128 3300049587 Ga0501071_0016883 Ga0501071_0016883_2280_3350 343
129 3300049588 Ga0501072_0008620 Ga0501072_0008620_4883_5953 343
130 3300049590 Ga0501074_0051412 Ga0501074_0051412_1754_2824 343
131 3300049591 Ga0501075_0003556 Ga0501075_0003556_6830_7900 343
132 3300049592 Ga0501076_0000337 Ga0501076_0000337_13529_14599 343
133 3300049593 Ga0501077_0141630 Ga0501077_0141630_99_1169 343
134 3300049741 Ga0501079_0024077 Ga0501079_0024077_2925_3995 343
135 3300049742 Ga0501080_0019468 Ga0501080_0019468_5190_6260 343
136 3300049743 Ga0501081_0015528 Ga0501081_0015528_969_2039 343
137 3300049824 Ga0501045_0003147 Ga0501045_0003147_3113_4183 343
138 3300054114 Ga0501084_0000907 Ga0501084_0000907_8274_9344 343
139 3300061734 Ga0530510_0001617 Ga0530510_0001617_3646_4716 343
140 iso_pu_bacteria 2837678835 2837681600 343
141 3300006844 Ga0075428_100085554 Ga0075428_1000855543 348
142 3300006847 Ga0075431_100138258 Ga0075431_1001382583 348
143 3300009147 Ga0114129_10264352 Ga0114129_102643523 348
144 3300050507 nmdc:mga05p37_402811_c1 nmdc:mga05p37_402811_c1_200_1348 348
145 3300050510 nmdc:mga06r32_139821_c1 nmdc:mga06r32_139821_c1_740_1888 348
146 3300005438 Ga0070701_10003103 Ga0070701_100031034 350
147 3300005440 Ga0070705_100000027 Ga0070705_10000002753 350
148 3300005444 Ga0070694_100001651 Ga0070694_10000165110 350
149 3300005458 Ga0070681_10030529 Ga0070681_100305294 350
150 3300005518 Ga0070699_100000454 Ga0070699_10000045429 350
151 3300005545 Ga0070695_100001187 Ga0070695_1000011878 350
152 3300005546 Ga0070696_100000051 Ga0070696_10000005129 350
153 3300005549 Ga0070704_100002193 Ga0070704_1000021932 350
154 3300005564 Ga0070664_100195058 Ga0070664_1001950582 350
155 3300005577 Ga0068857_100009967 Ga0068857_1000099674 350
156 3300005615 Ga0070702_100005127 Ga0070702_1000051272 350
157 3300005617 Ga0068859_100007259 Ga0068859_1000072596 350
158 3300005618 Ga0068864_100028795 Ga0068864_1000287952 350
159 3300005719 Ga0068861_100022533 Ga0068861_1000225333 350
160 3300005843 Ga0068860_100003821 Ga0068860_1000038219 350
161 3300005844 Ga0068862_100001513 Ga0068862_10000151321 350
162 3300006931 Ga0097620_100007259 Ga0097620_1000072599 350
163 3300011119 Ga0105246_10028689 Ga0105246_100286892 350
164 3300025912 Ga0207707_10054090 Ga0207707_100540902 350
165 3300025917 Ga0207660_10006612 Ga0207660_100066122 350
166 3300025942 Ga0207689_10037087 Ga0207689_100370875 350
167 3300025945 Ga0207679_10275526 Ga0207679_102755262 350
168 3300025961 Ga0207712_10015639 Ga0207712_100156392 350
169 3300026095 Ga0207676_10054587 Ga0207676_100545872 350
170 3300026116 Ga0207674_10002717 Ga0207674_1000271716 350
171 3300026118 Ga0207675_100053792 Ga0207675_1000537923 350
172 3300028380 Ga0268265_10000493 Ga0268265_1000049333 350
173 3300028381 Ga0268264_10007270 Ga0268264_100072706 350
174 3300048909 Ga0496106_0002468 Ga0496106_0002468_11643_12728 350
175 3300048918 Ga0496115_0146424 Ga0496115_0146424_844_1929 350
176 3300049572 Ga0501036_0274680 Ga0501036_0274680_130_1257 350
177 3300049580 Ga0501046_0213188 Ga0501046_0213188_161_1288 350
178 3300049591 Ga0501075_0099347 Ga0501075_0099347_226_1353 350
179 3300049743 Ga0501081_0035697 Ga0501081_0035697_1817_2944 350
180 3300060353 Ga0501082_0052111 Ga0501082_0052111_1521_2648 350

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00534

Glycos_transf_1

Glycosyl transferases group 1

165

331

0.93

PF13692

Glyco_trans_1_4

Glycosyl transferases group 1

176

319

0.88

PF13439

Glyco_transf_4

Glycosyltransferase Family 4

20

159

0.76

PF20706

GT4-conflict

Family 4 Glycosyltransferase in conflict systems

98

347

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i45-assembly1.cif.gz_A 1.35 angstrom crystal structure of c-terminal domain of glycosyl transferase group 1 family protein (lpcc) from francisella tularensis. 0.8369 155 319
6kih-assembly2.cif.gz_B sucrose-phosphate synthase (tll1590) from thermosynechococcus elongatus 0.8072 1 328
3c4q-assembly1.cif.gz_A structure of the retaining glycosyltransferase msha : the first step in mycothiol biosynthesis. organism : corynebacterium glutamicum- complex with udp 0.798 2 332
2bfw-assembly1.cif.gz_A structure of the c domain of glycogen synthase from pyrococcus abyssi 0.795 171 319
3c4q-assembly2.cif.gz_B structure of the retaining glycosyltransferase msha : the first step in mycothiol biosynthesis. organism : corynebacterium glutamicum- complex with udp 0.7886 2 332
ID Description Score Start End Superfamily
af_Q59002_191_368_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8903 169 320 3.40.50.2000
af_P9WMY7_260_428_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8785 173 321 3.40.50.2000
af_Q19265_201_383_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8709 168 319 3.40.50.2000
af_Q6ZHZ1_485_666_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.865 170 316 3.40.50.2000
af_Q7KWM5_214_420_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8619 173 319 3.40.50.2000
ID Description Score Start End GO Terms
AF-D3SFQ4-F1-model_v4 Glycosyl transferase group 1 0.9486 1 336 GO:0009103
GO:0016757
GO:0045226
AF-A0A7V2RTH2-F1-model_v4 Glycosyltransferase 0.9448 1 332 GO:0009103
GO:0016757
GO:0045226
AF-A0A3S5JEJ9-F1-model_v4 Glycosyltransferase family 1 protein 0.9442 1 341 GO:0009103
GO:0016757
GO:0045226
AF-A0A1W9KDA5-F1-model_v4 deleted 0.9438 1 340
AF-A0A537N1H0-F1-model_v4 Glycosyltransferase family 4 protein 0.9428 1 338 GO:0009103
GO:0016757
GO:0045226

Feature Viewer

pLDDT pTM Quality
88.73 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map