F274683

General Info

Members Datasets Scaffolds Average Seq Length
179 121 358 190

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2818991441|2819569824
Length 226
Sequence ARDEKVKYFTLLRLMITFKALDFLVTLSLLKGNDSMARNKEFDENEVLRKAMELFWIQGYEKTSMQDLVKYMGIHRRSLYDTFGDKHTLFIKALDHYNEIITTRIKNEVSQQHLVKEAIRQLFNMIIVRDKEHLIGCLTVNTAVELSLHDEQAAEKVTESFSMTELLLNNLVQKGQTAGEIPKHLDAKKTSEFLHNALVGLRVMTKTTDDTEKLNNIIDMTLSVLD

Samples

Sample ID Description Type Environment
1 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
4 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
5 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
6 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
7 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
8 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
9 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
10 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
11 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
12 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
13 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
14 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
15 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
16 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
17 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
18 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
19 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
20 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
21 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
22 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
23 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
24 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
25 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
26 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
27 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
28 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
29 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
30 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
31 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
32 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
33 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
34 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
35 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
36 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
37 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
38 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
39 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
40 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
41 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
42 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
43 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
44 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
45 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
46 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
47 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
48 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
49 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
50 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
51 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
52 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
53 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
54 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
55 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
56 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
57 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
58 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
59 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
60 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
61 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
62 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
63 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
64 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
65 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
66 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
67 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
68 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
69 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
70 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
71 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
73 2818991441 Niallia circulans 3243 Isolate Rhizosphere
74 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
75 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
76 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
77 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
78 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
79 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
80 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
81 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
82 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
83 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
84 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
85 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
86 2738543010 Bacillus sp. YR335 Isolate Unclassified
87 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
88 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
89 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
90 2818991459 Paenibacillus sp. 597 Isolate Unclassified
91 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
92 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
93 2857472729 Cohnella sp. R-74144 Isolate Unclassified
94 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
95 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
96 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
97 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
98 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
99 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
100 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
101 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
102 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
103 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
104 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
105 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
106 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
107 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
108 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
109 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
110 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
111 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
112 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
113 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
114 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
115 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
116 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
117 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified
118 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
119 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
120 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
121 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 69.27
Metatranscriptomes 1.12
Isolates 29.61

Biome Distribution

Category Percentage (%)
Aerial Root 1.12
Bulb 0
Endosphere 5.03
Nodule 6.7
Rhizoplane 5.03
Rhizosphere 53.07
Stem 0
Stem Tuber 0
Unclassified 1.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10004812 3300003187 Bacteria 7065
2 Ga0006562J51391_1020920 3300003578 Bacteria 800
3 Ga0079104_1000281 3300006946 Bacteria 65423
4 Ga0079104_1001249 3300006946 Bacteria 17756
5 Ga0079104_1002001 3300006946 Bacteria 11912
6 Ga0079104_1004065 3300006946 Bacteria 6443
7 Ga0079104_1009030 3300006946 Bacteria 3418
8 Ga0079104_1017112 3300006946 Bacteria 2094
9 Ga0105244_10081294 3300009036 Bacteria 1604
10 Ga0209566_100024 3300025225 Bacteria 396318
11 Ga0209566_100210 3300025225 Bacteria 59477
12 Ga0209437_100733 3300025233 Bacteria 16521
13 Ga0209676_1000178 3300025292 Bacteria 150383
14 Ga0209025_1000156 3300025294 Bacteria 168932
15 Ga0209025_1030375 3300025294 Bacteria 2588
16 Ga0207655_1111217 3300025728 Bacteria 925
17 Ga0209281_1000177 3300027111 Bacteria 149738
18 Ga0209281_1000389 3300027111 Bacteria 69350
19 Ga0209281_1000980 3300027111 Bacteria 22786
20 Ga0209281_1003796 3300027111 Bacteria 4788
21 Ga0209281_1016479 3300027111 Bacteria 1518
22 Ga0209813_10225928 3300027866 Bacteria 702
23 Ga0307408_100197119 3300031548 Bacteria 1627
24 Ga0307416_101836020 3300032002 Bacteria 710
25 Ga0395898_0067912 3300037466 Bacteria 3451
26 Ga0395901_0040316 3300038443 Bacteria 4836
27 Ga0439436_0007281 3300041404 Bacteria 3404
28 Ga0439439_0001122 3300041406 Bacteria 5131
29 Ga0439439_0014207 3300041406 Bacteria 1937
30 Ga0439433_0097304 3300041999 Bacteria 728
31 Ga0439449_0000179 3300042007 Bacteria 21988
32 Ga0439449_0001817 3300042007 Bacteria 8395
33 Ga0439449_0007214 3300042007 Bacteria 4229
34 Ga0439457_075406 3300042014 Bacteria 772
35 Ga0439462_0000172 3300042015 Bacteria 10878
36 Ga0439462_0014119 3300042015 Bacteria 2050
37 Ga0439462_0036897 3300042015 Bacteria 1301
38 Ga0495617_000086 3300046452 Bacteria 67731
39 Ga0495617_013853 3300046452 Bacteria 2742
40 Ga0495627_052614 3300046453 Bacteria 1221
41 Ga0495638_0010247 3300046460 Bacteria 6522
42 Ga0495605_0013141 3300046474 Bacteria 4574
43 Ga0495584_0001042 3300046491 Bacteria 17317
44 Ga0495585_0010403 3300046492 Bacteria 5539
45 Ga0495585_0010552 3300046492 Bacteria 5495
46 Ga0495585_0010973 3300046492 Bacteria 5381
47 Ga0495607_0002068 3300046501 Bacteria 16753
48 Ga0495607_0022614 3300046501 Bacteria 3945
49 Ga0495607_0120217 3300046501 Bacteria 1380
50 Ga0495583_0000437 3300046506 Bacteria 62701
51 Ga0495616_0001327 3300046513 Bacteria 17284
52 Ga0495616_0012345 3300046513 Bacteria 4852
53 Ga0495620_0026121 3300046515 Bacteria 2750
54 Ga0495644_0000291 3300046523 Bacteria 23231
55 Ga0495648_0000413 3300046524 Bacteria 47117
56 Ga0495654_0005472 3300046530 Bacteria 7369
57 Ga0495654_0060194 3300046530 Bacteria 1826
58 Ga0495609_0000262 3300046538 Bacteria 49441
59 Ga0495609_0002898 3300046538 Bacteria 10230
60 Ga0495622_0084309 3300046557 Bacteria 1462
61 Ga0495633_0000649 3300046558 Bacteria 32293
62 Ga0495656_0013088 3300046615 Bacteria 3077
63 Ga0495656_0114597 3300046615 Unclassified 1265
64 Ga0495656_0196028 3300046615 Bacteria 1000
65 Ga0495611_0001675 3300046648 Bacteria 10737
66 Ga0495611_0003498 3300046648 Bacteria 6913
67 Ga0495625_0013500 3300046660 Bacteria 6561
68 Ga0495625_0141498 3300046660 Bacteria 1622
69 Ga0495659_0000483 3300046664 Bacteria 14770
70 Ga0495661_0018325 3300046665 Bacteria 4607
71 Ga0495670_0005086 3300046691 Bacteria 6468
72 Ga0495671_0004123 3300046692 Bacteria 8761
73 Ga0495649_0076390 3300046694 Bacteria 1793
74 Ga0495660_0008897 3300046810 Bacteria 5868
75 Ga0495660_0032047 3300046810 Bacteria 2953
76 Ga0495660_0093820 3300046810 Bacteria 1555
77 Ga0495636_0007237 3300047318 Bacteria 4369
78 Ga0495672_0000674 3300047320 Bacteria 37974
79 Ga0495672_0026790 3300047320 Bacteria 3672
80 Ga0495683_0020556 3300047323 Bacteria 3404
81 Ga0495687_000331 3300047443 Bacteria 60618
82 Ga0495677_0016139 3300047445 Bacteria 2709
83 Ga0495685_000016 3300047447 Bacteria 76154
84 Ga0495673_0004669 3300047469 Bacteria 8509
85 Ga0496100_0322833 3300048903 Bacteria 1160
86 Ga0496101_0394753 3300048904 Bacteria 1089
87 Ga0496102_0453848 3300048905 Bacteria 1202
88 Ga0496102_0476384 3300048905 Unclassified 1169
89 Ga0496103_0254147 3300048906 Bacteria 1131
90 Ga0496103_0364697 3300048906 Bacteria 929
91 Ga0496106_0484340 3300048909 Bacteria 994
92 Ga0496116_0000070 3300048919 Bacteria 246059
93 Ga0496116_0002663 3300048919 Bacteria 18479
94 Ga0496116_0079720 3300048919 Bacteria 2036
95 Ga0496116_0094353 3300048919 Bacteria 1809
96 Ga0496117_0000624 3300048920 Bacteria 57349
97 Ga0496118_0007816 3300048921 Bacteria 11218
98 Ga0496119_0000034 3300048922 Bacteria 218417
99 Ga0496119_0005912 3300048922 Bacteria 11536
100 Ga0496119_0022706 3300048922 Bacteria 4480
101 Ga0496120_0000026 3300048923 Bacteria 235131
102 Ga0496120_0000031 3300048923 Bacteria 222276
103 Ga0496120_0004317 3300048923 Bacteria 12028
104 Ga0496120_0006136 3300048923 Bacteria 9320
105 Ga0496122_0000008 3300048925 Bacteria 596403
106 Ga0496122_0000052 3300048925 Bacteria 260977
107 Ga0496122_0002143 3300048925 Bacteria 29002
108 Ga0496122_0013213 3300048925 Bacteria 8104
109 Ga0496122_0064378 3300048925 Bacteria 2668
110 Ga0496123_0001672 3300048926 Bacteria 29677
111 Ga0496123_0017314 3300048926 Bacteria 5804
112 Ga0496124_0116585 3300048927 Bacteria 2141
113 Ga0496125_0001793 3300048928 Bacteria 29677
114 Ga0496125_0012199 3300048928 Bacteria 8552
115 Ga0496125_0039780 3300048928 Bacteria 4043
116 Ga0496125_0185133 3300048928 Bacteria 1382
117 Ga0496126_0000021 3300048929 Bacteria 472971
118 Ga0496126_0000313 3300048929 Bacteria 103014
119 Ga0496126_0000478 3300048929 Bacteria 79441
120 Ga0496126_0001951 3300048929 Bacteria 29288
121 Ga0496126_0005727 3300048929 Bacteria 14068
122 Ga0495678_003545 3300049459 Bacteria 9572
123 Ga0495682_0000080 3300049460 Bacteria 84736
124 Ga0495682_0001609 3300049460 Bacteria 11649
125 Ga0501334_02836 3300049550 Bacteria 1048
126 nmdc:mga04h51_257546_c1 3300050495 Bacteria 701
127 2819569824 2818991441 Bacteria 5062707
128 2512731199 2512564039 Bacteria 8739048
129 2524189315 2524023129 Bacteria 6762600
130 2550900472 2548877040 Bacteria 7507281
131 2571527810 2571042143 Bacteria 6986194
132 2573041336 2571042588 Bacteria 5045676
133 2578336362 2576861424 Bacteria 5270569
134 2580931424 2579778775 Bacteria 5360914
135 2601638997 2600255286 Bacteria 5390125
136 2621274545 2619619294 Bacteria 5575484
137 2643740832 2643221543 Bacteria 6628015
138 2672335686 2671180330 Bacteria 5521719
139 2728534558 2728368933 Bacteria 7044283
140 2739233789 2738543010 Bacteria 5583595
141 2753808352 2751185905 Bacteria 6142767
142 2757566139 2757320391 Bacteria 4746095
143 2808867392 2808606364 Bacteria 4465927
144 2819673632 2818991459 Bacteria 8736032
145 2821115959 2821111986 Bacteria 6894338
146 2857467451 2857465823 Bacteria 6772595
147 2857475663 2857472729 Bacteria 6568124
148 2857596091 2857591370 Bacteria 6569758
149 2881638618 2881636855 Bacteria 5205297
150 2881639177 2881636855 Bacteria 5205297
151 2889047710 2889042446 Bacteria 7618936
152 2889052748 2889049205 Bacteria 7524325
153 2904115602 2904113452 Bacteria 7796941
154 2904495445 2904490793 Bacteria 7046938
155 2904758931 2904755435 Bacteria 7986759
156 2919164619 2919160200 Bacteria 6929020
157 2931384760 2931384279 Bacteria 7299545
158 2936341792 2936340661 Bacteria 5139038
159 2936342660 2936340661 Bacteria 5139038
160 2936367712 2936361878 Bacteria 5632809
161 2938653335 2938649242 Bacteria 7118381
162 2945996584 2945991243 Bacteria 7008369
163 2946059261 2946053406 Bacteria 6978655
164 2968562814 2968558590 Bacteria 6956864
165 2971408084 2971403814 Bacteria 7370929
166 2971514532 2971511577 Bacteria 5404012
167 2980178696 2980176882 Bacteria 5397533
168 2984529501 2984527788 Bacteria 5288478
169 2984535606 2984532647 Bacteria 5288506
170 2988226799 2988225383 Bacteria 7221625
171 2988228404 2988225383 Bacteria 7221625
172 2988228560 2988225383 Bacteria 7221625
173 2996635682 2996632988 Bacteria 6921523
174 8002318807 8002317523 Bacteria 8051857
175 8007376107 8007375930 Bacteria 4080554
176 8046996581 8046991243 Bacteria 8497463
177 8054469857 8054465665 Bacteria 7323556
178 8054800988 8054795415 Bacteria 9785225
179 8057473270 8057473075 Bacteria 5892720
180 JGI25151J46595_10004812
181 Ga0006562J51391_1020920
182 Ga0079104_1000281
183 Ga0079104_1001249
184 Ga0079104_1002001
185 Ga0079104_1004065
186 Ga0079104_1009030
187 Ga0079104_1017112
188 Ga0105244_10081294
189 Ga0209566_100024
190 Ga0209566_100210
191 Ga0209437_100733
192 Ga0209676_1000178
193 Ga0209025_1000156
194 Ga0209025_1030375
195 Ga0207655_1111217
196 Ga0209281_1000177
197 Ga0209281_1000389
198 Ga0209281_1000980
199 Ga0209281_1003796
200 Ga0209281_1016479
201 Ga0209813_10225928
202 Ga0307408_100197119
203 Ga0307416_101836020
204 Ga0395898_0067912
205 Ga0395901_0040316
206 Ga0439436_0007281
207 Ga0439439_0001122
208 Ga0439439_0014207
209 Ga0439433_0097304
210 Ga0439449_0000179
211 Ga0439449_0001817
212 Ga0439449_0007214
213 Ga0439457_075406
214 Ga0439462_0000172
215 Ga0439462_0014119
216 Ga0439462_0036897
217 Ga0495617_000086
218 Ga0495617_013853
219 Ga0495627_052614
220 Ga0495638_0010247
221 Ga0495605_0013141
222 Ga0495584_0001042
223 Ga0495585_0010403
224 Ga0495585_0010552
225 Ga0495585_0010973
226 Ga0495607_0002068
227 Ga0495607_0022614
228 Ga0495607_0120217
229 Ga0495583_0000437
230 Ga0495616_0001327
231 Ga0495616_0012345
232 Ga0495620_0026121
233 Ga0495644_0000291
234 Ga0495648_0000413
235 Ga0495654_0005472
236 Ga0495654_0060194
237 Ga0495609_0000262
238 Ga0495609_0002898
239 Ga0495622_0084309
240 Ga0495633_0000649
241 Ga0495656_0013088
242 Ga0495656_0114597
243 Ga0495656_0196028
244 Ga0495611_0001675
245 Ga0495611_0003498
246 Ga0495625_0013500
247 Ga0495625_0141498
248 Ga0495659_0000483
249 Ga0495661_0018325
250 Ga0495670_0005086
251 Ga0495671_0004123
252 Ga0495649_0076390
253 Ga0495660_0008897
254 Ga0495660_0032047
255 Ga0495660_0093820
256 Ga0495636_0007237
257 Ga0495672_0000674
258 Ga0495672_0026790
259 Ga0495683_0020556
260 Ga0495687_000331
261 Ga0495677_0016139
262 Ga0495685_000016
263 Ga0495673_0004669
264 Ga0496100_0322833
265 Ga0496101_0394753
266 Ga0496102_0453848
267 Ga0496102_0476384
268 Ga0496103_0254147
269 Ga0496103_0364697
270 Ga0496106_0484340
271 Ga0496116_0000070
272 Ga0496116_0002663
273 Ga0496116_0079720
274 Ga0496116_0094353
275 Ga0496117_0000624
276 Ga0496118_0007816
277 Ga0496119_0000034
278 Ga0496119_0005912
279 Ga0496119_0022706
280 Ga0496120_0000026
281 Ga0496120_0000031
282 Ga0496120_0004317
283 Ga0496120_0006136
284 Ga0496122_0000008
285 Ga0496122_0000052
286 Ga0496122_0002143
287 Ga0496122_0013213
288 Ga0496122_0064378
289 Ga0496123_0001672
290 Ga0496123_0017314
291 Ga0496124_0116585
292 Ga0496125_0001793
293 Ga0496125_0012199
294 Ga0496125_0039780
295 Ga0496125_0185133
296 Ga0496126_0000021
297 Ga0496126_0000313
298 Ga0496126_0000478
299 Ga0496126_0001951
300 Ga0496126_0005727
301 Ga0495678_003545
302 Ga0495682_0000080
303 Ga0495682_0001609
304 Ga0501334_02836
305 nmdc:mga04h51_257546_c1
306 2819569824
307 2512731199
308 2524189315
309 2550900472
310 2571527810
311 2573041336
312 2578336362
313 2580931424
314 2601638997
315 2621274545
316 2643740832
317 2672335686
318 2728534558
319 2739233789
320 2753808352
321 2757566139
322 2808867392
323 2819673632
324 2821115959
325 2857467451
326 2857475663
327 2857596091
328 2881638618
329 2881639177
330 2889047710
331 2889052748
332 2904115602
333 2904495445
334 2904758931
335 2919164619
336 2931384760
337 2936341792
338 2936342660
339 2936367712
340 2938653335
341 2945996584
342 2946059261
343 2968562814
344 2971408084
345 2971514532
346 2980178696
347 2984529501
348 2984535606
349 2988226799
350 2988228404
351 2988228560
352 2996635682
353 8002318807
354 8007376107
355 8046996581
356 8054469857
357 8054800988
358 8057473270

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

47

93

0.95

PF16925

TetR_C_13

Tetracyclin repressor-like, C-terminal domain

115

221

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g7s-assembly1.cif.gz_A-2 the crystal structure of transcriptional regulator, tetr family, from agrobacterium tumefaciens 0.9021 10 190
3knw-assembly1.cif.gz_B crystal structure of a putative transcriptional regulator (tetr/acrr family member) from putative transcriptional regulator (tetr/acrr family) 0.8997 8 191
3knw-assembly1.cif.gz_B crystal structure of a putative transcriptional regulator (tetr/acrr family member) from putative transcriptional regulator (tetr/acrr family) 0.895 8 191
3knw-assembly1.cif.gz_A crystal structure of a putative transcriptional regulator (tetr/acrr family member) from putative transcriptional regulator (tetr/acrr family) 0.888 10 191
3qbm-assembly1.cif.gz_B crystal structure of a tetr transcriptional regulator (caur_2221) from chloroflexus aurantiacus j-10-fl at 1.80 a resolution 0.8797 10 188
ID Description Score Start End Superfamily
2i10B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.929 8 61 1.10.10.60
1jupD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9106 9 54 1.10.10.60
1jt6A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.909 10 54 1.10.10.60
1jusA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9084 10 54 1.10.10.60
1jtxA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9083 10 54 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A840VTF9-F1-model_v4 TetR/AcrR family transcriptional repressor of nem operon 0.9651 1 191 GO:0003677
GO:0006355
AF-A0A4R1YA29-F1-model_v4 deleted 0.9623 1 191
AF-A0A645BJF4-F1-model_v4 HTH-type transcriptional repressor ComR 0.9622 1 190 GO:0003677
GO:0006355
GO:0016747
AF-A0A1B8WKS2-F1-model_v4 TetR family transcriptional regulator 0.9594 1 191 GO:0003677
GO:0006355
AF-A0A1I3L0Z9-F1-model_v4 Transcriptional regulator, TetR family 0.9591 1 191 GO:0003677
GO:0006355

Map