F274644

General Info

Members Datasets Scaffolds Average Seq Length
179 125 358 174

Family's Representative Sequence

Representative Sequence 3300059421|Ga0590071_001440|Ga0590071_001440_5632_6225
Length 197
Sequence MTRPPGCAESPIDPVAPLRQDRAAVRQLRYSVAASLDGYIAGPDGEFDWIVIDPEIDFAAGFAGFSGIVMGRRSYEVSVGTGGPMGPTLPTYVYSRTLPEGERDGVTFARDAVSHVKTLKQAAEQKPLWLWGGGELFRNLAEAGLVDGVDVAIIPVLLGGGIPLLPTPGPRLPLRLRKHRLYETTGTLALEYDVLRE

Samples

Sample ID Description Type Environment
1 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
42 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
43 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
64 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
65 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
66 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
67 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
68 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
69 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
72 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
73 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
74 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
75 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
76 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
77 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
78 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
79 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
80 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
81 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
82 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
83 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
84 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
85 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
86 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
87 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
88 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
89 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
90 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
91 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
92 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
93 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
94 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
95 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
96 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
97 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
98 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
99 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
104 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
105 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
106 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
107 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
108 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
109 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
110 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
111 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
112 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
113 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
114 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
115 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
116 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
117 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
118 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
119 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
120 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
121 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
122 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
123 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
124 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.7
Nodule 0
Rhizoplane 3.91
Rhizosphere 89.39
Stem 0
Stem Tuber 0
Unclassified 18.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0590071_001440 3300059421 Bacteria 6287
2 Ga0065712_10086659 3300005290 Bacteria 2623
3 Ga0070670_100282303 3300005331 Bacteria 1450
4 Ga0070670_100555839 3300005331 Bacteria 1024
5 Ga0070677_10188491 3300005333 Bacteria 987
6 Ga0070691_10074468 3300005341 Bacteria 1652
7 Ga0070661_100095404 3300005344 Bacteria 2206
8 Ga0070674_100361313 3300005356 Bacteria 1176
9 Ga0070714_100600254 3300005435 Bacteria 1057
10 Ga0070663_100172078 3300005455 Unclassified 1675
11 Ga0070663_100369847 3300005455 Unclassified 1165
12 Ga0070678_100036644 3300005456 Bacteria 3435
13 Ga0068867_100793689 3300005459 Bacteria 844
14 Ga0068867_100805809 3300005459 Bacteria 838
15 Ga0070699_100647559 3300005518 Bacteria 964
16 Ga0070684_100013117 3300005535 Bacteria 6670
17 Ga0068853_100331774 3300005539 Unclassified 1412
18 Ga0070696_100068926 3300005546 Bacteria 2484
19 Ga0068855_100441788 3300005563 Unclassified 1421
20 Ga0068855_101048733 3300005563 Bacteria 854
21 Ga0070664_100336516 3300005564 Bacteria 1370
22 Ga0070664_101156402 3300005564 Bacteria 729
23 Ga0068860_102106248 3300005843 Bacteria 585
24 Ga0068862_100866353 3300005844 Bacteria 886
25 Ga0081539_10082000 3300005985 Bacteria 1692
26 Ga0070717_10156040 3300006028 Bacteria 1977
27 Ga0075364_10260258 3300006051 Bacteria 1179
28 Ga0075367_10003983 3300006178 Bacteria 7134
29 Ga0075367_10599267 3300006178 Bacteria 700
30 Ga0075366_10008612 3300006195 Bacteria 5680
31 Ga0075428_100000124 3300006844 Bacteria 66783
32 Ga0075428_100041997 3300006844 Bacteria 5029
33 Ga0075430_100028212 3300006846 Bacteria 4769
34 Ga0075431_100058808 3300006847 Bacteria 3967
35 Ga0075431_100206341 3300006847 Unclassified 2009
36 Ga0075434_100554559 3300006871 Unclassified 1169
37 Ga0075429_100007748 3300006880 Bacteria 9324
38 Ga0075429_100244688 3300006880 Bacteria 1571
39 Ga0075429_100488706 3300006880 Bacteria 1079
40 Ga0105240_10511448 3300009093 Bacteria 1334
41 Ga0111539_10000019 3300009094 Bacteria 266927
42 Ga0111539_10053272 3300009094 Bacteria 4816
43 Ga0111539_10074135 3300009094 Unclassified 4010
44 Ga0111539_10303839 3300009094 Bacteria 1857
45 Ga0111539_11086526 3300009094 Bacteria 930
46 Ga0111539_11335004 3300009094 Bacteria 832
47 Ga0114129_10774191 3300009147 Bacteria 1226
48 Ga0105238_10959627 3300009551 Unclassified 875
49 Ga0105246_10138319 3300011119 Bacteria 1828
50 Ga0105246_10297001 3300011119 Bacteria 1302
51 Ga0157373_10144249 3300013100 Unclassified 1674
52 Ga0157370_10675688 3300013104 Unclassified 943
53 Ga0157369_10579024 3300013105 Unclassified 1159
54 Ga0157369_11953097 3300013105 Unclassified 595
55 Ga0157374_11746918 3300013296 Unclassified 647
56 Ga0157372_10219363 3300013307 Unclassified 2205
57 Ga0157372_11331976 3300013307 Unclassified 828
58 Ga0157380_10539090 3300014326 Unclassified 1142
59 Ga0182008_10003497 3300014497 Bacteria 9474
60 Ga0182006_1100508 3300015261 Unclassified 1027
61 Ga0207697_10073650 3300025315 Bacteria 1434
62 Ga0207643_10999204 3300025908 Unclassified 541
63 Ga0207707_10633870 3300025912 Unclassified 902
64 Ga0207707_10901046 3300025912 Bacteria 731
65 Ga0207695_10118780 3300025913 Bacteria 2615
66 Ga0207695_10200897 3300025913 Bacteria 1908
67 Ga0207652_10679921 3300025921 Unclassified 919
68 Ga0207694_10658228 3300025924 Unclassified 883
69 Ga0207650_10209394 3300025925 Bacteria 1565
70 Ga0207650_10436675 3300025925 Bacteria 1088
71 Ga0207659_10210915 3300025926 Bacteria 1557
72 Ga0207669_10226659 3300025937 Bacteria 1376
73 Ga0207679_10704946 3300025945 Bacteria 916
74 Ga0207679_10845244 3300025945 Bacteria 836
75 Ga0207667_10695812 3300025949 Bacteria 1019
76 Ga0207677_10173754 3300026023 Bacteria 1688
77 Ga0207678_10047038 3300026067 Unclassified 3731
78 Ga0207675_100285376 3300026118 Bacteria 1605
79 Ga0207683_10197868 3300026121 Bacteria 1826
80 Ga0207683_10759339 3300026121 Bacteria 900
81 Ga0209971_1074239 3300027682 Bacteria 826
82 Ga0209813_10120632 3300027866 Bacteria 912
83 Ga0207428_10000248 3300027907 Bacteria 73259
84 Ga0207428_10018070 3300027907 Bacteria 6034
85 Ga0268264_11621487 3300028381 Bacteria 658
86 Ga0265338_10006729 3300028800 Bacteria 14513
87 Ga0265325_10068473 3300031241 Bacteria 1787
88 Ga0265339_10006351 3300031249 Bacteria 7767
89 Ga0265316_10050341 3300031344 Bacteria 3276
90 Ga0265314_10054263 3300031711 Bacteria 2774
91 Ga0265342_10200506 3300031712 Bacteria 1084
92 Ga0307412_10853117 3300031911 Bacteria 795
93 Ga0307409_101361279 3300031995 Bacteria 736
94 Ga0307416_100301015 3300032002 Bacteria 1594
95 Ga0307416_100590946 3300032002 Bacteria 1189
96 Ga0307416_100773461 3300032002 Bacteria 1054
97 Ga0307416_101189618 3300032002 Bacteria 868
98 Ga0307416_101269922 3300032002 Bacteria 842
99 Ga0307414_11029367 3300032004 Bacteria 759
100 Ga0307415_100334082 3300032126 Bacteria 1269
101 Ga0439453_0046880 3300041408 Unclassified 863
102 Ga0439433_0003260 3300041999 Bacteria 3479
103 Ga0439449_0242784 3300042007 Bacteria 677
104 Ga0439451_073057 3300042009 Bacteria 687
105 Ga0439457_099922 3300042014 Unclassified 676
106 Ga0450920_005935 3300042122 Bacteria 2183
107 Ga0450894_001973 3300042131 Bacteria 2831
108 Ga0450894_038424 3300042131 Unclassified 683
109 Ga0450896_004113 3300042133 Bacteria 1963
110 Ga0450898_020404 3300042134 Bacteria 1161
111 Ga0450906_018259 3300042145 Bacteria 1259
112 Ga0450908_005202 3300042184 Bacteria 2493
113 Ga0450908_006760 3300042184 Bacteria 2171
114 Ga0439435_0000444 3300042436 Bacteria 6503
115 Ga0439435_0057769 3300042436 Bacteria 1124
116 Ga0439435_0063783 3300042436 Bacteria 1078
117 Ga0450916_021146 3300042530 Bacteria 894
118 Ga0450918_014040 3300042531 Bacteria 1393
119 Ga0451577_0006815 3300042876 Bacteria 11321
120 Ga0495638_0013917 3300046460 Bacteria 5455
121 Ga0495643_0026704 3300046522 Unclassified 3253
122 Ga0495672_0302495 3300047320 Unclassified 757
123 Ga0496102_0179005 3300048905 Bacteria 1997
124 Ga0496104_0212524 3300048907 Bacteria 1846
125 Ga0496106_0287421 3300048909 Bacteria 1318
126 Ga0496107_0136399 3300048910 Bacteria 1813
127 Ga0496110_0139120 3300048913 Bacteria 2195
128 Ga0496112_0004019 3300048915 Bacteria 12333
129 Ga0496113_0308174 3300048916 Bacteria 1268
130 Ga0501296_025032 3300049519 Bacteria 780
131 Ga0501040_0780003 3300049576 Unclassified 691
132 Ga0501041_0206522 3300049577 Bacteria 1232
133 Ga0501042_0164713 3300049578 Bacteria 1600
134 Ga0501042_0410203 3300049578 Bacteria 982
135 Ga0501042_1093958 3300049578 Bacteria 581
136 Ga0501048_0742443 3300049582 Bacteria 705
137 Ga0501071_0197143 3300049587 Bacteria 1512
138 Ga0501071_0320298 3300049587 Bacteria 1177
139 Ga0501071_0609956 3300049587 Bacteria 839
140 Ga0501072_0003286 3300049588 Bacteria 12160
141 Ga0501072_0597666 3300049588 Bacteria 870
142 Ga0501075_0070215 3300049591 Bacteria 2647
143 Ga0501075_0147965 3300049591 Bacteria 1790
144 Ga0501075_0203788 3300049591 Bacteria 1509
145 Ga0501076_0182305 3300049592 Bacteria 1712
146 Ga0501076_0598893 3300049592 Bacteria 909
147 Ga0501079_0583226 3300049741 Bacteria 880
148 Ga0501080_0511699 3300049742 Bacteria 1072
149 Ga0501081_0052574 3300049743 Bacteria 2812
150 Ga0501045_0596139 3300049824 Bacteria 818
151 Ga0501045_1024468 3300049824 Unclassified 605
152 nmdc:mga00v17_641822_c1 3300050491 Unclassified 683
153 nmdc:mga06z11_169613_c1 3300050494 Unclassified 1252
154 nmdc:mga06z11_8106_c2 3300050494 Unclassified 3602
155 nmdc:mga04h51_26378_c1 3300050495 Unclassified 1796
156 nmdc:mga05p37_361644_c1 3300050507 Bacteria 1706
157 nmdc:mga09592_101813_c1 3300050508 Bacteria 2461
158 nmdc:mga09592_386778_c1 3300050508 Bacteria 1209
159 nmdc:mga0qj67_39124_c1 3300050509 Bacteria 3723
160 nmdc:mga06r32_250061_c1 3300050510 Unclassified 1760
161 nmdc:mga06r32_357285_c1 3300050510 Bacteria 1445
162 nmdc:mga06r32_5455_c1 3300050510 Bacteria 11452
163 nmdc:mga08y16_1272539_c1 3300050511 Bacteria 703
164 nmdc:mga08y16_14_c1 3300050511 Bacteria 398067
165 nmdc:mga08y16_1672118_c1 3300050511 Bacteria 592
166 nmdc:mga08y16_243420_c1 3300050511 Bacteria 1859
167 nmdc:mga08y16_75042_c1 3300050511 Bacteria 3525
168 nmdc:mga08y16_876223_c1 3300050511 Bacteria 885
169 nmdc:mga0n895_240634_c1 3300050512 Bacteria 1836
170 Ga0500592_021139 3300053116 Bacteria 1047
171 Ga0500568_0001030 3300053139 Bacteria 19071
172 Ga0500568_0020451 3300053139 Viruses 2861
173 Ga0501084_0123695 3300054114 Bacteria 2176
174 Ga0501084_0237936 3300054114 Bacteria 1537
175 Ga0501084_0538252 3300054114 Bacteria 987
176 Ga0590075_000087 3300059424 Bacteria 23864
177 Ga0590077_000165 3300059426 Bacteria 18710
178 Ga0590077_014646 3300059426 Bacteria 1635
179 Ga0501082_0117010 3300060353 Bacteria 2309
180 Ga0590071_001440
181 Ga0065712_10086659
182 Ga0070670_100282303
183 Ga0070670_100555839
184 Ga0070677_10188491
185 Ga0070691_10074468
186 Ga0070661_100095404
187 Ga0070674_100361313
188 Ga0070714_100600254
189 Ga0070663_100172078
190 Ga0070663_100369847
191 Ga0070678_100036644
192 Ga0068867_100793689
193 Ga0068867_100805809
194 Ga0070699_100647559
195 Ga0070684_100013117
196 Ga0068853_100331774
197 Ga0070696_100068926
198 Ga0068855_100441788
199 Ga0068855_101048733
200 Ga0070664_100336516
201 Ga0070664_101156402
202 Ga0068860_102106248
203 Ga0068862_100866353
204 Ga0081539_10082000
205 Ga0070717_10156040
206 Ga0075364_10260258
207 Ga0075367_10003983
208 Ga0075367_10599267
209 Ga0075366_10008612
210 Ga0075428_100000124
211 Ga0075428_100041997
212 Ga0075430_100028212
213 Ga0075431_100058808
214 Ga0075431_100206341
215 Ga0075434_100554559
216 Ga0075429_100007748
217 Ga0075429_100244688
218 Ga0075429_100488706
219 Ga0105240_10511448
220 Ga0111539_10000019
221 Ga0111539_10053272
222 Ga0111539_10074135
223 Ga0111539_10303839
224 Ga0111539_11086526
225 Ga0111539_11335004
226 Ga0114129_10774191
227 Ga0105238_10959627
228 Ga0105246_10138319
229 Ga0105246_10297001
230 Ga0157373_10144249
231 Ga0157370_10675688
232 Ga0157369_10579024
233 Ga0157369_11953097
234 Ga0157374_11746918
235 Ga0157372_10219363
236 Ga0157372_11331976
237 Ga0157380_10539090
238 Ga0182008_10003497
239 Ga0182006_1100508
240 Ga0207697_10073650
241 Ga0207643_10999204
242 Ga0207707_10633870
243 Ga0207707_10901046
244 Ga0207695_10118780
245 Ga0207695_10200897
246 Ga0207652_10679921
247 Ga0207694_10658228
248 Ga0207650_10209394
249 Ga0207650_10436675
250 Ga0207659_10210915
251 Ga0207669_10226659
252 Ga0207679_10704946
253 Ga0207679_10845244
254 Ga0207667_10695812
255 Ga0207677_10173754
256 Ga0207678_10047038
257 Ga0207675_100285376
258 Ga0207683_10197868
259 Ga0207683_10759339
260 Ga0209971_1074239
261 Ga0209813_10120632
262 Ga0207428_10000248
263 Ga0207428_10018070
264 Ga0268264_11621487
265 Ga0265338_10006729
266 Ga0265325_10068473
267 Ga0265339_10006351
268 Ga0265316_10050341
269 Ga0265314_10054263
270 Ga0265342_10200506
271 Ga0307412_10853117
272 Ga0307409_101361279
273 Ga0307416_100301015
274 Ga0307416_100590946
275 Ga0307416_100773461
276 Ga0307416_101189618
277 Ga0307416_101269922
278 Ga0307414_11029367
279 Ga0307415_100334082
280 Ga0439453_0046880
281 Ga0439433_0003260
282 Ga0439449_0242784
283 Ga0439451_073057
284 Ga0439457_099922
285 Ga0450920_005935
286 Ga0450894_001973
287 Ga0450894_038424
288 Ga0450896_004113
289 Ga0450898_020404
290 Ga0450906_018259
291 Ga0450908_005202
292 Ga0450908_006760
293 Ga0439435_0000444
294 Ga0439435_0057769
295 Ga0439435_0063783
296 Ga0450916_021146
297 Ga0450918_014040
298 Ga0451577_0006815
299 Ga0495638_0013917
300 Ga0495643_0026704
301 Ga0495672_0302495
302 Ga0496102_0179005
303 Ga0496104_0212524
304 Ga0496106_0287421
305 Ga0496107_0136399
306 Ga0496110_0139120
307 Ga0496112_0004019
308 Ga0496113_0308174
309 Ga0501296_025032
310 Ga0501040_0780003
311 Ga0501041_0206522
312 Ga0501042_0164713
313 Ga0501042_0410203
314 Ga0501042_1093958
315 Ga0501048_0742443
316 Ga0501071_0197143
317 Ga0501071_0320298
318 Ga0501071_0609956
319 Ga0501072_0003286
320 Ga0501072_0597666
321 Ga0501075_0070215
322 Ga0501075_0147965
323 Ga0501075_0203788
324 Ga0501076_0182305
325 Ga0501076_0598893
326 Ga0501079_0583226
327 Ga0501080_0511699
328 Ga0501081_0052574
329 Ga0501045_0596139
330 Ga0501045_1024468
331 nmdc:mga00v17_641822_c1
332 nmdc:mga06z11_169613_c1
333 nmdc:mga06z11_8106_c2
334 nmdc:mga04h51_26378_c1
335 nmdc:mga05p37_361644_c1
336 nmdc:mga09592_101813_c1
337 nmdc:mga09592_386778_c1
338 nmdc:mga0qj67_39124_c1
339 nmdc:mga06r32_250061_c1
340 nmdc:mga06r32_357285_c1
341 nmdc:mga06r32_5455_c1
342 nmdc:mga08y16_1272539_c1
343 nmdc:mga08y16_14_c1
344 nmdc:mga08y16_1672118_c1
345 nmdc:mga08y16_243420_c1
346 nmdc:mga08y16_75042_c1
347 nmdc:mga08y16_876223_c1
348 nmdc:mga0n895_240634_c1
349 Ga0500592_021139
350 Ga0500568_0001030
351 Ga0500568_0020451
352 Ga0501084_0123695
353 Ga0501084_0237936
354 Ga0501084_0538252
355 Ga0590075_000087
356 Ga0590077_000165
357 Ga0590077_014646
358 Ga0501082_0117010

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

26

188

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8576 1 170
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.8514 1 169
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8484 1 170
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8455 1 170
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.841 3 170
ID Description Score Start End Superfamily
af_B6SZL4_173_238_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9229 151 167 3.30.70.100
af_A0A1D6HW91_25_86_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8864 151 168 3.30.70.100
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8468 1 170 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8422 1 170 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8354 1 171 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A7V9SHY1-F1-model_v4 Dihydrofolate reductase 0.9899 1 142 GO:0008703
GO:0009231
AF-A0A2W4TBS0-F1-model_v4 Dihydrofolate reductase 0.9792 1 171 GO:0008703
GO:0009231
AF-A0A7W1DQ88-F1-model_v4 Dihydrofolate reductase 0.9753 3 171 GO:0008703
GO:0009231
AF-A0A2W4TBS0-F1-model_v4 Dihydrofolate reductase 0.9736 1 171 GO:0008703
GO:0009231
AF-A0A7W1DQ88-F1-model_v4 Dihydrofolate reductase 0.964 3 171 GO:0008703
GO:0009231

Map