F274119

General Info

Members Datasets Scaffolds Average Seq Length
179 127 358 303

Family's Representative Sequence

Representative Sequence 3300035172|Ga0373955_0117225|Ga0373955_0117225_484_1524
Length 346
Sequence MAARLATWFRAFSKPSHDAFSRAMKKAHQLAGVSILLLLAAGGARAQMGDPAKIALKTTPVAGGVSVIEGANGFAGGNVAVSVGNDGVFIVDDELTPMSAKLKAAIAALSKKPVRFVINTHWHADHTGGNPAMGSAGAVIVAHDNVRKRLSVDQTMNFGGQVRTVAATPPEGLPVVTFGDDVTLHLNGDDVHVIHVPPAHTDGDSIVHFANANVIHMGDTFSMMGYPFVDASSGGKFDGLLAAADRALALCNDTTKVIPGHGAVGTTADLKAWREMLAKVRDKVAALAAEHKSLEDIKAAKPTAEFDAKMSAGFIKPDQLVEAVFVSLPPAPEKGKDAGKGKKAKK

Samples

Sample ID Description Type Environment
1 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
74 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
75 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
76 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
77 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
78 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
79 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
80 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
81 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
82 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
88 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
91 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
92 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
93 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
94 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
95 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
96 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
97 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
106 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
107 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
108 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
109 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
110 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
111 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
112 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
113 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
114 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
115 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
118 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
119 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
120 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
121 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
122 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
123 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
124 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
125 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
126 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
127 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.12
Nodule 0
Rhizoplane 0.56
Rhizosphere 96.65
Stem 0
Stem Tuber 0
Unclassified 4.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373955_0117225 3300035172 Bacteria 1544
2 rootH1_10052958 3300003323 Bacteria 7522
3 Ga0070683_100204979 3300005329 Bacteria 1873
4 Ga0070683_100256044 3300005329 Unclassified 1665
5 Ga0070677_10000158 3300005333 Bacteria 23091
6 Ga0070677_10113130 3300005333 Bacteria 1215
7 Ga0068869_100577821 3300005334 Bacteria 947
8 Ga0070680_100044277 3300005336 Bacteria 3617
9 Ga0070680_100077121 3300005336 Bacteria 2745
10 Ga0070680_100113846 3300005336 Bacteria 2253
11 Ga0070682_100020376 3300005337 Bacteria 3900
12 Ga0070682_100069476 3300005337 Bacteria 2249
13 Ga0068868_100000122 3300005338 Bacteria 49376
14 Ga0068868_100294767 3300005338 Bacteria 1376
15 Ga0070660_100000521 3300005339 Bacteria 25661
16 Ga0070689_100417553 3300005340 Bacteria 1136
17 Ga0070675_100048609 3300005354 Bacteria 3479
18 Ga0070675_100061805 3300005354 Bacteria 3094
19 Ga0070674_100381247 3300005356 Unclassified 1147
20 Ga0070659_100000032 3300005366 Bacteria 120241
21 Ga0070713_100268971 3300005436 Bacteria 1560
22 Ga0070701_10005720 3300005438 Bacteria 5167
23 Ga0070700_100159699 3300005441 Bacteria 1550
24 Ga0070662_100157265 3300005457 Bacteria 1775
25 Ga0070681_10031656 3300005458 Bacteria 5310
26 Ga0070681_10048910 3300005458 Bacteria 4224
27 Ga0070679_100027257 3300005530 Bacteria 5621
28 Ga0070679_100124390 3300005530 Bacteria 2562
29 Ga0070679_100312819 3300005530 Bacteria 1520
30 Ga0068853_100198152 3300005539 Bacteria 1827
31 Ga0070686_100006655 3300005544 Bacteria 6434
32 Ga0070686_100079423 3300005544 Bacteria 2169
33 Ga0070665_100000089 3300005548 Bacteria 177659
34 Ga0070665_100000195 3300005548 Bacteria 106493
35 Ga0070665_100343282 3300005548 Bacteria 1498
36 Ga0070704_100008772 3300005549 Bacteria 6082
37 Ga0068856_100029024 3300005614 Bacteria 5405
38 Ga0068856_100157219 3300005614 Bacteria 2284
39 Ga0068856_100314299 3300005614 Bacteria 1584
40 Ga0068859_100280084 3300005617 Bacteria 1760
41 Ga0068861_100017669 3300005719 Bacteria 5069
42 Ga0068861_100208596 3300005719 Bacteria 1644
43 Ga0068860_100257031 3300005843 Bacteria 1702
44 Ga0068862_100021604 3300005844 Bacteria 5381
45 Ga0070717_10262757 3300006028 Bacteria 1527
46 Ga0075428_100025762 3300006844 Bacteria 6513
47 Ga0075428_100361151 3300006844 Bacteria 1558
48 Ga0075428_100366681 3300006844 Bacteria 1545
49 Ga0075430_100078417 3300006846 Bacteria 2769
50 Ga0075431_100403557 3300006847 Bacteria 1368
51 Ga0075429_100021659 3300006880 Bacteria 5572
52 Ga0097620_100280083 3300006931 Bacteria 1760
53 Ga0111539_10060470 3300009094 Bacteria 4490
54 Ga0105245_10034708 3300009098 Bacteria 4474
55 Ga0105243_10046399 3300009148 Bacteria 3418
56 Ga0157378_10649695 3300013297 Bacteria 1070
57 Ga0157372_10182678 3300013307 Bacteria 2428
58 Ga0157375_10161598 3300013308 Bacteria 2382
59 Ga0157380_10040065 3300014326 Bacteria 3646
60 Ga0207653_10036482 3300025885 Bacteria 1602
61 Ga0207682_10000750 3300025893 Bacteria 14968
62 Ga0207707_10024914 3300025912 Bacteria 5234
63 Ga0207707_10072579 3300025912 Bacteria 3000
64 Ga0207660_10028103 3300025917 Bacteria 3845
65 Ga0207662_10115255 3300025918 Bacteria 1679
66 Ga0207662_10119135 3300025918 Bacteria 1654
67 Ga0207657_10002315 3300025919 Bacteria 20657
68 Ga0207652_10036789 3300025921 Bacteria 4139
69 Ga0207652_10192817 3300025921 Bacteria 1833
70 Ga0207652_10322507 3300025921 Unclassified 1394
71 Ga0207681_10118255 3300025923 Bacteria 1940
72 Ga0207659_10047954 3300025926 Bacteria 3024
73 Ga0207687_10100987 3300025927 Bacteria 2123
74 Ga0207700_10235147 3300025928 Bacteria 1560
75 Ga0207690_10000001 3300025932 Bacteria 807539
76 Ga0207686_10016696 3300025934 Bacteria 4122
77 Ga0207670_10153950 3300025936 Bacteria 1709
78 Ga0207665_10380359 3300025939 Bacteria 1071
79 Ga0207691_10049571 3300025940 Bacteria 3847
80 Ga0207661_10036458 3300025944 Bacteria 3839
81 Ga0207661_10164946 3300025944 Bacteria 1924
82 Ga0207661_10232033 3300025944 Bacteria 1635
83 Ga0207640_10280227 3300025981 Bacteria 1309
84 Ga0207677_10000176 3300026023 Bacteria 50717
85 Ga0207677_10322559 3300026023 Bacteria 1284
86 Ga0207639_10135524 3300026041 Bacteria 2044
87 Ga0207678_10154271 3300026067 Bacteria 1961
88 Ga0207708_10108592 3300026075 Bacteria 2152
89 Ga0207702_10092670 3300026078 Bacteria 2648
90 Ga0207702_10241115 3300026078 Bacteria 1694
91 Ga0207676_10588042 3300026095 Bacteria 1068
92 Ga0207675_100017184 3300026118 Bacteria 6757
93 Ga0207683_10178724 3300026121 Bacteria 1924
94 Ga0268266_10000083 3300028379 Bacteria 202393
95 Ga0268266_10000865 3300028379 Bacteria 39418
96 Ga0268266_10408682 3300028379 Bacteria 1285
97 Ga0268265_10019858 3300028380 Bacteria 4680
98 Ga0268264_10324749 3300028381 Bacteria 1456
99 Ga0265336_10003629 3300028666 Bacteria 6025
100 Ga0265338_10001192 3300028800 Bacteria 42948
101 Ga0265338_10110902 3300028800 Unclassified 2210
102 Ga0307511_10171664 3300030521 Bacteria 1190
103 Ga0265332_10033386 3300031238 Bacteria 2240
104 Ga0265328_10001838 3300031239 Bacteria 9647
105 Ga0265320_10003665 3300031240 Bacteria 10255
106 Ga0265320_10005175 3300031240 Bacteria 8413
107 Ga0265329_10016347 3300031242 Unclassified 2573
108 Ga0265340_10072895 3300031247 Unclassified 1626
109 Ga0265339_10004962 3300031249 Bacteria 8958
110 Ga0265339_10006578 3300031249 Bacteria 7613
111 Ga0265339_10024500 3300031249 Bacteria 3475
112 Ga0265314_10000909 3300031711 Bacteria 34935
113 Ga0265314_10010287 3300031711 Bacteria 7815
114 Ga0265342_10000458 3300031712 Bacteria 44443
115 Ga0265342_10033086 3300031712 Bacteria 3182
116 Ga0316576_10119779 3300031727 Unclassified 1976
117 Ga0307410_10032228 3300031852 Bacteria 3370
118 Ga0307407_10019205 3300031903 Bacteria 3476
119 Ga0307409_100048131 3300031995 Bacteria 3242
120 Ga0307416_100227885 3300032002 Bacteria 1794
121 Ga0307416_100246928 3300032002 Bacteria 1734
122 Ga0316574_0003231 3300035398 Bacteria 8359
123 Ga0316574_0032851 3300035398 Bacteria 3156
124 Ga0373935_0126970 3300035692 Bacteria 1710
125 Ga0373937_0064525 3300036401 Bacteria 3368
126 Ga0373937_0116981 3300036401 Bacteria 2483
127 Ga0436365_1054924 3300039437 Bacteria 11608
128 Ga0451577_0001599 3300042876 Bacteria 29486
129 Ga0451577_0016089 3300042876 Bacteria 6937
130 Ga0466963_0247565 3300044694 Bacteria 1251
131 Ga0451576_0341952 3300045051 Bacteria 1566
132 Ga0495628_0115083 3300046516 Bacteria 2066
133 Ga0495642_0029091 3300046528 Bacteria 2204
134 Ga0496112_0141268 3300048915 Bacteria 2377
135 Ga0501033_0188403 3300049570 Bacteria 1477
136 Ga0501036_0085187 3300049572 Bacteria 2671
137 Ga0501039_0028984 3300049575 Bacteria 4263
138 Ga0501040_0060923 3300049576 Bacteria 2594
139 Ga0501041_0004908 3300049577 Bacteria 7770
140 Ga0501042_0116106 3300049578 Bacteria 1927
141 Ga0501042_0157242 3300049578 Bacteria 1640
142 Ga0501046_0026557 3300049580 Bacteria 4729
143 Ga0501048_0019117 3300049582 Bacteria 5032
144 Ga0501067_0081975 3300049583 Bacteria 1788
145 Ga0501068_0024636 3300049584 Bacteria 3534
146 Ga0501070_0035148 3300049586 Bacteria 4188
147 Ga0501071_0042954 3300049587 Bacteria 3240
148 Ga0501071_0198230 3300049587 Bacteria 1507
149 Ga0501072_0009234 3300049588 Bacteria 7495
150 Ga0501072_0020997 3300049588 Bacteria 5063
151 Ga0501072_0124251 3300049588 Bacteria 2056
152 Ga0501073_0002639 3300049589 Bacteria 13434
153 Ga0501073_0076091 3300049589 Bacteria 2336
154 Ga0501074_0100924 3300049590 Bacteria 2065
155 Ga0501075_0032432 3300049591 Bacteria 3881
156 Ga0501075_0265681 3300049591 Bacteria 1308
157 Ga0501075_0300459 3300049591 Bacteria 1223
158 Ga0501076_0009757 3300049592 Bacteria 7092
159 Ga0501076_0265505 3300049592 Bacteria 1405
160 Ga0501077_0000397 3300049593 Bacteria 26187
161 Ga0501077_0226155 3300049593 Bacteria 1189
162 Ga0501079_0001448 3300049741 Bacteria 16783
163 Ga0501079_0007613 3300049741 Bacteria 8202
164 Ga0501080_0006758 3300049742 Bacteria 10334
165 Ga0501080_0026995 3300049742 Bacteria 5339
166 Ga0501081_0011971 3300049743 Bacteria 5684
167 Ga0501081_0059872 3300049743 Bacteria 2637
168 Ga0501083_0063962 3300049744 Bacteria 2453
169 nmdc:mga09592_33314_c1 3300050508 Bacteria 4300
170 nmdc:mga06r32_455741_c1 3300050510 Unclassified 1258
171 nmdc:mga08y16_57203_c1 3300050511 Bacteria 4076
172 nmdc:mga0n895_80695_c1 3300050512 Bacteria 3241
173 Ga0500566_0077858 3300053094 Bacteria 1851
174 Ga0500597_007256 3300053120 Bacteria 3740
175 Ga0501084_0008266 3300054114 Bacteria 8585
176 Ga0501084_0142225 3300054114 Bacteria 2020
177 Ga0501082_0087043 3300060353 Bacteria 2695
178 Ga0501082_0108632 3300060353 Bacteria 2401
179 Ga0530510_0352255 3300061734 Bacteria 1106
180 Ga0373955_0117225
181 rootH1_10052958
182 Ga0070683_100204979
183 Ga0070683_100256044
184 Ga0070677_10000158
185 Ga0070677_10113130
186 Ga0068869_100577821
187 Ga0070680_100044277
188 Ga0070680_100077121
189 Ga0070680_100113846
190 Ga0070682_100020376
191 Ga0070682_100069476
192 Ga0068868_100000122
193 Ga0068868_100294767
194 Ga0070660_100000521
195 Ga0070689_100417553
196 Ga0070675_100048609
197 Ga0070675_100061805
198 Ga0070674_100381247
199 Ga0070659_100000032
200 Ga0070713_100268971
201 Ga0070701_10005720
202 Ga0070700_100159699
203 Ga0070662_100157265
204 Ga0070681_10031656
205 Ga0070681_10048910
206 Ga0070679_100027257
207 Ga0070679_100124390
208 Ga0070679_100312819
209 Ga0068853_100198152
210 Ga0070686_100006655
211 Ga0070686_100079423
212 Ga0070665_100000089
213 Ga0070665_100000195
214 Ga0070665_100343282
215 Ga0070704_100008772
216 Ga0068856_100029024
217 Ga0068856_100157219
218 Ga0068856_100314299
219 Ga0068859_100280084
220 Ga0068861_100017669
221 Ga0068861_100208596
222 Ga0068860_100257031
223 Ga0068862_100021604
224 Ga0070717_10262757
225 Ga0075428_100025762
226 Ga0075428_100361151
227 Ga0075428_100366681
228 Ga0075430_100078417
229 Ga0075431_100403557
230 Ga0075429_100021659
231 Ga0097620_100280083
232 Ga0111539_10060470
233 Ga0105245_10034708
234 Ga0105243_10046399
235 Ga0157378_10649695
236 Ga0157372_10182678
237 Ga0157375_10161598
238 Ga0157380_10040065
239 Ga0207653_10036482
240 Ga0207682_10000750
241 Ga0207707_10024914
242 Ga0207707_10072579
243 Ga0207660_10028103
244 Ga0207662_10115255
245 Ga0207662_10119135
246 Ga0207657_10002315
247 Ga0207652_10036789
248 Ga0207652_10192817
249 Ga0207652_10322507
250 Ga0207681_10118255
251 Ga0207659_10047954
252 Ga0207687_10100987
253 Ga0207700_10235147
254 Ga0207690_10000001
255 Ga0207686_10016696
256 Ga0207670_10153950
257 Ga0207665_10380359
258 Ga0207691_10049571
259 Ga0207661_10036458
260 Ga0207661_10164946
261 Ga0207661_10232033
262 Ga0207640_10280227
263 Ga0207677_10000176
264 Ga0207677_10322559
265 Ga0207639_10135524
266 Ga0207678_10154271
267 Ga0207708_10108592
268 Ga0207702_10092670
269 Ga0207702_10241115
270 Ga0207676_10588042
271 Ga0207675_100017184
272 Ga0207683_10178724
273 Ga0268266_10000083
274 Ga0268266_10000865
275 Ga0268266_10408682
276 Ga0268265_10019858
277 Ga0268264_10324749
278 Ga0265336_10003629
279 Ga0265338_10001192
280 Ga0265338_10110902
281 Ga0307511_10171664
282 Ga0265332_10033386
283 Ga0265328_10001838
284 Ga0265320_10003665
285 Ga0265320_10005175
286 Ga0265329_10016347
287 Ga0265340_10072895
288 Ga0265339_10004962
289 Ga0265339_10006578
290 Ga0265339_10024500
291 Ga0265314_10000909
292 Ga0265314_10010287
293 Ga0265342_10000458
294 Ga0265342_10033086
295 Ga0316576_10119779
296 Ga0307410_10032228
297 Ga0307407_10019205
298 Ga0307409_100048131
299 Ga0307416_100227885
300 Ga0307416_100246928
301 Ga0316574_0003231
302 Ga0316574_0032851
303 Ga0373935_0126970
304 Ga0373937_0064525
305 Ga0373937_0116981
306 Ga0436365_1054924
307 Ga0451577_0001599
308 Ga0451577_0016089
309 Ga0466963_0247565
310 Ga0451576_0341952
311 Ga0495628_0115083
312 Ga0495642_0029091
313 Ga0496112_0141268
314 Ga0501033_0188403
315 Ga0501036_0085187
316 Ga0501039_0028984
317 Ga0501040_0060923
318 Ga0501041_0004908
319 Ga0501042_0116106
320 Ga0501042_0157242
321 Ga0501046_0026557
322 Ga0501048_0019117
323 Ga0501067_0081975
324 Ga0501068_0024636
325 Ga0501070_0035148
326 Ga0501071_0042954
327 Ga0501071_0198230
328 Ga0501072_0009234
329 Ga0501072_0020997
330 Ga0501072_0124251
331 Ga0501073_0002639
332 Ga0501073_0076091
333 Ga0501074_0100924
334 Ga0501075_0032432
335 Ga0501075_0265681
336 Ga0501075_0300459
337 Ga0501076_0009757
338 Ga0501076_0265505
339 Ga0501077_0000397
340 Ga0501077_0226155
341 Ga0501079_0001448
342 Ga0501079_0007613
343 Ga0501080_0006758
344 Ga0501080_0026995
345 Ga0501081_0011971
346 Ga0501081_0059872
347 Ga0501083_0063962
348 nmdc:mga09592_33314_c1
349 nmdc:mga06r32_455741_c1
350 nmdc:mga08y16_57203_c1
351 nmdc:mga0n895_80695_c1
352 Ga0500566_0077858
353 Ga0500597_007256
354 Ga0501084_0008266
355 Ga0501084_0142225
356 Ga0501082_0087043
357 Ga0501082_0108632
358 Ga0530510_0352255

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

72

291

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fqa-assembly1.cif.gz_A crystal structure of bacillus cereus metallo-beta-lactamase ii 0.8628 32 253
2uyx-assembly1.cif.gz_A metallo-beta-lactamase (1bc2) single point mutant d120s 0.86 32 253
3kns-assembly4.cif.gz_D bacillus cereus metallo-beta-lactamase cys221asp mutant, 20 mm zn(ii) 0.8593 32 253
2bg2-assembly1.cif.gz_A bacillus cereus metallo-beta-lactamase (bcii) arg (121) cys mutant. solved at ph4.5 using 20mm znso4 in the buffer. 1mm dtt and 1mm tcep- hcl were used as reducing agents. cys221 is reduced. 0.8545 32 253
3kns-assembly4.cif.gz_D bacillus cereus metallo-beta-lactamase cys221asp mutant, 20 mm zn(ii) 0.8514 32 253
ID Description Score Start End Superfamily
af_A0A0R0HZQ1_3_96_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8569 150 242 3.60.15.10
1m2xC00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8337 32 254 3.60.15.10
af_A0A0R0HZQ1_3_96_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8243 150 242 3.60.15.10
af_Q682P6_229_394_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.818 66 242 3.60.15.10
4nq7A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8165 30 253 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A2A5FWV3-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9846 159 304
AF-B5IJT7-F1-model_v4 Beta-lactamase domain protein 0.9751 31 304 GO:0016787
GO:0017001
GO:0042597
GO:0046677
GO:0046872
AF-A0A2V7L0K4-F1-model_v4 MBL fold metallo-hydrolase 0.9742 67 304 GO:0016787
GO:0017001
GO:0042597
GO:0046677
GO:0046872
AF-A0A0S8EQT0-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9737 27 303 GO:0016787
GO:0017001
GO:0042597
GO:0046677
GO:0046872
AF-L8LJT8-F1-model_v4 Zn-dependent hydrolase, glyoxylase 0.9723 29 303 GO:0016020
GO:0016787
GO:0017001
GO:0042597
GO:0046677
GO:0046872

Map