F274098

General Info

Members Datasets Scaffolds Average Seq Length
179 98 358 241

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10569086|Ga0307414_105690861
Length 232
Sequence VAVHIGTSGWSYAHWDGVLYPGGLPAQHRLDYYLPHFRTAELNSSYYRWPSDAAFERWRRRLPDDFLLSVKAPGLLTHVKRLFAPERWLARIGRSLARLGTRRGVLLVQLPPGAPVDHPRLAYVAVELRHPSWHQESVFRLLERHGAAYTVMSGAGLPCVLRATASFVYVRLHGPDPNHLYGGSYSDGDLHWWADRIREWDGMRRDVFVYFNNDGGGNAVRNAASLRRILGV

Samples

Sample ID Description Type Environment
1 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
2 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
3 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
17 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
18 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
19 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
21 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
22 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
23 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
24 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
25 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
26 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
27 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
28 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
43 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
44 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
45 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
46 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
47 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
48 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
49 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
50 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
51 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
52 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
53 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
54 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
55 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
56 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
57 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
58 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
59 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
60 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
61 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
62 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
63 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
64 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
65 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
66 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
67 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
68 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
69 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
70 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
71 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
72 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
73 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
74 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
75 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
76 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
77 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
78 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
79 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
80 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
81 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
82 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
83 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
84 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
88 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
89 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
90 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
91 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
92 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
93 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
94 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
95 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
96 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
97 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
98 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.85
Metatranscriptomes 0.56
Isolates 5.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.12
Nodule 0
Rhizoplane 3.35
Rhizosphere 90.5
Stem 0
Stem Tuber 0
Unclassified 0.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307414_10569086 3300032004 Bacteria 1012
2 Ga0070687_100002167 3300005343 Bacteria 7261
3 Ga0070669_100002882 3300005353 Bacteria 12399
4 Ga0070675_100004797 3300005354 Bacteria 10312
5 Ga0070671_100003216 3300005355 Bacteria 12735
6 Ga0070673_100044866 3300005364 Bacteria 3425
7 Ga0070673_100310980 3300005364 Bacteria 1390
8 Ga0070709_10307598 3300005434 Bacteria 1159
9 Ga0070714_100038522 3300005435 Bacteria 4018
10 Ga0070662_100042364 3300005457 Bacteria 3252
11 Ga0070679_100230191 3300005530 Bacteria 1813
12 Ga0070684_100104625 3300005535 Bacteria 2532
13 Ga0070672_100178357 3300005543 Bacteria 1769
14 Ga0070686_100603504 3300005544 Bacteria 865
15 Ga0068856_100043675 3300005614 Bacteria 4410
16 Ga0068859_100003418 3300005617 Bacteria 16148
17 Ga0068870_10000864 3300005840 Bacteria 11840
18 Ga0070712_100040455 3300006175 Bacteria 3196
19 Ga0075370_10266067 3300006353 Bacteria 1017
20 Ga0097620_100003418 3300006931 Bacteria 16148
21 Ga0105242_10777963 3300009176 Bacteria 945
22 Ga0105249_10033252 3300009553 Bacteria 4668
23 Ga0105239_10007652 3300010375 Bacteria 12380
24 Ga0163162_10399960 3300013306 Bacteria 1506
25 Ga0157372_10328624 3300013307 Bacteria 1780
26 Ga0157380_10049306 3300014326 Bacteria 3320
27 Ga0206353_10387518 3300020082 Bacteria 1864
28 Ga0213875_10002018 3300021388 Bacteria 12521
29 Ga0207643_10000942 3300025908 Bacteria 17455
30 Ga0207693_10124684 3300025915 Bacteria 2024
31 Ga0207662_10004926 3300025918 Bacteria 7058
32 Ga0207652_10271425 3300025921 Bacteria 1530
33 Ga0207659_10020730 3300025926 Bacteria 4351
34 Ga0207664_10340892 3300025929 Bacteria 1325
35 Ga0207706_10047744 3300025933 Bacteria 3788
36 Ga0207691_10192279 3300025940 Bacteria 1779
37 Ga0207711_10272651 3300025941 Bacteria 1557
38 Ga0207661_10134848 3300025944 Bacteria 2119
39 Ga0207661_10224884 3300025944 Bacteria 1660
40 Ga0207661_10479138 3300025944 Bacteria 1136
41 Ga0207679_10685207 3300025945 Bacteria 929
42 Ga0207651_10011995 3300025960 Bacteria 4879
43 Ga0207678_10160603 3300026067 Bacteria 1919
44 Ga0207678_10716278 3300026067 Bacteria 881
45 Ga0207674_10073853 3300026116 Bacteria 3423
46 Ga0307408_100010730 3300031548 Bacteria 6044
47 Ga0307408_100032892 3300031548 Bacteria 3618
48 Ga0307408_100061880 3300031548 Bacteria 2733
49 Ga0307408_100253571 3300031548 Bacteria 1452
50 Ga0307405_10004301 3300031731 Bacteria 6704
51 Ga0307405_10019596 3300031731 Bacteria 3761
52 Ga0307405_10212312 3300031731 Bacteria 1414
53 Ga0307413_10047185 3300031824 Bacteria 2567
54 Ga0307413_10075361 3300031824 Bacteria 2141
55 Ga0307413_10111733 3300031824 Bacteria 1830
56 Ga0307413_10116604 3300031824 Bacteria 1799
57 Ga0307413_10170751 3300031824 Bacteria 1539
58 Ga0307413_10295123 3300031824 Bacteria 1226
59 Ga0307413_10344379 3300031824 Bacteria 1148
60 Ga0307413_10513790 3300031824 Bacteria 964
61 Ga0307410_10019504 3300031852 Bacteria 4127
62 Ga0307410_10035596 3300031852 Bacteria 3234
63 Ga0307410_10056170 3300031852 Bacteria 2676
64 Ga0307410_10071560 3300031852 Bacteria 2405
65 Ga0307410_10083018 3300031852 Bacteria 2255
66 Ga0307410_10146728 3300031852 Bacteria 1752
67 Ga0307410_10239828 3300031852 Bacteria 1404
68 Ga0307410_10582146 3300031852 Bacteria 931
69 Ga0307406_10003336 3300031901 Bacteria 8754
70 Ga0307406_10028786 3300031901 Bacteria 3359
71 Ga0307406_10035769 3300031901 Bacteria 3056
72 Ga0307406_10070365 3300031901 Bacteria 2291
73 Ga0307406_10261973 3300031901 Bacteria 1308
74 Ga0307407_10005437 3300031903 Bacteria 5527
75 Ga0307407_10005858 3300031903 Bacteria 5387
76 Ga0307407_10023191 3300031903 Bacteria 3234
77 Ga0307407_10034294 3300031903 Bacteria 2777
78 Ga0307407_10052297 3300031903 Bacteria 2345
79 Ga0307407_10289842 3300031903 Bacteria 1137
80 Ga0307407_10342165 3300031903 Bacteria 1056
81 Ga0307412_10007544 3300031911 Bacteria 6177
82 Ga0307412_10027877 3300031911 Bacteria 3527
83 Ga0307412_10027995 3300031911 Bacteria 3521
84 Ga0307412_10135195 3300031911 Bacteria 1797
85 Ga0307409_100058289 3300031995 Bacteria 2998
86 Ga0307409_100062844 3300031995 Bacteria 2909
87 Ga0307409_100102347 3300031995 Bacteria 2379
88 Ga0307409_100160528 3300031995 Bacteria 1965
89 Ga0307409_100171262 3300031995 Bacteria 1911
90 Ga0307409_100504799 3300031995 Bacteria 1178
91 Ga0307416_100019480 3300032002 Bacteria 4812
92 Ga0307416_100030944 3300032002 Bacteria 4023
93 Ga0307416_100037427 3300032002 Bacteria 3733
94 Ga0307416_100076103 3300032002 Bacteria 2811
95 Ga0307416_100143124 3300032002 Bacteria 2177
96 Ga0307416_100156802 3300032002 Bacteria 2097
97 Ga0307416_100206624 3300032002 Bacteria 1869
98 Ga0307416_100280775 3300032002 Bacteria 1642
99 Ga0307416_100875290 3300032002 Bacteria 997
100 Ga0307416_101080708 3300032002 Bacteria 906
101 Ga0307414_10026362 3300032004 Bacteria 3740
102 Ga0307414_10066598 3300032004 Bacteria 2576
103 Ga0307414_10067744 3300032004 Bacteria 2559
104 Ga0307414_10148887 3300032004 Bacteria 1843
105 Ga0307411_10007994 3300032005 Bacteria 5444
106 Ga0307411_10182820 3300032005 Bacteria 1593
107 Ga0307411_10207677 3300032005 Bacteria 1509
108 Ga0307411_10216878 3300032005 Bacteria 1482
109 Ga0307411_10750355 3300032005 Bacteria 855
110 Ga0307415_100000667 3300032126 Bacteria 15183
111 Ga0307415_100002474 3300032126 Bacteria 9230
112 Ga0307415_100022264 3300032126 Bacteria 3907
113 Ga0307415_100079478 3300032126 Bacteria 2336
114 Ga0307415_100435857 3300032126 Bacteria 1129
115 Ga0373957_0119910 3300035120 Bacteria 1064
116 Ga0373935_0168741 3300035692 Bacteria 1496
117 Ga0373947_0176331 3300035725 Bacteria 1389
118 Ga0395900_0102792 3300037418 Bacteria 2935
119 Ga0395900_0138089 3300037418 Bacteria 2497
120 Ga0395898_0025919 3300037466 Bacteria 5903
121 Ga0395898_0049204 3300037466 Bacteria 4131
122 Ga0395898_0207111 3300037466 Bacteria 1871
123 Ga0395905_0134795 3300037471 Bacteria 2323
124 Ga0436364_1231391 3300037853 Bacteria 28702
125 Ga0395901_0018718 3300038443 Bacteria 7075
126 Ga0466972_0201932 3300044658 Bacteria 931
127 Ga0466965_0033307 3300044683 Bacteria 2518
128 Ga0466965_0165411 3300044683 Bacteria 1161
129 Ga0466965_0242621 3300044683 Bacteria 965
130 Ga0466965_0275513 3300044683 Bacteria 907
131 Ga0466965_0301778 3300044683 Bacteria 869
132 Ga0466961_0024749 3300044693 Bacteria 3862
133 Ga0466961_0048003 3300044693 Bacteria 2729
134 Ga0466963_0019718 3300044694 Bacteria 4234
135 Ga0466968_0039274 3300044735 Bacteria 1992
136 Ga0466970_0009768 3300044765 Bacteria 4858
137 Ga0466970_0015467 3300044765 Bacteria 3924
138 Ga0466970_0126237 3300044765 Bacteria 1403
139 Ga0466970_0207743 3300044765 Bacteria 1090
140 Ga0466957_0401953 3300044842 Bacteria 937
141 Ga0466957_0425314 3300044842 Bacteria 912
142 Ga0466960_0003325 3300044901 Bacteria 6167
143 Ga0466960_0008406 3300044901 Bacteria 4226
144 Ga0466960_0016170 3300044901 Bacteria 3231
145 Ga0466960_0034068 3300044901 Bacteria 2371
146 Ga0466960_0085721 3300044901 Bacteria 1596
147 Ga0466960_0154123 3300044901 Bacteria 1230
148 Ga0466960_0243429 3300044901 Bacteria 997
149 Ga0466959_0013074 3300045049 Bacteria 6012
150 Ga0466958_0096631 3300045836 Unclassified 1832
151 Ga0466958_0224836 3300045836 Bacteria 1198
152 Ga0466967_0112333 3300045976 Bacteria 2505
153 Ga0495634_0182650 3300046642 Bacteria 1312
154 Ga0495581_0132774 3300047315 Bacteria 1451
155 Ga0495677_0194915 3300047445 Bacteria 787
156 Ga0496102_1064886 3300048905 Bacteria 729
157 Ga0496105_0329962 3300048908 Bacteria 1221
158 Ga0496109_0142840 3300048912 Bacteria 2239
159 Ga0496112_0651013 3300048915 Bacteria 983
160 Ga0496114_0065598 3300048917 Bacteria 3042
161 Ga0496115_0013112 3300048918 Bacteria 6259
162 Ga0496122_0001218 3300048925 Bacteria 43657
163 Ga0496124_0186032 3300048927 Bacteria 1594
164 Ga0496126_0424087 3300048929 Bacteria 1075
165 Ga0501031_0424685 3300049568 Bacteria 859
166 Ga0501032_0139340 3300049569 Bacteria 1598
167 Ga0501037_0158739 3300049573 Bacteria 1613
168 Ga0501070_0529615 3300049586 Bacteria 945
169 Ga0500658_0044237 3300053134 Bacteria 1796
170 2691515343 2690315906 Bacteria 4517044
171 2808892750 2808606370 Bacteria 4942454
172 2905929648 2905926851 Bacteria 4423176
173 2910812476 2910809715 Bacteria 4982797
174 2919053127 2919051321 Bacteria 4210889
175 2939659522 2939657138 Bacteria 3740283
176 2945922206 2945920336 Bacteria 4501603
177 2946037533 2946037020 Bacteria 4900426
178 2953998802 2953998280 Bacteria 4812144
179 2974305566 2974302888 Bacteria 4369871
180 Ga0307414_10569086
181 Ga0070687_100002167
182 Ga0070669_100002882
183 Ga0070675_100004797
184 Ga0070671_100003216
185 Ga0070673_100044866
186 Ga0070673_100310980
187 Ga0070709_10307598
188 Ga0070714_100038522
189 Ga0070662_100042364
190 Ga0070679_100230191
191 Ga0070684_100104625
192 Ga0070672_100178357
193 Ga0070686_100603504
194 Ga0068856_100043675
195 Ga0068859_100003418
196 Ga0068870_10000864
197 Ga0070712_100040455
198 Ga0075370_10266067
199 Ga0097620_100003418
200 Ga0105242_10777963
201 Ga0105249_10033252
202 Ga0105239_10007652
203 Ga0163162_10399960
204 Ga0157372_10328624
205 Ga0157380_10049306
206 Ga0206353_10387518
207 Ga0213875_10002018
208 Ga0207643_10000942
209 Ga0207693_10124684
210 Ga0207662_10004926
211 Ga0207652_10271425
212 Ga0207659_10020730
213 Ga0207664_10340892
214 Ga0207706_10047744
215 Ga0207691_10192279
216 Ga0207711_10272651
217 Ga0207661_10134848
218 Ga0207661_10224884
219 Ga0207661_10479138
220 Ga0207679_10685207
221 Ga0207651_10011995
222 Ga0207678_10160603
223 Ga0207678_10716278
224 Ga0207674_10073853
225 Ga0307408_100010730
226 Ga0307408_100032892
227 Ga0307408_100061880
228 Ga0307408_100253571
229 Ga0307405_10004301
230 Ga0307405_10019596
231 Ga0307405_10212312
232 Ga0307413_10047185
233 Ga0307413_10075361
234 Ga0307413_10111733
235 Ga0307413_10116604
236 Ga0307413_10170751
237 Ga0307413_10295123
238 Ga0307413_10344379
239 Ga0307413_10513790
240 Ga0307410_10019504
241 Ga0307410_10035596
242 Ga0307410_10056170
243 Ga0307410_10071560
244 Ga0307410_10083018
245 Ga0307410_10146728
246 Ga0307410_10239828
247 Ga0307410_10582146
248 Ga0307406_10003336
249 Ga0307406_10028786
250 Ga0307406_10035769
251 Ga0307406_10070365
252 Ga0307406_10261973
253 Ga0307407_10005437
254 Ga0307407_10005858
255 Ga0307407_10023191
256 Ga0307407_10034294
257 Ga0307407_10052297
258 Ga0307407_10289842
259 Ga0307407_10342165
260 Ga0307412_10007544
261 Ga0307412_10027877
262 Ga0307412_10027995
263 Ga0307412_10135195
264 Ga0307409_100058289
265 Ga0307409_100062844
266 Ga0307409_100102347
267 Ga0307409_100160528
268 Ga0307409_100171262
269 Ga0307409_100504799
270 Ga0307416_100019480
271 Ga0307416_100030944
272 Ga0307416_100037427
273 Ga0307416_100076103
274 Ga0307416_100143124
275 Ga0307416_100156802
276 Ga0307416_100206624
277 Ga0307416_100280775
278 Ga0307416_100875290
279 Ga0307416_101080708
280 Ga0307414_10026362
281 Ga0307414_10066598
282 Ga0307414_10067744
283 Ga0307414_10148887
284 Ga0307411_10007994
285 Ga0307411_10182820
286 Ga0307411_10207677
287 Ga0307411_10216878
288 Ga0307411_10750355
289 Ga0307415_100000667
290 Ga0307415_100002474
291 Ga0307415_100022264
292 Ga0307415_100079478
293 Ga0307415_100435857
294 Ga0373957_0119910
295 Ga0373935_0168741
296 Ga0373947_0176331
297 Ga0395900_0102792
298 Ga0395900_0138089
299 Ga0395898_0025919
300 Ga0395898_0049204
301 Ga0395898_0207111
302 Ga0395905_0134795
303 Ga0436364_1231391
304 Ga0395901_0018718
305 Ga0466972_0201932
306 Ga0466965_0033307
307 Ga0466965_0165411
308 Ga0466965_0242621
309 Ga0466965_0275513
310 Ga0466965_0301778
311 Ga0466961_0024749
312 Ga0466961_0048003
313 Ga0466963_0019718
314 Ga0466968_0039274
315 Ga0466970_0009768
316 Ga0466970_0015467
317 Ga0466970_0126237
318 Ga0466970_0207743
319 Ga0466957_0401953
320 Ga0466957_0425314
321 Ga0466960_0003325
322 Ga0466960_0008406
323 Ga0466960_0016170
324 Ga0466960_0034068
325 Ga0466960_0085721
326 Ga0466960_0154123
327 Ga0466960_0243429
328 Ga0466959_0013074
329 Ga0466958_0096631
330 Ga0466958_0224836
331 Ga0466967_0112333
332 Ga0495634_0182650
333 Ga0495581_0132774
334 Ga0495677_0194915
335 Ga0496102_1064886
336 Ga0496105_0329962
337 Ga0496109_0142840
338 Ga0496112_0651013
339 Ga0496114_0065598
340 Ga0496115_0013112
341 Ga0496122_0001218
342 Ga0496124_0186032
343 Ga0496126_0424087
344 Ga0501031_0424685
345 Ga0501032_0139340
346 Ga0501037_0158739
347 Ga0501070_0529615
348 Ga0500658_0044237
349 2691515343
350 2808892750
351 2905929648
352 2910812476
353 2919053127
354 2939659522
355 2945922206
356 2946037533
357 2953998802
358 2974305566

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01904

DUF72

Protein of unknown function DUF72

20

229

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpq-assembly1.cif.gz_A crystal structure of a duf72 family protein (tm1631) from thermotoga maritima msb8 at 2.20 a resolution 0.8851 2 241
1vpq-assembly1.cif.gz_A crystal structure of a duf72 family protein (tm1631) from thermotoga maritima msb8 at 2.20 a resolution 0.8782 2 241
1ztv-assembly1.cif.gz_B crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 3.10 a resolution 0.8352 1 241
1ztv-assembly1.cif.gz_B crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 3.10 a resolution 0.8319 1 241
1vpy-assembly1.cif.gz_A crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 2.52 a resolution 0.79 2 241
ID Description Score Start End Superfamily
1vpqA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8851 2 241 3.20.20.410
af_Q2FZX7_1_282_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8791 1 241 3.20.20.410
1vpqA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8782 2 241 3.20.20.410
af_Q2FZX7_1_282_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8757 1 241 3.20.20.410
af_Q4E4B4_140_369_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8713 62 240 3.20.20.410
ID Description Score Start End GO Terms
AF-A0A2S9FDH6-F1-model_v4 DUF72 domain-containing protein 0.9803 87 240
AF-A0A7Y9MIW5-F1-model_v4 Uncharacterized protein YecE (DUF72 family) 0.9789 1 239
AF-A0A2A7MXG5-F1-model_v4 Sensor histidine kinase 0.9786 1 240 GO:0016301
AF-A0A0Q1E542-F1-model_v4 Sensor histidine kinase 0.9768 2 241 GO:0016301
AF-A0A4Q5ZRU7-F1-model_v4 DUF72 domain-containing protein 0.9765 87 239

Map