F273822

General Info

Members Datasets Scaffolds Average Seq Length
179 141 147 269

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10328830|Ga0157369_103288302
Length 290
Sequence MRWDAAAGWGRMRRLDVHHGRIQDLDADGLADYSRLTDVALRRVTEPAGGLYIAESTKVITRALAAGHRPRSVLVQEQWLADVEPLLAEYPDVPVFVGDAAVLERLTGYHLHRGALAAMHRPVLPDPAGLLRDARRVVILEDIVDHTNVGAIFRSVAGLGADAVFVTPRCADPLYRRSVRVSMGTVLQVPWTRLPEWDAAEPLLHAAGFSIAALALADDAVTLDEFAADPPDRVAMVFGAEGDGLTRRALHAADTVVTIPMLHGVDSLNVASASAVALWALRARSQPAHR

Samples

Sample ID Description Type Environment
1 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
2 2643221572 Leifsonia sp. Root60 Isolate Unclassified
3 2643221616 Leifsonia sp. Root227 Isolate Unclassified
4 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
5 2643221649 Leifsonia sp. Root4 Isolate Unclassified
6 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
7 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
8 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
9 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
10 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
11 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
12 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
13 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
14 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
15 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
16 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
17 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
18 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
19 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
20 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
21 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
22 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
23 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
24 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
25 2928153084 Leifsonia sp. 563 Isolate Unclassified
26 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
27 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
28 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
29 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
30 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
31 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
32 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
33 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
34 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
35 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
36 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
37 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
38 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
39 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
40 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
67 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
70 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
86 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
87 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
88 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
89 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
90 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
91 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
92 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
93 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
94 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
95 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
96 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
97 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
98 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
99 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
100 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
101 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
102 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
103 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
104 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
105 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
106 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
107 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
108 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
109 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
110 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
111 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
112 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
113 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
128 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
131 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
132 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
133 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
134 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
135 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
136 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
137 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
138 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
139 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
140 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
141 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.01
Metatranscriptomes 1.12
Isolates 17.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.67
Nodule 0
Rhizoplane 3.35
Rhizosphere 56.98
Stem 0
Stem Tuber 0.56
Unclassified 18.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25164J39214_1000730 3300002772 Bacteria 12296
2 JGI25165J46597_1000330 3300003214 Bacteria 56543
3 Ga0055539_1000008 3300003752 Bacteria 537665
4 Ga0055533_1000001 3300003756 Bacteria 1863437
5 Ga0055525_1000197 3300003759 Bacteria 71227
6 Ga0055527_1000001 3300003760 Bacteria 850044
7 Ga0055542_1009990 3300003762 Bacteria 1761
8 Ga0055529_1000018 3300003763 Bacteria 344344
9 Ga0055541_1003061 3300003841 Bacteria 3209
10 Ga0070658_10005707 3300005327 Bacteria 10096
11 Ga0070682_100193730 3300005337 Bacteria 1429
12 Ga0070671_100575089 3300005355 Bacteria 973
13 Ga0070710_10048426 3300005437 Bacteria 2374
14 Ga0070663_100656030 3300005455 Bacteria 888
15 Ga0068853_100018390 3300005539 Bacteria 5784
16 Ga0068857_100087775 3300005577 Bacteria 2782
17 Ga0068857_100468557 3300005577 Bacteria 1179
18 Ga0068852_100086655 3300005616 Bacteria 2792
19 Ga0068851_10000061 3300005834 Bacteria 60738
20 Ga0075365_10237891 3300006038 Bacteria 1279
21 Ga0075369_10124895 3300006186 Bacteria 1167
22 Ga0105248_10012384 3300009177 Bacteria 9410
23 Ga0105237_10000386 3300009545 Bacteria 62773
24 Ga0105238_10022675 3300009551 Bacteria 6399
25 Ga0105249_10289940 3300009553 Bacteria 1638
26 Ga0157371_10002043 3300013102 Bacteria 19896
27 Ga0157371_10148046 3300013102 Bacteria 1674
28 Ga0157369_10002060 3300013105 Bacteria 24257
29 Ga0157369_10086586 3300013105 Bacteria 3346
30 Ga0157369_10126795 3300013105 Bacteria 2706
31 Ga0157369_10188222 3300013105 Bacteria 2170
32 Ga0157369_10328830 3300013105 Bacteria 1588
33 Ga0206356_10431859 3300020070 Bacteria 2509
34 Ga0206353_10709692 3300020082 Bacteria 10662
35 Ga0209566_100050 3300025225 Bacteria 234653
36 Ga0209674_100001 3300025226 Bacteria 4013750
37 Ga0209672_100006 3300025228 Bacteria 1004497
38 Ga0209147_100948 3300025229 Bacteria 12795
39 Ga0209563_100001 3300025230 Bacteria 4013775
40 Ga0209563_100706 3300025230 Bacteria 10448
41 Ga0207427_100052 3300025231 Bacteria 218228
42 Ga0209437_100574 3300025233 Bacteria 23823
43 Ga0209677_100001 3300025253 Bacteria 4013787
44 Ga0209677_102532 3300025253 Bacteria 6768
45 Ga0209148_1000015 3300025254 Bacteria 850103
46 Ga0209233_1000001 3300025261 Bacteria 2992747
47 Ga0209455_1000013 3300025272 Bacteria 850103
48 Ga0207656_10000012 3300025321 Bacteria 190545
49 Ga0207692_10037054 3300025898 Bacteria 2383
50 Ga0207647_10017587 3300025904 Bacteria 4858
51 Ga0207705_10022879 3300025909 Bacteria 4456
52 Ga0207705_10045042 3300025909 Bacteria 3171
53 Ga0207671_10000002 3300025914 Bacteria 1144816
54 Ga0207694_10000061 3300025924 Bacteria 141236
55 Ga0207711_10023697 3300025941 Bacteria 5140
56 Ga0207674_10001110 3300026116 Bacteria 34914
57 Ga0207698_10001793 3300026142 Bacteria 12530
58 Ga0307515_10151420 3300028794 Bacteria 2423
59 Ga0307515_10304601 3300028794 Bacteria 1275
60 Ga0307406_10054057 3300031901 Bacteria 2561
61 Ga0395899_0050934 3300037312 Bacteria 3073
62 Ga0395900_0005598 3300037418 Bacteria 13142
63 Ga0395898_0000131 3300037466 Bacteria 192369
64 Ga0395898_0690577 3300037466 Bacteria 963
65 Ga0451793_1004031 3300041452 Bacteria 1152
66 Ga0451806_688692 3300041462 Bacteria 2257
67 Ga0466972_0015856 3300044658 Bacteria 3767
68 Ga0466965_0007380 3300044683 Bacteria 5046
69 Ga0466965_0085575 3300044683 Bacteria 1598
70 Ga0466961_0028826 3300044693 Bacteria 3570
71 Ga0466968_0122326 3300044735 Bacteria 1178
72 Ga0466970_0030136 3300044765 Bacteria 2860
73 Ga0466970_0055864 3300044765 Bacteria 2109
74 Ga0466970_0084196 3300044765 Bacteria 1721
75 Ga0466970_0197895 3300044765 Bacteria 1117
76 Ga0466957_0059775 3300044842 Bacteria 2337
77 Ga0466960_0047885 3300044901 Bacteria 2052
78 Ga0466960_0106425 3300044901 Bacteria 1451
79 Ga0466959_0013035 3300045049 Bacteria 6020
80 Ga0495590_0004497 3300046457 Bacteria 5625
81 Ga0495650_0000850 3300046471 Bacteria 36701
82 Ga0495609_0144767 3300046538 Bacteria 1013
83 Ga0495672_0006031 3300047320 Bacteria 9474
84 Ga0495672_0035617 3300047320 Bacteria 3064
85 Ga0495626_0026193 3300048091 Bacteria 2845
86 Ga0496102_0122857 3300048905 Bacteria 2426
87 Ga0496104_0563893 3300048907 Bacteria 1049
88 Ga0496114_0020616 3300048917 Bacteria 5351
89 Ga0496115_0083810 3300048918 Bacteria 2598
90 Ga0496117_0001302 3300048920 Bacteria 36720
91 Ga0496117_0027744 3300048920 Bacteria 4401
92 Ga0496118_0001377 3300048921 Bacteria 36644
93 Ga0496118_0003671 3300048921 Bacteria 19046
94 Ga0496119_0003331 3300048922 Bacteria 16743
95 Ga0496119_0048536 3300048922 Bacteria 2632
96 Ga0496119_0059790 3300048922 Bacteria 2286
97 Ga0496119_0274832 3300048922 Bacteria 840
98 Ga0496120_0003199 3300048923 Bacteria 15227
99 Ga0496120_0031386 3300048923 Bacteria 3218
100 Ga0496120_0075614 3300048923 Bacteria 1838
101 Ga0496121_0000040 3300048924 Bacteria 348494
102 Ga0496122_0014653 3300048925 Bacteria 7562
103 Ga0496122_0036774 3300048925 Bacteria 3952
104 Ga0496123_0017304 3300048926 Bacteria 5808
105 Ga0496123_0038301 3300048926 Bacteria 3372
106 Ga0496124_0000037 3300048927 Bacteria 317430
107 Ga0496124_0006147 3300048927 Bacteria 13171
108 Ga0496126_0221081 3300048929 Bacteria 1591
109 Ga0501031_0001096 3300049568 Bacteria 16494
110 Ga0501033_0015992 3300049570 Bacteria 5683
111 Ga0501034_0066951 3300049571 Bacteria 3605
112 Ga0501034_0075881 3300049571 Bacteria 3368
113 Ga0501034_0088397 3300049571 Bacteria 3096
114 Ga0501034_0247250 3300049571 Bacteria 1728
115 Ga0501036_0003685 3300049572 Bacteria 12267
116 Ga0501037_0000658 3300049573 Bacteria 26510
117 Ga0501039_0000181 3300049575 Bacteria 44892
118 Ga0501039_0139243 3300049575 Bacteria 1906
119 Ga0501042_0000646 3300049578 Bacteria 18688
120 Ga0501043_0015133 3300049579 Bacteria 6036
121 Ga0501046_0000286 3300049580 Bacteria 51204
122 Ga0501048_0006746 3300049582 Bacteria 8721
123 Ga0501068_0080067 3300049584 Bacteria 2003
124 Ga0501070_0000300 3300049586 Bacteria 45950
125 Ga0501070_0015554 3300049586 Bacteria 6399
126 Ga0501073_0077049 3300049589 Bacteria 2320
127 Ga0501073_0123577 3300049589 Bacteria 1794
128 Ga0501080_0052204 3300049742 Bacteria 3805
129 Ga0501083_0000042 3300049744 Bacteria 92618
130 Ga0501035_0048398 3300049822 Bacteria 3813
131 Ga0501044_0004311 3300049823 Bacteria 15954
132 Ga0501045_0002633 3300049824 Bacteria 12231
133 nmdc:mga0yw44_138285_c1 3300050492 Bacteria 1581
134 Ga0500635_0000044 3300053080 Bacteria 87331
135 Ga0500651_0005138 3300053093 Bacteria 7447
136 Ga0500559_0002758 3300053136 Bacteria 8912
137 Ga0500568_0005602 3300053139 Bacteria 6465
138 Ga0500568_0006109 3300053139 Bacteria 6104
139 Ga0500573_0009539 3300053140 Bacteria 5389
140 Ga0500573_0012104 3300053140 Bacteria 4841
141 Ga0500573_0027610 3300053140 Bacteria 3265
142 Ga0500573_0047342 3300053140 Bacteria 2478
143 Ga0500577_0029978 3300053142 Bacteria 1889
144 Ga0500616_0000125 3300053153 Bacteria 135146
145 Ga0500620_000008 3300053155 Bacteria 52879
146 Ga0466962_0025856 3300061719 Bacteria 2817
147 Ga0466962_0130396 3300061719 Bacteria 1215

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048922 Ga0496119_0059790 Ga0496119_0059790_1396_2214 246
2 3300048922 Ga0496119_0274832 Ga0496119_0274832_23_823 248
3 3300048923 Ga0496120_0031386 Ga0496120_0031386_732_1532 248
4 3300013105 Ga0157369_10126795 Ga0157369_101267952 250
5 3300046471 Ga0495650_0000850 Ga0495650_0000850_8407_9207 250
6 3300005577 Ga0068857_100087775 Ga0068857_1000877751 251
7 3300005616 Ga0068852_100086655 Ga0068852_1000866551 251
8 3300005834 Ga0068851_10000061 Ga0068851_100000614 251
9 3300009545 Ga0105237_10000386 Ga0105237_1000038618 251
10 3300009551 Ga0105238_10022675 Ga0105238_100226753 251
11 3300025321 Ga0207656_10000012 Ga0207656_1000001281 251
12 3300025909 Ga0207705_10022879 Ga0207705_100228795 251
13 3300025914 Ga0207671_10000002 Ga0207671_10000002189 251
14 3300025924 Ga0207694_10000061 Ga0207694_10000061109 251
15 3300026116 Ga0207674_10001110 Ga0207674_100011101 251
16 3300026142 Ga0207698_10001793 Ga0207698_100017933 251
17 3300048924 Ga0496121_0000040 Ga0496121_0000040_124365_125192 255
18 3300013102 Ga0157371_10002043 Ga0157371_100020439 257
19 3300053136 Ga0500559_0002758 Ga0500559_0002758_2552_3355 261
20 3300005337 Ga0070682_100193730 Ga0070682_1001937301 262
21 3300044901 Ga0466960_0106425 Ga0466960_0106425_131_955 262
22 iso_pu_bacteria 2751185788 2753302128 262
23 iso_pu_bacteria 2857729791 2857732558 262
24 iso_pu_bacteria 2857737099 2857737416 262
25 iso_pu_bacteria 2904430863 2904432624 262
26 iso_pu_bacteria 2904501621 2904503082 262
27 iso_pu_bacteria 2908674828 2908675741 262
28 iso_pu_bacteria 2909074476 2909074793 262
29 iso_pu_bacteria 2919039151 2919040747 262
30 iso_pu_bacteria 2928104781 2928107910 262
31 iso_pu_bacteria 2928121344 2928122900 262
32 iso_pu_bacteria 2928500415 2928502420 262
33 iso_pu_bacteria 2585428094 2587862754 263
34 iso_pu_bacteria 2643221572 2643875283 263
35 iso_pu_bacteria 2643221616 2644096077 263
36 iso_pu_bacteria 2643221632 2644183565 263
37 iso_pu_bacteria 2643221649 2644279637 263
38 iso_pu_bacteria 2643221669 2644382339 263
39 iso_pu_bacteria 2808606306 2808631352 263
40 iso_pu_bacteria 2844841374 2844842494 263
41 iso_pu_bacteria 2862993130 2862996249 263
42 iso_pu_bacteria 2884763398 2884765442 263
43 iso_pu_bacteria 2895660088 2895661372 263
44 iso_pu_bacteria 2919055335 2919058179 263
45 iso_pu_bacteria 2919523602 2919524553 263
46 iso_pu_bacteria 2928153084 2928156524 263
47 iso_pu_bacteria 2939657138 2939657918 263
48 iso_pu_bacteria 2939660829 2939660998 263
49 iso_pu_bacteria 2964326757 2964329658 263
50 iso_pu_bacteria 2966921586 2966922727 263
51 iso_pu_bacteria 2995726249 2995728117 263
52 iso_pu_bacteria 8055034563 8055035874 263
53 3300005437 Ga0070710_10048426 Ga0070710_100484262 265
54 3300009553 Ga0105249_10289940 Ga0105249_102899402 265
55 3300025898 Ga0207692_10037054 Ga0207692_100370542 265
56 3300031901 Ga0307406_10054057 Ga0307406_100540572 265
57 3300003762 Ga0055542_1009990 Ga0055542_10099902 266
58 3300005355 Ga0070671_100575089 Ga0070671_1005750891 266
59 3300005539 Ga0068853_100018390 Ga0068853_1000183905 266
60 3300005577 Ga0068857_100468557 Ga0068857_1004685572 266
61 3300006038 Ga0075365_10237891 Ga0075365_102378912 266
62 3300009177 Ga0105248_10012384 Ga0105248_100123849 266
63 3300013102 Ga0157371_10148046 Ga0157371_101480461 266
64 3300013105 Ga0157369_10086586 Ga0157369_100865863 266
65 3300025941 Ga0207711_10023697 Ga0207711_100236972 266
66 3300028794 Ga0307515_10151420 Ga0307515_101514202 266
67 3300028794 Ga0307515_10304601 Ga0307515_103046011 266
68 3300041452 Ga0451793_1004031 Ga0451793_1004031_138_962 266
69 3300041462 Ga0451806_688692 Ga0451806_688692_1187_1987 266
70 3300044735 Ga0466968_0122326 Ga0466968_0122326_333_1151 266
71 3300044765 Ga0466970_0055864 Ga0466970_0055864_60_878 266
72 3300046457 Ga0495590_0004497 Ga0495590_0004497_4237_5037 266
73 3300046538 Ga0495609_0144767 Ga0495609_0144767_161_979 266
74 3300047320 Ga0495672_0006031 Ga0495672_0006031_403_1221 266
75 3300047320 Ga0495672_0035617 Ga0495672_0035617_910_1710 266
76 3300048091 Ga0495626_0026193 Ga0495626_0026193_1951_2769 266
77 3300048920 Ga0496117_0001302 Ga0496117_0001302_17657_18472 266
78 3300048921 Ga0496118_0001377 Ga0496118_0001377_18187_19002 266
79 3300048922 Ga0496119_0003331 Ga0496119_0003331_6422_7222 266
80 3300048922 Ga0496119_0048536 Ga0496119_0048536_1490_2308 266
81 3300048923 Ga0496120_0003199 Ga0496120_0003199_11955_12755 266
82 3300048923 Ga0496120_0075614 Ga0496120_0075614_422_1237 266
83 3300048925 Ga0496122_0014653 Ga0496122_0014653_5318_6121 266
84 3300048925 Ga0496122_0036774 Ga0496122_0036774_274_1089 266
85 3300048926 Ga0496123_0017304 Ga0496123_0017304_1614_2429 266
86 3300048926 Ga0496123_0038301 Ga0496123_0038301_2534_3337 266
87 3300048927 Ga0496124_0000037 Ga0496124_0000037_298571_299386 266
88 3300048927 Ga0496124_0006147 Ga0496124_0006147_6850_7668 266
89 3300049571 Ga0501034_0066951 Ga0501034_0066951_2053_2871 266
90 3300049571 Ga0501034_0075881 Ga0501034_0075881_1327_2148 266
91 3300049571 Ga0501034_0247250 Ga0501034_0247250_728_1531 266
92 3300049575 Ga0501039_0139243 Ga0501039_0139243_1047_1892 266
93 3300049589 Ga0501073_0077049 Ga0501073_0077049_386_1189 266
94 3300050492 nmdc:mga0yw44_138285_c1 nmdc:mga0yw44_138285_c1_279_1085 266
95 3300053093 Ga0500651_0005138 Ga0500651_0005138_5409_6209 266
96 3300053139 Ga0500568_0005602 Ga0500568_0005602_2716_3516 266
97 3300053139 Ga0500568_0006109 Ga0500568_0006109_1588_2421 266
98 3300053140 Ga0500573_0027610 Ga0500573_0027610_2034_2843 266
99 3300053140 Ga0500573_0047342 Ga0500573_0047342_1255_2064 266
100 3300053142 Ga0500577_0029978 Ga0500577_0029978_729_1541 266
101 3300053153 Ga0500616_0000125 Ga0500616_0000125_86241_87071 266
102 3300053155 Ga0500620_000008 Ga0500620_000008_14364_15164 266
103 iso_pu_bacteria 2852643534 2852645409 266
104 3300002772 JGI25164J39214_1000730 JGI25164J39214_10007306 267
105 3300003214 JGI25165J46597_1000330 JGI25165J46597_10003301 267
106 3300003752 Ga0055539_1000008 Ga0055539_1000008245 267
107 3300003756 Ga0055533_1000001 Ga0055533_1000001826 267
108 3300003759 Ga0055525_1000197 Ga0055525_100019768 267
109 3300003760 Ga0055527_1000001 Ga0055527_1000001292 267
110 3300003763 Ga0055529_1000018 Ga0055529_1000018204 267
111 3300003841 Ga0055541_1003061 Ga0055541_10030612 267
112 3300005327 Ga0070658_10005707 Ga0070658_1000570710 267
113 3300005455 Ga0070663_100656030 Ga0070663_1006560301 267
114 3300006186 Ga0075369_10124895 Ga0075369_101248951 267
115 3300013105 Ga0157369_10002060 Ga0157369_100020602 267
116 3300013105 Ga0157369_10188222 Ga0157369_101882222 267
117 3300013105 Ga0157369_10328830 Ga0157369_103288302 267
118 3300020070 Ga0206356_10431859 Ga0206356_104318593 267
119 3300020082 Ga0206353_10709692 Ga0206353_107096926 267
120 3300025225 Ga0209566_100050 Ga0209566_100050162 267
121 3300025226 Ga0209674_100001 Ga0209674_100001826 267
122 3300025228 Ga0209672_100006 Ga0209672_100006684 267
123 3300025229 Ga0209147_100948 Ga0209147_1009487 267
124 3300025230 Ga0209563_100001 Ga0209563_100001826 267
125 3300025230 Ga0209563_100706 Ga0209563_1007068 267
126 3300025231 Ga0207427_100052 Ga0207427_100052113 267
127 3300025233 Ga0209437_100574 Ga0209437_10057420 267
128 3300025253 Ga0209677_100001 Ga0209677_100001826 267
129 3300025253 Ga0209677_102532 Ga0209677_1025326 267
130 3300025254 Ga0209148_1000015 Ga0209148_1000015528 267
131 3300025261 Ga0209233_1000001 Ga0209233_10000012061 267
132 3300025272 Ga0209455_1000013 Ga0209455_1000013528 267
133 3300025904 Ga0207647_10017587 Ga0207647_100175875 267
134 3300025909 Ga0207705_10045042 Ga0207705_100450422 267
135 3300037312 Ga0395899_0050934 Ga0395899_0050934_565_1389 267
136 3300037418 Ga0395900_0005598 Ga0395900_0005598_1833_2675 267
137 3300037466 Ga0395898_0000131 Ga0395898_0000131_75438_76280 267
138 3300037466 Ga0395898_0690577 Ga0395898_0690577_61_885 267
139 3300044658 Ga0466972_0015856 Ga0466972_0015856_2700_3524 267
140 3300044683 Ga0466965_0007380 Ga0466965_0007380_1522_2346 267
141 3300044683 Ga0466965_0085575 Ga0466965_0085575_118_930 267
142 3300044693 Ga0466961_0028826 Ga0466961_0028826_670_1494 267
143 3300044765 Ga0466970_0030136 Ga0466970_0030136_559_1371 267
144 3300044765 Ga0466970_0084196 Ga0466970_0084196_579_1382 267
145 3300044765 Ga0466970_0197895 Ga0466970_0197895_191_1015 267
146 3300044842 Ga0466957_0059775 Ga0466957_0059775_95_919 267
147 3300044901 Ga0466960_0047885 Ga0466960_0047885_846_1658 267
148 3300045049 Ga0466959_0013035 Ga0466959_0013035_5019_5843 267
149 3300048905 Ga0496102_0122857 Ga0496102_0122857_1206_2030 267
150 3300048907 Ga0496104_0563893 Ga0496104_0563893_47_859 267
151 3300048917 Ga0496114_0020616 Ga0496114_0020616_1544_2350 267
152 3300048918 Ga0496115_0083810 Ga0496115_0083810_1251_2063 267
153 3300048920 Ga0496117_0027744 Ga0496117_0027744_3270_4094 267
154 3300048921 Ga0496118_0003671 Ga0496118_0003671_15873_16697 267
155 3300048929 Ga0496126_0221081 Ga0496126_0221081_688_1494 267
156 3300049568 Ga0501031_0001096 Ga0501031_0001096_8139_8942 267
157 3300049570 Ga0501033_0015992 Ga0501033_0015992_2324_3127 267
158 3300049571 Ga0501034_0088397 Ga0501034_0088397_14_817 267
159 3300049572 Ga0501036_0003685 Ga0501036_0003685_2858_3661 267
160 3300049573 Ga0501037_0000658 Ga0501037_0000658_8782_9585 267
161 3300049575 Ga0501039_0000181 Ga0501039_0000181_28588_29391 267
162 3300049578 Ga0501042_0000646 Ga0501042_0000646_2175_2999 267
163 3300049579 Ga0501043_0015133 Ga0501043_0015133_2549_3352 267
164 3300049580 Ga0501046_0000286 Ga0501046_0000286_12939_13742 267
165 3300049582 Ga0501048_0006746 Ga0501048_0006746_6706_7509 267
166 3300049584 Ga0501068_0080067 Ga0501068_0080067_880_1683 267
167 3300049586 Ga0501070_0000300 Ga0501070_0000300_10607_11416 267
168 3300049586 Ga0501070_0015554 Ga0501070_0015554_1868_2671 267
169 3300049589 Ga0501073_0123577 Ga0501073_0123577_677_1480 267
170 3300049742 Ga0501080_0052204 Ga0501080_0052204_1657_2460 267
171 3300049744 Ga0501083_0000042 Ga0501083_0000042_59809_60633 267
172 3300049822 Ga0501035_0048398 Ga0501035_0048398_2182_2991 267
173 3300049823 Ga0501044_0004311 Ga0501044_0004311_9374_10177 267
174 3300049824 Ga0501045_0002633 Ga0501045_0002633_1193_1996 267
175 3300053080 Ga0500635_0000044 Ga0500635_0000044_76905_77729 267
176 3300053140 Ga0500573_0009539 Ga0500573_0009539_3088_3951 267
177 3300053140 Ga0500573_0012104 Ga0500573_0012104_774_1604 267
178 3300061719 Ga0466962_0025856 Ga0466962_0025856_1253_2077 267
179 3300061719 Ga0466962_0130396 Ga0466962_0130396_232_1044 267

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00588

SpoU_methylase

SpoU rRNA Methylase family

135

279

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gz0-assembly4.cif.gz_E 23s ribosomal rna g2251 2'o-methyltransferase rlmb 0.8441 113 266
1v2x-assembly1.cif.gz_A-2 trmh 0.8392 112 267
5l0z-assembly1.cif.gz_B crystal structure of adomet bound rrna methyltransferase from sinorhizobium meliloti 0.8373 3 267
4fzi-assembly2.cif.gz_B crystal structure of prostaglandin f synthase from trypanosoma cruzi 0.8315 119 151
5l0z-assembly1.cif.gz_B crystal structure of adomet bound rrna methyltransferase from sinorhizobium meliloti 0.817 3 267
ID Description Score Start End Superfamily
af_P9WFY3_121_283_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9153 110 267 3.40.1280.10
af_P94978_97_258_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9036 109 267 3.40.1280.10
af_Q2FZE0_99_246_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8861 115 267 3.40.1280.10
af_P9WFY3_121_283_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8837 110 267 3.40.1280.10
af_P94978_97_258_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8828 109 267 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A3A5IZ75-F1-model_v4 deleted 0.9153 122 266
AF-A0A1E5KJP0-F1-model_v4 deleted 0.9089 1 265
AF-D1BRX5-F1-model_v4 tRNA/rRNA methyltransferase (SpoU) 0.9075 3 265 GO:0003723
GO:0006396
GO:0008173
GO:0032259
AF-A0A382QX96-F1-model_v4 tRNA/rRNA methyltransferase SpoU type domain-containing protein 0.9062 125 267 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A2G6G5L9-F1-model_v4 RNA methyltransferase 0.9061 120 265 GO:0003723
GO:0006396
GO:0008173
GO:0032259

Feature Viewer

pLDDT pTM Quality
89.27 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map