F273729

General Info

Members Datasets Scaffolds Average Seq Length
179 132 179 322

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10031153|Ga0105245_100311532
Length 347
Sequence MWFVGAPADLFEISATVTDRRYSKSMTTVIEPIRAIELNDITSARSRIADTIVRTPLLRLEVGSEFPEIWLKLENLQPINAYKLRGAANAVAMLSDADRKRGVWTVSAGNAGQGVAYAAKRAGVPCTVVAIETAPAAKLDRMRRLGAKLLPVSYDEAWRTLEQRAYPGAEGTFVHPFDDYNFIAGHGTMGLEILEDLPSVSAVIAAIGGGGLITGVGAAIKAVKPDTKVIGVEPETAAPAALSFRKGSPQVFTDWKASFVDGAGGQSVFPRMWERMKPVVDDYMVVSLDQTKQAMRMLAEKARVIAEGAGALSVAAALTGKAGKGPIVAVISGGNIDLEKFCQLVAS

Samples

Sample ID Description Type Environment
1 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
2 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
65 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
93 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
94 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
95 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
96 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
97 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
98 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
99 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
100 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
107 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
108 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
109 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
112 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
116 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
119 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
120 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
123 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
124 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
125 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
129 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
130 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
131 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
132 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.68
Rhizosphere 97.77
Stem 0
Stem Tuber 0
Unclassified 0.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1000152 3300000545 Bacteria 11875
2 Ga0065703_1021581 3300005272 Bacteria 1182
3 Ga0070676_10266666 3300005328 Unclassified 1148
4 Ga0070690_100202141 3300005330 Bacteria 1383
5 Ga0070670_100119659 3300005331 Bacteria 2271
6 Ga0070680_100116408 3300005336 Bacteria 2228
7 Ga0070660_100013501 3300005339 Bacteria 5861
8 Ga0070692_10003555 3300005345 Bacteria 6343
9 Ga0070668_100030614 3300005347 Unclassified 4092
10 Ga0070675_100113147 3300005354 Unclassified 2298
11 Ga0070671_100018445 3300005355 Bacteria 5668
12 Ga0070671_100023222 3300005355 Bacteria 5073
13 Ga0070674_100025255 3300005356 Unclassified 3866
14 Ga0070674_100113779 3300005356 Unclassified 1991
15 Ga0070673_100010933 3300005364 Bacteria 6173
16 Ga0070673_100072520 3300005364 Unclassified 2769
17 Ga0070688_100015564 3300005365 Unclassified 4332
18 Ga0070659_100001698 3300005366 Bacteria 15823
19 Ga0070667_100019160 3300005367 Bacteria 5674
20 Ga0070714_100022687 3300005435 Bacteria 5148
21 Ga0070701_10117144 3300005438 Unclassified 1496
22 Ga0070711_100103564 3300005439 Unclassified 2074
23 Ga0070694_100000350 3300005444 Bacteria 24736
24 Ga0070694_100216140 3300005444 Bacteria 1436
25 Ga0070708_100079623 3300005445 Bacteria 2964
26 Ga0070708_100081923 3300005445 Unclassified 2922
27 Ga0070662_100157483 3300005457 Unclassified 1774
28 Ga0070681_10026804 3300005458 Bacteria 5794
29 Ga0068867_100041343 3300005459 Unclassified 3369
30 Ga0070706_100005450 3300005467 Bacteria 12119
31 Ga0070706_100015275 3300005467 Bacteria 7088
32 Ga0070706_100075735 3300005467 Bacteria 3114
33 Ga0070707_100005026 3300005468 Bacteria 12394
34 Ga0070707_100035544 3300005468 Bacteria 4753
35 Ga0070707_100036786 3300005468 Bacteria 4672
36 Ga0070707_100097342 3300005468 Bacteria 2850
37 Ga0070707_100387401 3300005468 Unclassified 1357
38 Ga0070699_100350136 3300005518 Bacteria 1330
39 Ga0070679_100150527 3300005530 Bacteria 2304
40 Ga0070697_100000275 3300005536 Bacteria 41715
41 Ga0070697_100029367 3300005536 Bacteria 4407
42 Ga0070697_100030468 3300005536 Bacteria 4334
43 Ga0070697_100040013 3300005536 Bacteria 3791
44 Ga0070672_100034760 3300005543 Unclassified 3827
45 Ga0070672_100262956 3300005543 Unclassified 1455
46 Ga0070672_100408806 3300005543 Bacteria 1164
47 Ga0070695_100280202 3300005545 Bacteria 1224
48 Ga0070695_100349271 3300005545 Bacteria 1108
49 Ga0070696_100217999 3300005546 Bacteria 1431
50 Ga0070704_100001324 3300005549 Bacteria 13118
51 Ga0068855_100064379 3300005563 Bacteria 4276
52 Ga0070664_100170319 3300005564 Bacteria 1931
53 Ga0068857_100354097 3300005577 Bacteria 1360
54 Ga0068859_100203850 3300005617 Bacteria 2063
55 Ga0068864_100193458 3300005618 Unclassified 1865
56 Ga0068870_10197921 3300005840 Bacteria 1217
57 Ga0068863_100477390 3300005841 Unclassified 1226
58 Ga0081540_1000991 3300005983 Bacteria 25575
59 Ga0081540_1001558 3300005983 Bacteria 19640
60 Ga0070712_100000266 3300006175 Bacteria 29294
61 Ga0070712_100256831 3300006175 Unclassified 1399
62 Ga0097621_100201338 3300006237 Unclassified 1729
63 Ga0068871_100067919 3300006358 Unclassified 2926
64 Ga0075428_100060700 3300006844 Bacteria 4141
65 Ga0075431_100079683 3300006847 Bacteria 3381
66 Ga0075431_100159337 3300006847 Bacteria 2321
67 Ga0075433_10034835 3300006852 Unclassified 4327
68 Ga0075434_100208680 3300006871 Unclassified 1974
69 Ga0075436_100038385 3300006914 Bacteria 3306
70 Ga0075436_100155799 3300006914 Unclassified 1609
71 Ga0097620_100203840 3300006931 Bacteria 2063
72 Ga0105240_10076373 3300009093 Bacteria 4130
73 Ga0111539_10002767 3300009094 Bacteria 23272
74 Ga0105245_10031153 3300009098 Bacteria 4718
75 Ga0114129_10021776 3300009147 Bacteria 9098
76 Ga0105239_10693351 3300010375 Unclassified 1164
77 Ga0105246_10001684 3300011119 Bacteria 13174
78 Ga0157371_10149956 3300013102 Bacteria 1663
79 Ga0157374_10011484 3300013296 Bacteria 7673
80 Ga0157374_10031970 3300013296 Unclassified 4788
81 Ga0157378_10047184 3300013297 Bacteria 3829
82 Ga0157378_10411535 3300013297 Unclassified 1335
83 Ga0163162_10014871 3300013306 Bacteria 7600
84 Ga0163163_10175626 3300014325 Bacteria 2189
85 Ga0157379_10280525 3300014968 Bacteria 1516
86 Ga0157376_10029775 3300014969 Bacteria 4352
87 Ga0157376_10031655 3300014969 Bacteria 4239
88 Ga0213871_10005885 3300021441 Bacteria 2563
89 Ga0207697_10005542 3300025315 Bacteria 5852
90 Ga0207680_10282072 3300025903 Bacteria 1154
91 Ga0207645_10005049 3300025907 Bacteria 9668
92 Ga0207684_10004512 3300025910 Bacteria 13084
93 Ga0207684_10100275 3300025910 Unclassified 2474
94 Ga0207693_10000169 3300025915 Bacteria 58960
95 Ga0207693_10120786 3300025915 Bacteria 2058
96 Ga0207660_10135055 3300025917 Bacteria 1881
97 Ga0207652_10062623 3300025921 Bacteria 3215
98 Ga0207646_10002252 3300025922 Bacteria 22955
99 Ga0207646_10026434 3300025922 Bacteria 5295
100 Ga0207646_10134988 3300025922 Bacteria 2222
101 Ga0207646_10183219 3300025922 Unclassified 1891
102 Ga0207646_10313019 3300025922 Bacteria 1418
103 Ga0207681_10263792 3300025923 Unclassified 1349
104 Ga0207650_10087351 3300025925 Unclassified 2376
105 Ga0207659_10178551 3300025926 Unclassified 1680
106 Ga0207700_10225372 3300025928 Bacteria 1591
107 Ga0207664_10023621 3300025929 Bacteria 4610
108 Ga0207644_10042102 3300025931 Bacteria 3235
109 Ga0207644_10158116 3300025931 Bacteria 1759
110 Ga0207690_10009305 3300025932 Bacteria 5836
111 Ga0207706_10150554 3300025933 Unclassified 2046
112 Ga0207706_10261915 3300025933 Unclassified 1509
113 Ga0207670_10138508 3300025936 Unclassified 1792
114 Ga0207669_10014837 3300025937 Unclassified 3916
115 Ga0207669_10078534 3300025937 Unclassified 2103
116 Ga0207691_10096419 3300025940 Unclassified 2644
117 Ga0207651_10014834 3300025960 Unclassified 4511
118 Ga0207712_10275345 3300025961 Unclassified 1371
119 Ga0207668_10250355 3300025972 Unclassified 1438
120 Ga0207658_10041085 3300025986 Unclassified 3347
121 Ga0207675_100337025 3300026118 Bacteria 1476
122 Ga0207675_100497816 3300026118 Unclassified 1213
123 Ga0265356_1003466 3300028017 Bacteria 1991
124 Ga0268266_10087862 3300028379 Unclassified 2720
125 Ga0265338_10002571 3300028800 Bacteria 26831
126 Ga0265324_10002563 3300029957 Bacteria 9179
127 Ga0265325_10112006 3300031241 Unclassified 1325
128 Ga0265340_10000063 3300031247 Bacteria 49803
129 Ga0265340_10008184 3300031247 Bacteria 5654
130 Ga0265331_10073789 3300031250 Bacteria 1593
131 Ga0307513_10021244 3300031456 Bacteria 7667
132 Ga0265314_10006475 3300031711 Bacteria 10357
133 Ga0265314_10081542 3300031711 Bacteria 2131
134 Ga0265342_10156413 3300031712 Bacteria 1262
135 Ga0373945_0163163 3300035116 Unclassified 909
136 Ga0373943_0173378 3300035170 Unclassified 1181
137 Ga0373931_0017592 3300035691 Bacteria 3540
138 Ga0373935_0014067 3300035692 Bacteria 4833
139 Ga0373935_0071185 3300035692 Bacteria 2243
140 Ga0373947_0186641 3300035725 Bacteria 1352
141 Ga0373937_0369832 3300036401 Bacteria 1359
142 Ga0373925_0056250 3300037068 Bacteria 2947
143 Ga0373925_0242148 3300037068 Archaea 1445
144 Ga0436360_0155932 3300039438 Bacteria 2859
145 Ga0436361_1222665 3300039447 Bacteria 32450
146 Ga0436362_0554630 3300039453 Bacteria 2248
147 Ga0495592_0030284 3300046454 Unclassified 4094
148 Ga0495629_0000167 3300046459 Bacteria 58031
149 Ga0495582_0005840 3300046473 Bacteria 6857
150 Ga0495594_0001946 3300046499 Bacteria 10770
151 Ga0495628_0022445 3300046516 Bacteria 5184
152 Ga0495630_0048371 3300046517 Unclassified 3182
153 Ga0495586_0097883 3300046535 Bacteria 1626
154 Ga0495634_0046185 3300046642 Unclassified 2940
155 Ga0495635_0000149 3300046663 Bacteria 42612
156 Ga0495647_0001163 3300046681 Bacteria 8091
157 Ga0495647_0003491 3300046681 Bacteria 5030
158 Ga0495658_0000003 3300046683 Bacteria 224090
159 Ga0495658_0033749 3300046683 Unclassified 2805
160 Ga0495658_0043144 3300046683 Unclassified 2521
161 Ga0495658_0071452 3300046683 Bacteria 2016
162 Ga0495669_0041253 3300046684 Bacteria 2049
163 Ga0495613_0001329 3300046689 Bacteria 18883
164 Ga0495613_0258846 3300046689 Bacteria 1213
165 Ga0495581_0000148 3300047315 Bacteria 30986
166 Ga0495674_0023452 3300047319 Bacteria 5686
167 Ga0495676_0110216 3300047321 Unclassified 2021
168 Ga0495680_0007938 3300047322 Bacteria 9682
169 Ga0495680_0018468 3300047322 Bacteria 5919
170 Ga0496108_0068250 3300048911 Bacteria 3000
171 Ga0496108_0216347 3300048911 Unclassified 1664
172 Ga0496112_0139493 3300048915 Unclassified 2394
173 nmdc:mga08y16_243382_c1 3300050511 Bacteria 1859
174 nmdc:mga0n895_200912_c1 3300050512 Unclassified 2024
175 nmdc:mga08x19_32132_c1 3300050514 Bacteria 3306
176 nmdc:mga08x19_419748_c1 3300050514 Bacteria 940
177 nmdc:mga08x19_63803_c1 3300050514 Unclassified 2390
178 nmdc:mga0a205_4607_c2 3300050515 Bacteria 11669
179 Ga0495619_0002376 3300053085 Bacteria 12370

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035116 Ga0373945_0163163 Ga0373945_0163163_33_872 279
2 3300046454 Ga0495592_0030284 Ga0495592_0030284_3239_4078 279
3 3300050514 nmdc:mga08x19_419748_c1 nmdc:mga08x19_419748_c1_40_900 286
4 3300025922 Ga0207646_10313019 Ga0207646_103130191 291
5 3300039453 Ga0436362_0554630 Ga0436362_0554630_1354_2232 292
6 3300005444 Ga0070694_100216140 Ga0070694_1002161402 302
7 3300005549 Ga0070704_100001324 Ga0070704_10000132412 302
8 3300046459 Ga0495629_0000167 Ga0495629_0000167_7152_8114 312
9 3300046473 Ga0495582_0005840 Ga0495582_0005840_3854_4816 312
10 3300046681 Ga0495647_0001163 Ga0495647_0001163_4577_5539 312
11 3300046683 Ga0495658_0000003 Ga0495658_0000003_215067_216029 312
12 3300046689 Ga0495613_0001329 Ga0495613_0001329_12029_12991 312
13 3300047315 Ga0495581_0000148 Ga0495581_0000148_22849_23811 312
14 3300047322 Ga0495680_0007938 Ga0495680_0007938_2771_3733 312
15 3300053085 Ga0495619_0002376 Ga0495619_0002376_1504_2466 312
16 3300031456 Ga0307513_10021244 Ga0307513_100212444 314
17 3300005468 Ga0070707_100387401 Ga0070707_1003874011 315
18 3300036401 Ga0373937_0369832 Ga0373937_0369832_54_1004 316
19 3300046499 Ga0495594_0001946 Ga0495594_0001946_9528_10478 316
20 3300039438 Ga0436360_0155932 Ga0436360_0155932_1820_2773 317
21 3300039447 Ga0436361_1222665 Ga0436361_1222665_30158_31111 317
22 3300005339 Ga0070660_100013501 Ga0070660_1000135013 319
23 3300005366 Ga0070659_100001698 Ga0070659_1000016981 319
24 3300025932 Ga0207690_10009305 Ga0207690_100093055 319
25 3300005272 Ga0065703_1021581 Ga0065703_10215811 320
26 3300005330 Ga0070690_100202141 Ga0070690_1002021412 320
27 3300005347 Ga0070668_100030614 Ga0070668_1000306142 320
28 3300005354 Ga0070675_100113147 Ga0070675_1001131473 320
29 3300005355 Ga0070671_100018445 Ga0070671_1000184453 320
30 3300005356 Ga0070674_100025255 Ga0070674_1000252554 320
31 3300005364 Ga0070673_100072520 Ga0070673_1000725203 320
32 3300005365 Ga0070688_100015564 Ga0070688_1000155643 320
33 3300005367 Ga0070667_100019160 Ga0070667_1000191605 320
34 3300005459 Ga0068867_100041343 Ga0068867_1000413431 320
35 3300005543 Ga0070672_100034760 Ga0070672_1000347602 320
36 3300005564 Ga0070664_100170319 Ga0070664_1001703192 320
37 3300006844 Ga0075428_100060700 Ga0075428_1000607003 320
38 3300006871 Ga0075434_100208680 Ga0075434_1002086801 320
39 3300006914 Ga0075436_100155799 Ga0075436_1001557991 320
40 3300013296 Ga0157374_10011484 Ga0157374_100114844 320
41 3300013297 Ga0157378_10411535 Ga0157378_104115352 320
42 3300013306 Ga0163162_10014871 Ga0163162_100148719 320
43 3300025315 Ga0207697_10005542 Ga0207697_100055425 320
44 3300025903 Ga0207680_10282072 Ga0207680_102820721 320
45 3300025907 Ga0207645_10005049 Ga0207645_1000504910 320
46 3300025925 Ga0207650_10087351 Ga0207650_100873513 320
47 3300025926 Ga0207659_10178551 Ga0207659_101785512 320
48 3300025931 Ga0207644_10158116 Ga0207644_101581161 320
49 3300025933 Ga0207706_10150554 Ga0207706_101505542 320
50 3300025936 Ga0207670_10138508 Ga0207670_101385083 320
51 3300025937 Ga0207669_10078534 Ga0207669_100785343 320
52 3300025960 Ga0207651_10014834 Ga0207651_100148345 320
53 3300025972 Ga0207668_10250355 Ga0207668_102503552 320
54 3300025986 Ga0207658_10041085 Ga0207658_100410853 320
55 3300028379 Ga0268266_10087862 Ga0268266_100878623 320
56 3300046663 Ga0495635_0000149 Ga0495635_0000149_2167_3129 320
57 3300048911 Ga0496108_0216347 Ga0496108_0216347_475_1440 320
58 3300048915 Ga0496112_0139493 Ga0496112_0139493_61_1026 320
59 3300050512 nmdc:mga0n895_200912_c1 nmdc:mga0n895_200912_c1_248_1210 320
60 3300050514 nmdc:mga08x19_63803_c1 nmdc:mga08x19_63803_c1_660_1622 320
61 3300046535 Ga0495586_0097883 Ga0495586_0097883_474_1481 321
62 3300005328 Ga0070676_10266666 Ga0070676_102666661 322
63 3300005331 Ga0070670_100119659 Ga0070670_1001196592 322
64 3300005345 Ga0070692_10003555 Ga0070692_100035556 322
65 3300005356 Ga0070674_100113779 Ga0070674_1001137792 322
66 3300005364 Ga0070673_100010933 Ga0070673_1000109332 322
67 3300005439 Ga0070711_100103564 Ga0070711_1001035642 322
68 3300005444 Ga0070694_100000350 Ga0070694_1000003505 322
69 3300005445 Ga0070708_100081923 Ga0070708_1000819232 322
70 3300005457 Ga0070662_100157483 Ga0070662_1001574832 322
71 3300005467 Ga0070706_100075735 Ga0070706_1000757351 322
72 3300005468 Ga0070707_100036786 Ga0070707_1000367863 322
73 3300005518 Ga0070699_100350136 Ga0070699_1003501362 322
74 3300005543 Ga0070672_100262956 Ga0070672_1002629562 322
75 3300005543 Ga0070672_100408806 Ga0070672_1004088062 322
76 3300005545 Ga0070695_100349271 Ga0070695_1003492711 322
77 3300005546 Ga0070696_100217999 Ga0070696_1002179991 322
78 3300005841 Ga0068863_100477390 Ga0068863_1004773901 322
79 3300006175 Ga0070712_100000266 Ga0070712_10000026614 322
80 3300006237 Ga0097621_100201338 Ga0097621_1002013381 322
81 3300006358 Ga0068871_100067919 Ga0068871_1000679192 322
82 3300006847 Ga0075431_100159337 Ga0075431_1001593372 322
83 3300009098 Ga0105245_10031153 Ga0105245_100311532 322
84 3300009147 Ga0114129_10021776 Ga0114129_100217767 322
85 3300010375 Ga0105239_10693351 Ga0105239_106933511 322
86 3300013296 Ga0157374_10031970 Ga0157374_100319706 322
87 3300013297 Ga0157378_10047184 Ga0157378_100471844 322
88 3300014968 Ga0157379_10280525 Ga0157379_102805252 322
89 3300014969 Ga0157376_10029775 Ga0157376_100297752 322
90 3300025910 Ga0207684_10100275 Ga0207684_101002752 322
91 3300025915 Ga0207693_10000169 Ga0207693_1000016956 322
92 3300025922 Ga0207646_10134988 Ga0207646_101349883 322
93 3300025923 Ga0207681_10263792 Ga0207681_102637922 322
94 3300025928 Ga0207700_10225372 Ga0207700_102253722 322
95 3300025933 Ga0207706_10261915 Ga0207706_102619151 322
96 3300025937 Ga0207669_10014837 Ga0207669_100148372 322
97 3300025940 Ga0207691_10096419 Ga0207691_100964192 322
98 3300026118 Ga0207675_100497816 Ga0207675_1004978161 322
99 3300028017 Ga0265356_1003466 Ga0265356_10034662 322
100 3300031247 Ga0265340_10000063 Ga0265340_1000006342 322
101 3300031247 Ga0265340_10008184 Ga0265340_100081843 322
102 3300031250 Ga0265331_10073789 Ga0265331_100737892 322
103 3300031711 Ga0265314_10081542 Ga0265314_100815423 322
104 3300031712 Ga0265342_10156413 Ga0265342_101564132 322
105 3300035692 Ga0373935_0014067 Ga0373935_0014067_2044_3012 322
106 3300037068 Ga0373925_0056250 Ga0373925_0056250_625_1593 322
107 3300046684 Ga0495669_0041253 Ga0495669_0041253_747_1715 322
108 3300048911 Ga0496108_0068250 Ga0496108_0068250_111_1079 322
109 3300050511 nmdc:mga08y16_243382_c1 nmdc:mga08y16_243382_c1_253_1230 322
110 3300005435 Ga0070714_100022687 Ga0070714_1000226874 323
111 3300006852 Ga0075433_10034835 Ga0075433_100348355 323
112 3300021441 Ga0213871_10005885 Ga0213871_100058852 323
113 3300025929 Ga0207664_10023621 Ga0207664_100236215 323
114 3300046517 Ga0495630_0048371 Ga0495630_0048371_46_1017 323
115 3300046642 Ga0495634_0046185 Ga0495634_0046185_70_1041 323
116 3300046681 Ga0495647_0003491 Ga0495647_0003491_3732_4703 323
117 3300046683 Ga0495658_0033749 Ga0495658_0033749_653_1624 323
118 3300047319 Ga0495674_0023452 Ga0495674_0023452_2092_3063 323
119 3300047321 Ga0495676_0110216 Ga0495676_0110216_688_1659 323
120 3300047322 Ga0495680_0018468 Ga0495680_0018468_1432_2403 323
121 3300050515 nmdc:mga0a205_4607_c2 nmdc:mga0a205_4607_c2_9013_9984 323
122 3300005438 Ga0070701_10117144 Ga0070701_101171442 324
123 3300005468 Ga0070707_100005026 Ga0070707_10000502611 324
124 3300005545 Ga0070695_100280202 Ga0070695_1002802022 324
125 3300005577 Ga0068857_100354097 Ga0068857_1003540971 324
126 3300005617 Ga0068859_100203850 Ga0068859_1002038502 324
127 3300005618 Ga0068864_100193458 Ga0068864_1001934581 324
128 3300005840 Ga0068870_10197921 Ga0068870_101979211 324
129 3300006931 Ga0097620_100203840 Ga0097620_1002038402 324
130 3300009094 Ga0111539_10002767 Ga0111539_100027676 324
131 3300011119 Ga0105246_10001684 Ga0105246_100016845 324
132 3300013102 Ga0157371_10149956 Ga0157371_101499562 324
133 3300014325 Ga0163163_10175626 Ga0163163_101756262 324
134 3300025922 Ga0207646_10002252 Ga0207646_1000225211 324
135 3300025961 Ga0207712_10275345 Ga0207712_102753451 324
136 3300026118 Ga0207675_100337025 Ga0207675_1003370251 324
137 3300035170 Ga0373943_0173378 Ga0373943_0173378_11_985 324
138 3300035692 Ga0373935_0071185 Ga0373935_0071185_858_1835 324
139 3300035725 Ga0373947_0186641 Ga0373947_0186641_196_1173 324
140 3300046683 Ga0495658_0043144 Ga0495658_0043144_1144_2121 324
141 3300046689 Ga0495613_0258846 Ga0495613_0258846_78_1052 324
142 3300000545 CNXas_1000152 CNXas_100015210 325
143 3300005336 Ga0070680_100116408 Ga0070680_1001164083 325
144 3300005355 Ga0070671_100023222 Ga0070671_1000232223 325
145 3300005445 Ga0070708_100079623 Ga0070708_1000796232 325
146 3300005458 Ga0070681_10026804 Ga0070681_100268043 325
147 3300005467 Ga0070706_100005450 Ga0070706_10000545010 325
148 3300005467 Ga0070706_100015275 Ga0070706_1000152753 325
149 3300005468 Ga0070707_100035544 Ga0070707_1000355445 325
150 3300005468 Ga0070707_100097342 Ga0070707_1000973422 325
151 3300005530 Ga0070679_100150527 Ga0070679_1001505273 325
152 3300005536 Ga0070697_100000275 Ga0070697_1000002754 325
153 3300005536 Ga0070697_100029367 Ga0070697_1000293674 325
154 3300005536 Ga0070697_100030468 Ga0070697_1000304681 325
155 3300005536 Ga0070697_100040013 Ga0070697_1000400133 325
156 3300005563 Ga0068855_100064379 Ga0068855_1000643792 325
157 3300005983 Ga0081540_1000991 Ga0081540_100099118 325
158 3300005983 Ga0081540_1001558 Ga0081540_10015584 325
159 3300006175 Ga0070712_100256831 Ga0070712_1002568312 325
160 3300006847 Ga0075431_100079683 Ga0075431_1000796833 325
161 3300006914 Ga0075436_100038385 Ga0075436_1000383853 325
162 3300009093 Ga0105240_10076373 Ga0105240_100763732 325
163 3300014969 Ga0157376_10031655 Ga0157376_100316553 325
164 3300025910 Ga0207684_10004512 Ga0207684_100045129 325
165 3300025915 Ga0207693_10120786 Ga0207693_101207861 325
166 3300025917 Ga0207660_10135055 Ga0207660_101350552 325
167 3300025921 Ga0207652_10062623 Ga0207652_100626232 325
168 3300025922 Ga0207646_10026434 Ga0207646_100264343 325
169 3300025922 Ga0207646_10183219 Ga0207646_101832192 325
170 3300025931 Ga0207644_10042102 Ga0207644_100421022 325
171 3300028800 Ga0265338_10002571 Ga0265338_100025712 325
172 3300029957 Ga0265324_10002563 Ga0265324_100025636 325
173 3300031241 Ga0265325_10112006 Ga0265325_101120062 325
174 3300031711 Ga0265314_10006475 Ga0265314_100064759 325
175 3300035691 Ga0373931_0017592 Ga0373931_0017592_360_1337 325
176 3300037068 Ga0373925_0242148 Ga0373925_0242148_413_1390 325
177 3300046516 Ga0495628_0022445 Ga0495628_0022445_1389_2366 325
178 3300046683 Ga0495658_0071452 Ga0495658_0071452_144_1121 325
179 3300050514 nmdc:mga08x19_32132_c1 nmdc:mga08x19_32132_c1_1589_2596 325

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00291

PALP

Pyridoxal-phosphate dependent enzyme

48

333

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zpu-assembly1.cif.gz_A crystal structure of modified serine racemase from s.pombe. 0.9041 8 322
2gn2-assembly1.cif.gz_A crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) 0.9007 5 324
2zpu-assembly1.cif.gz_A crystal structure of modified serine racemase from s.pombe. 0.8905 8 322
1ve5-assembly1.cif.gz_A crystal structure of t.th. hb8 threonine deaminase 0.8879 12 312
1ve5-assembly1.cif.gz_B crystal structure of t.th. hb8 threonine deaminase 0.8878 12 312
ID Description Score Start End Superfamily
1wtcA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.909 14 322 3.40.50.1100
5d86A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8984 56 128 3.40.50.1100
1ve5C01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8893 12 309 3.40.50.1100
3hmkA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8871 7 314 3.40.50.1100
1wtcA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8856 14 322 3.40.50.1100
ID Description Score Start End GO Terms
AF-A0A534GBF2-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.9868 1 274 GO:0003941
GO:0004794
GO:0006565
GO:0006567
GO:0009097
AF-A0A534ELY7-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.9839 1 325 GO:0003941
GO:0004794
GO:0006565
GO:0006567
GO:0009097
AF-A0A534GBF2-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.9833 1 274 GO:0003941
GO:0004794
GO:0006565
GO:0006567
GO:0009097
AF-A0A534ELY7-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.9809 1 325 GO:0003941
GO:0004794
GO:0006565
GO:0006567
GO:0009097
AF-A0A1H7BG75-F1-model_v4 Threonine dehydratase 0.9757 16 322 GO:0003941
GO:0004794
GO:0006565
GO:0006567
GO:0009097

Feature Viewer

pLDDT pTM Quality
91.49 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map