F273729
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 179 | 132 | 179 | 322 |
Family's Representative Sequence
| Representative Sequence | 3300009098|Ga0105245_10031153|Ga0105245_100311532 |
| Length | 347 |
| Sequence | MWFVGAPADLFEISATVTDRRYSKSMTTVIEPIRAIELNDITSARSRIADTIVRTPLLRLEVGSEFPEIWLKLENLQPINAYKLRGAANAVAMLSDADRKRGVWTVSAGNAGQGVAYAAKRAGVPCTVVAIETAPAAKLDRMRRLGAKLLPVSYDEAWRTLEQRAYPGAEGTFVHPFDDYNFIAGHGTMGLEILEDLPSVSAVIAAIGGGGLITGVGAAIKAVKPDTKVIGVEPETAAPAALSFRKGSPQVFTDWKASFVDGAGGQSVFPRMWERMKPVVDDYMVVSLDQTKQAMRMLAEKARVIAEGAGALSVAAALTGKAGKGPIVAVISGGNIDLEKFCQLVAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 42 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 45 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 46 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 47 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 48 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 49 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 50 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 65 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 90 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 92 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 93 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 94 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 95 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 96 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 97 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 98 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 99 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 100 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 101 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 102 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 103 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 104 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 105 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 106 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 107 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 108 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 109 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 127 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 128 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 129 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 130 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 131 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 132 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.68 |
| Rhizosphere | 97.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNXas_1000152 | 3300000545 | Bacteria | 11875 |
| 2 | Ga0065703_1021581 | 3300005272 | Bacteria | 1182 |
| 3 | Ga0070676_10266666 | 3300005328 | Unclassified | 1148 |
| 4 | Ga0070690_100202141 | 3300005330 | Bacteria | 1383 |
| 5 | Ga0070670_100119659 | 3300005331 | Bacteria | 2271 |
| 6 | Ga0070680_100116408 | 3300005336 | Bacteria | 2228 |
| 7 | Ga0070660_100013501 | 3300005339 | Bacteria | 5861 |
| 8 | Ga0070692_10003555 | 3300005345 | Bacteria | 6343 |
| 9 | Ga0070668_100030614 | 3300005347 | Unclassified | 4092 |
| 10 | Ga0070675_100113147 | 3300005354 | Unclassified | 2298 |
| 11 | Ga0070671_100018445 | 3300005355 | Bacteria | 5668 |
| 12 | Ga0070671_100023222 | 3300005355 | Bacteria | 5073 |
| 13 | Ga0070674_100025255 | 3300005356 | Unclassified | 3866 |
| 14 | Ga0070674_100113779 | 3300005356 | Unclassified | 1991 |
| 15 | Ga0070673_100010933 | 3300005364 | Bacteria | 6173 |
| 16 | Ga0070673_100072520 | 3300005364 | Unclassified | 2769 |
| 17 | Ga0070688_100015564 | 3300005365 | Unclassified | 4332 |
| 18 | Ga0070659_100001698 | 3300005366 | Bacteria | 15823 |
| 19 | Ga0070667_100019160 | 3300005367 | Bacteria | 5674 |
| 20 | Ga0070714_100022687 | 3300005435 | Bacteria | 5148 |
| 21 | Ga0070701_10117144 | 3300005438 | Unclassified | 1496 |
| 22 | Ga0070711_100103564 | 3300005439 | Unclassified | 2074 |
| 23 | Ga0070694_100000350 | 3300005444 | Bacteria | 24736 |
| 24 | Ga0070694_100216140 | 3300005444 | Bacteria | 1436 |
| 25 | Ga0070708_100079623 | 3300005445 | Bacteria | 2964 |
| 26 | Ga0070708_100081923 | 3300005445 | Unclassified | 2922 |
| 27 | Ga0070662_100157483 | 3300005457 | Unclassified | 1774 |
| 28 | Ga0070681_10026804 | 3300005458 | Bacteria | 5794 |
| 29 | Ga0068867_100041343 | 3300005459 | Unclassified | 3369 |
| 30 | Ga0070706_100005450 | 3300005467 | Bacteria | 12119 |
| 31 | Ga0070706_100015275 | 3300005467 | Bacteria | 7088 |
| 32 | Ga0070706_100075735 | 3300005467 | Bacteria | 3114 |
| 33 | Ga0070707_100005026 | 3300005468 | Bacteria | 12394 |
| 34 | Ga0070707_100035544 | 3300005468 | Bacteria | 4753 |
| 35 | Ga0070707_100036786 | 3300005468 | Bacteria | 4672 |
| 36 | Ga0070707_100097342 | 3300005468 | Bacteria | 2850 |
| 37 | Ga0070707_100387401 | 3300005468 | Unclassified | 1357 |
| 38 | Ga0070699_100350136 | 3300005518 | Bacteria | 1330 |
| 39 | Ga0070679_100150527 | 3300005530 | Bacteria | 2304 |
| 40 | Ga0070697_100000275 | 3300005536 | Bacteria | 41715 |
| 41 | Ga0070697_100029367 | 3300005536 | Bacteria | 4407 |
| 42 | Ga0070697_100030468 | 3300005536 | Bacteria | 4334 |
| 43 | Ga0070697_100040013 | 3300005536 | Bacteria | 3791 |
| 44 | Ga0070672_100034760 | 3300005543 | Unclassified | 3827 |
| 45 | Ga0070672_100262956 | 3300005543 | Unclassified | 1455 |
| 46 | Ga0070672_100408806 | 3300005543 | Bacteria | 1164 |
| 47 | Ga0070695_100280202 | 3300005545 | Bacteria | 1224 |
| 48 | Ga0070695_100349271 | 3300005545 | Bacteria | 1108 |
| 49 | Ga0070696_100217999 | 3300005546 | Bacteria | 1431 |
| 50 | Ga0070704_100001324 | 3300005549 | Bacteria | 13118 |
| 51 | Ga0068855_100064379 | 3300005563 | Bacteria | 4276 |
| 52 | Ga0070664_100170319 | 3300005564 | Bacteria | 1931 |
| 53 | Ga0068857_100354097 | 3300005577 | Bacteria | 1360 |
| 54 | Ga0068859_100203850 | 3300005617 | Bacteria | 2063 |
| 55 | Ga0068864_100193458 | 3300005618 | Unclassified | 1865 |
| 56 | Ga0068870_10197921 | 3300005840 | Bacteria | 1217 |
| 57 | Ga0068863_100477390 | 3300005841 | Unclassified | 1226 |
| 58 | Ga0081540_1000991 | 3300005983 | Bacteria | 25575 |
| 59 | Ga0081540_1001558 | 3300005983 | Bacteria | 19640 |
| 60 | Ga0070712_100000266 | 3300006175 | Bacteria | 29294 |
| 61 | Ga0070712_100256831 | 3300006175 | Unclassified | 1399 |
| 62 | Ga0097621_100201338 | 3300006237 | Unclassified | 1729 |
| 63 | Ga0068871_100067919 | 3300006358 | Unclassified | 2926 |
| 64 | Ga0075428_100060700 | 3300006844 | Bacteria | 4141 |
| 65 | Ga0075431_100079683 | 3300006847 | Bacteria | 3381 |
| 66 | Ga0075431_100159337 | 3300006847 | Bacteria | 2321 |
| 67 | Ga0075433_10034835 | 3300006852 | Unclassified | 4327 |
| 68 | Ga0075434_100208680 | 3300006871 | Unclassified | 1974 |
| 69 | Ga0075436_100038385 | 3300006914 | Bacteria | 3306 |
| 70 | Ga0075436_100155799 | 3300006914 | Unclassified | 1609 |
| 71 | Ga0097620_100203840 | 3300006931 | Bacteria | 2063 |
| 72 | Ga0105240_10076373 | 3300009093 | Bacteria | 4130 |
| 73 | Ga0111539_10002767 | 3300009094 | Bacteria | 23272 |
| 74 | Ga0105245_10031153 | 3300009098 | Bacteria | 4718 |
| 75 | Ga0114129_10021776 | 3300009147 | Bacteria | 9098 |
| 76 | Ga0105239_10693351 | 3300010375 | Unclassified | 1164 |
| 77 | Ga0105246_10001684 | 3300011119 | Bacteria | 13174 |
| 78 | Ga0157371_10149956 | 3300013102 | Bacteria | 1663 |
| 79 | Ga0157374_10011484 | 3300013296 | Bacteria | 7673 |
| 80 | Ga0157374_10031970 | 3300013296 | Unclassified | 4788 |
| 81 | Ga0157378_10047184 | 3300013297 | Bacteria | 3829 |
| 82 | Ga0157378_10411535 | 3300013297 | Unclassified | 1335 |
| 83 | Ga0163162_10014871 | 3300013306 | Bacteria | 7600 |
| 84 | Ga0163163_10175626 | 3300014325 | Bacteria | 2189 |
| 85 | Ga0157379_10280525 | 3300014968 | Bacteria | 1516 |
| 86 | Ga0157376_10029775 | 3300014969 | Bacteria | 4352 |
| 87 | Ga0157376_10031655 | 3300014969 | Bacteria | 4239 |
| 88 | Ga0213871_10005885 | 3300021441 | Bacteria | 2563 |
| 89 | Ga0207697_10005542 | 3300025315 | Bacteria | 5852 |
| 90 | Ga0207680_10282072 | 3300025903 | Bacteria | 1154 |
| 91 | Ga0207645_10005049 | 3300025907 | Bacteria | 9668 |
| 92 | Ga0207684_10004512 | 3300025910 | Bacteria | 13084 |
| 93 | Ga0207684_10100275 | 3300025910 | Unclassified | 2474 |
| 94 | Ga0207693_10000169 | 3300025915 | Bacteria | 58960 |
| 95 | Ga0207693_10120786 | 3300025915 | Bacteria | 2058 |
| 96 | Ga0207660_10135055 | 3300025917 | Bacteria | 1881 |
| 97 | Ga0207652_10062623 | 3300025921 | Bacteria | 3215 |
| 98 | Ga0207646_10002252 | 3300025922 | Bacteria | 22955 |
| 99 | Ga0207646_10026434 | 3300025922 | Bacteria | 5295 |
| 100 | Ga0207646_10134988 | 3300025922 | Bacteria | 2222 |
| 101 | Ga0207646_10183219 | 3300025922 | Unclassified | 1891 |
| 102 | Ga0207646_10313019 | 3300025922 | Bacteria | 1418 |
| 103 | Ga0207681_10263792 | 3300025923 | Unclassified | 1349 |
| 104 | Ga0207650_10087351 | 3300025925 | Unclassified | 2376 |
| 105 | Ga0207659_10178551 | 3300025926 | Unclassified | 1680 |
| 106 | Ga0207700_10225372 | 3300025928 | Bacteria | 1591 |
| 107 | Ga0207664_10023621 | 3300025929 | Bacteria | 4610 |
| 108 | Ga0207644_10042102 | 3300025931 | Bacteria | 3235 |
| 109 | Ga0207644_10158116 | 3300025931 | Bacteria | 1759 |
| 110 | Ga0207690_10009305 | 3300025932 | Bacteria | 5836 |
| 111 | Ga0207706_10150554 | 3300025933 | Unclassified | 2046 |
| 112 | Ga0207706_10261915 | 3300025933 | Unclassified | 1509 |
| 113 | Ga0207670_10138508 | 3300025936 | Unclassified | 1792 |
| 114 | Ga0207669_10014837 | 3300025937 | Unclassified | 3916 |
| 115 | Ga0207669_10078534 | 3300025937 | Unclassified | 2103 |
| 116 | Ga0207691_10096419 | 3300025940 | Unclassified | 2644 |
| 117 | Ga0207651_10014834 | 3300025960 | Unclassified | 4511 |
| 118 | Ga0207712_10275345 | 3300025961 | Unclassified | 1371 |
| 119 | Ga0207668_10250355 | 3300025972 | Unclassified | 1438 |
| 120 | Ga0207658_10041085 | 3300025986 | Unclassified | 3347 |
| 121 | Ga0207675_100337025 | 3300026118 | Bacteria | 1476 |
| 122 | Ga0207675_100497816 | 3300026118 | Unclassified | 1213 |
| 123 | Ga0265356_1003466 | 3300028017 | Bacteria | 1991 |
| 124 | Ga0268266_10087862 | 3300028379 | Unclassified | 2720 |
| 125 | Ga0265338_10002571 | 3300028800 | Bacteria | 26831 |
| 126 | Ga0265324_10002563 | 3300029957 | Bacteria | 9179 |
| 127 | Ga0265325_10112006 | 3300031241 | Unclassified | 1325 |
| 128 | Ga0265340_10000063 | 3300031247 | Bacteria | 49803 |
| 129 | Ga0265340_10008184 | 3300031247 | Bacteria | 5654 |
| 130 | Ga0265331_10073789 | 3300031250 | Bacteria | 1593 |
| 131 | Ga0307513_10021244 | 3300031456 | Bacteria | 7667 |
| 132 | Ga0265314_10006475 | 3300031711 | Bacteria | 10357 |
| 133 | Ga0265314_10081542 | 3300031711 | Bacteria | 2131 |
| 134 | Ga0265342_10156413 | 3300031712 | Bacteria | 1262 |
| 135 | Ga0373945_0163163 | 3300035116 | Unclassified | 909 |
| 136 | Ga0373943_0173378 | 3300035170 | Unclassified | 1181 |
| 137 | Ga0373931_0017592 | 3300035691 | Bacteria | 3540 |
| 138 | Ga0373935_0014067 | 3300035692 | Bacteria | 4833 |
| 139 | Ga0373935_0071185 | 3300035692 | Bacteria | 2243 |
| 140 | Ga0373947_0186641 | 3300035725 | Bacteria | 1352 |
| 141 | Ga0373937_0369832 | 3300036401 | Bacteria | 1359 |
| 142 | Ga0373925_0056250 | 3300037068 | Bacteria | 2947 |
| 143 | Ga0373925_0242148 | 3300037068 | Archaea | 1445 |
| 144 | Ga0436360_0155932 | 3300039438 | Bacteria | 2859 |
| 145 | Ga0436361_1222665 | 3300039447 | Bacteria | 32450 |
| 146 | Ga0436362_0554630 | 3300039453 | Bacteria | 2248 |
| 147 | Ga0495592_0030284 | 3300046454 | Unclassified | 4094 |
| 148 | Ga0495629_0000167 | 3300046459 | Bacteria | 58031 |
| 149 | Ga0495582_0005840 | 3300046473 | Bacteria | 6857 |
| 150 | Ga0495594_0001946 | 3300046499 | Bacteria | 10770 |
| 151 | Ga0495628_0022445 | 3300046516 | Bacteria | 5184 |
| 152 | Ga0495630_0048371 | 3300046517 | Unclassified | 3182 |
| 153 | Ga0495586_0097883 | 3300046535 | Bacteria | 1626 |
| 154 | Ga0495634_0046185 | 3300046642 | Unclassified | 2940 |
| 155 | Ga0495635_0000149 | 3300046663 | Bacteria | 42612 |
| 156 | Ga0495647_0001163 | 3300046681 | Bacteria | 8091 |
| 157 | Ga0495647_0003491 | 3300046681 | Bacteria | 5030 |
| 158 | Ga0495658_0000003 | 3300046683 | Bacteria | 224090 |
| 159 | Ga0495658_0033749 | 3300046683 | Unclassified | 2805 |
| 160 | Ga0495658_0043144 | 3300046683 | Unclassified | 2521 |
| 161 | Ga0495658_0071452 | 3300046683 | Bacteria | 2016 |
| 162 | Ga0495669_0041253 | 3300046684 | Bacteria | 2049 |
| 163 | Ga0495613_0001329 | 3300046689 | Bacteria | 18883 |
| 164 | Ga0495613_0258846 | 3300046689 | Bacteria | 1213 |
| 165 | Ga0495581_0000148 | 3300047315 | Bacteria | 30986 |
| 166 | Ga0495674_0023452 | 3300047319 | Bacteria | 5686 |
| 167 | Ga0495676_0110216 | 3300047321 | Unclassified | 2021 |
| 168 | Ga0495680_0007938 | 3300047322 | Bacteria | 9682 |
| 169 | Ga0495680_0018468 | 3300047322 | Bacteria | 5919 |
| 170 | Ga0496108_0068250 | 3300048911 | Bacteria | 3000 |
| 171 | Ga0496108_0216347 | 3300048911 | Unclassified | 1664 |
| 172 | Ga0496112_0139493 | 3300048915 | Unclassified | 2394 |
| 173 | nmdc:mga08y16_243382_c1 | 3300050511 | Bacteria | 1859 |
| 174 | nmdc:mga0n895_200912_c1 | 3300050512 | Unclassified | 2024 |
| 175 | nmdc:mga08x19_32132_c1 | 3300050514 | Bacteria | 3306 |
| 176 | nmdc:mga08x19_419748_c1 | 3300050514 | Bacteria | 940 |
| 177 | nmdc:mga08x19_63803_c1 | 3300050514 | Unclassified | 2390 |
| 178 | nmdc:mga0a205_4607_c2 | 3300050515 | Bacteria | 11669 |
| 179 | Ga0495619_0002376 | 3300053085 | Bacteria | 12370 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035116 | Ga0373945_0163163 | Ga0373945_0163163_33_872 | 279 |
| 2 | 3300046454 | Ga0495592_0030284 | Ga0495592_0030284_3239_4078 | 279 |
| 3 | 3300050514 | nmdc:mga08x19_419748_c1 | nmdc:mga08x19_419748_c1_40_900 | 286 |
| 4 | 3300025922 | Ga0207646_10313019 | Ga0207646_103130191 | 291 |
| 5 | 3300039453 | Ga0436362_0554630 | Ga0436362_0554630_1354_2232 | 292 |
| 6 | 3300005444 | Ga0070694_100216140 | Ga0070694_1002161402 | 302 |
| 7 | 3300005549 | Ga0070704_100001324 | Ga0070704_10000132412 | 302 |
| 8 | 3300046459 | Ga0495629_0000167 | Ga0495629_0000167_7152_8114 | 312 |
| 9 | 3300046473 | Ga0495582_0005840 | Ga0495582_0005840_3854_4816 | 312 |
| 10 | 3300046681 | Ga0495647_0001163 | Ga0495647_0001163_4577_5539 | 312 |
| 11 | 3300046683 | Ga0495658_0000003 | Ga0495658_0000003_215067_216029 | 312 |
| 12 | 3300046689 | Ga0495613_0001329 | Ga0495613_0001329_12029_12991 | 312 |
| 13 | 3300047315 | Ga0495581_0000148 | Ga0495581_0000148_22849_23811 | 312 |
| 14 | 3300047322 | Ga0495680_0007938 | Ga0495680_0007938_2771_3733 | 312 |
| 15 | 3300053085 | Ga0495619_0002376 | Ga0495619_0002376_1504_2466 | 312 |
| 16 | 3300031456 | Ga0307513_10021244 | Ga0307513_100212444 | 314 |
| 17 | 3300005468 | Ga0070707_100387401 | Ga0070707_1003874011 | 315 |
| 18 | 3300036401 | Ga0373937_0369832 | Ga0373937_0369832_54_1004 | 316 |
| 19 | 3300046499 | Ga0495594_0001946 | Ga0495594_0001946_9528_10478 | 316 |
| 20 | 3300039438 | Ga0436360_0155932 | Ga0436360_0155932_1820_2773 | 317 |
| 21 | 3300039447 | Ga0436361_1222665 | Ga0436361_1222665_30158_31111 | 317 |
| 22 | 3300005339 | Ga0070660_100013501 | Ga0070660_1000135013 | 319 |
| 23 | 3300005366 | Ga0070659_100001698 | Ga0070659_1000016981 | 319 |
| 24 | 3300025932 | Ga0207690_10009305 | Ga0207690_100093055 | 319 |
| 25 | 3300005272 | Ga0065703_1021581 | Ga0065703_10215811 | 320 |
| 26 | 3300005330 | Ga0070690_100202141 | Ga0070690_1002021412 | 320 |
| 27 | 3300005347 | Ga0070668_100030614 | Ga0070668_1000306142 | 320 |
| 28 | 3300005354 | Ga0070675_100113147 | Ga0070675_1001131473 | 320 |
| 29 | 3300005355 | Ga0070671_100018445 | Ga0070671_1000184453 | 320 |
| 30 | 3300005356 | Ga0070674_100025255 | Ga0070674_1000252554 | 320 |
| 31 | 3300005364 | Ga0070673_100072520 | Ga0070673_1000725203 | 320 |
| 32 | 3300005365 | Ga0070688_100015564 | Ga0070688_1000155643 | 320 |
| 33 | 3300005367 | Ga0070667_100019160 | Ga0070667_1000191605 | 320 |
| 34 | 3300005459 | Ga0068867_100041343 | Ga0068867_1000413431 | 320 |
| 35 | 3300005543 | Ga0070672_100034760 | Ga0070672_1000347602 | 320 |
| 36 | 3300005564 | Ga0070664_100170319 | Ga0070664_1001703192 | 320 |
| 37 | 3300006844 | Ga0075428_100060700 | Ga0075428_1000607003 | 320 |
| 38 | 3300006871 | Ga0075434_100208680 | Ga0075434_1002086801 | 320 |
| 39 | 3300006914 | Ga0075436_100155799 | Ga0075436_1001557991 | 320 |
| 40 | 3300013296 | Ga0157374_10011484 | Ga0157374_100114844 | 320 |
| 41 | 3300013297 | Ga0157378_10411535 | Ga0157378_104115352 | 320 |
| 42 | 3300013306 | Ga0163162_10014871 | Ga0163162_100148719 | 320 |
| 43 | 3300025315 | Ga0207697_10005542 | Ga0207697_100055425 | 320 |
| 44 | 3300025903 | Ga0207680_10282072 | Ga0207680_102820721 | 320 |
| 45 | 3300025907 | Ga0207645_10005049 | Ga0207645_1000504910 | 320 |
| 46 | 3300025925 | Ga0207650_10087351 | Ga0207650_100873513 | 320 |
| 47 | 3300025926 | Ga0207659_10178551 | Ga0207659_101785512 | 320 |
| 48 | 3300025931 | Ga0207644_10158116 | Ga0207644_101581161 | 320 |
| 49 | 3300025933 | Ga0207706_10150554 | Ga0207706_101505542 | 320 |
| 50 | 3300025936 | Ga0207670_10138508 | Ga0207670_101385083 | 320 |
| 51 | 3300025937 | Ga0207669_10078534 | Ga0207669_100785343 | 320 |
| 52 | 3300025960 | Ga0207651_10014834 | Ga0207651_100148345 | 320 |
| 53 | 3300025972 | Ga0207668_10250355 | Ga0207668_102503552 | 320 |
| 54 | 3300025986 | Ga0207658_10041085 | Ga0207658_100410853 | 320 |
| 55 | 3300028379 | Ga0268266_10087862 | Ga0268266_100878623 | 320 |
| 56 | 3300046663 | Ga0495635_0000149 | Ga0495635_0000149_2167_3129 | 320 |
| 57 | 3300048911 | Ga0496108_0216347 | Ga0496108_0216347_475_1440 | 320 |
| 58 | 3300048915 | Ga0496112_0139493 | Ga0496112_0139493_61_1026 | 320 |
| 59 | 3300050512 | nmdc:mga0n895_200912_c1 | nmdc:mga0n895_200912_c1_248_1210 | 320 |
| 60 | 3300050514 | nmdc:mga08x19_63803_c1 | nmdc:mga08x19_63803_c1_660_1622 | 320 |
| 61 | 3300046535 | Ga0495586_0097883 | Ga0495586_0097883_474_1481 | 321 |
| 62 | 3300005328 | Ga0070676_10266666 | Ga0070676_102666661 | 322 |
| 63 | 3300005331 | Ga0070670_100119659 | Ga0070670_1001196592 | 322 |
| 64 | 3300005345 | Ga0070692_10003555 | Ga0070692_100035556 | 322 |
| 65 | 3300005356 | Ga0070674_100113779 | Ga0070674_1001137792 | 322 |
| 66 | 3300005364 | Ga0070673_100010933 | Ga0070673_1000109332 | 322 |
| 67 | 3300005439 | Ga0070711_100103564 | Ga0070711_1001035642 | 322 |
| 68 | 3300005444 | Ga0070694_100000350 | Ga0070694_1000003505 | 322 |
| 69 | 3300005445 | Ga0070708_100081923 | Ga0070708_1000819232 | 322 |
| 70 | 3300005457 | Ga0070662_100157483 | Ga0070662_1001574832 | 322 |
| 71 | 3300005467 | Ga0070706_100075735 | Ga0070706_1000757351 | 322 |
| 72 | 3300005468 | Ga0070707_100036786 | Ga0070707_1000367863 | 322 |
| 73 | 3300005518 | Ga0070699_100350136 | Ga0070699_1003501362 | 322 |
| 74 | 3300005543 | Ga0070672_100262956 | Ga0070672_1002629562 | 322 |
| 75 | 3300005543 | Ga0070672_100408806 | Ga0070672_1004088062 | 322 |
| 76 | 3300005545 | Ga0070695_100349271 | Ga0070695_1003492711 | 322 |
| 77 | 3300005546 | Ga0070696_100217999 | Ga0070696_1002179991 | 322 |
| 78 | 3300005841 | Ga0068863_100477390 | Ga0068863_1004773901 | 322 |
| 79 | 3300006175 | Ga0070712_100000266 | Ga0070712_10000026614 | 322 |
| 80 | 3300006237 | Ga0097621_100201338 | Ga0097621_1002013381 | 322 |
| 81 | 3300006358 | Ga0068871_100067919 | Ga0068871_1000679192 | 322 |
| 82 | 3300006847 | Ga0075431_100159337 | Ga0075431_1001593372 | 322 |
| 83 | 3300009098 | Ga0105245_10031153 | Ga0105245_100311532 | 322 |
| 84 | 3300009147 | Ga0114129_10021776 | Ga0114129_100217767 | 322 |
| 85 | 3300010375 | Ga0105239_10693351 | Ga0105239_106933511 | 322 |
| 86 | 3300013296 | Ga0157374_10031970 | Ga0157374_100319706 | 322 |
| 87 | 3300013297 | Ga0157378_10047184 | Ga0157378_100471844 | 322 |
| 88 | 3300014968 | Ga0157379_10280525 | Ga0157379_102805252 | 322 |
| 89 | 3300014969 | Ga0157376_10029775 | Ga0157376_100297752 | 322 |
| 90 | 3300025910 | Ga0207684_10100275 | Ga0207684_101002752 | 322 |
| 91 | 3300025915 | Ga0207693_10000169 | Ga0207693_1000016956 | 322 |
| 92 | 3300025922 | Ga0207646_10134988 | Ga0207646_101349883 | 322 |
| 93 | 3300025923 | Ga0207681_10263792 | Ga0207681_102637922 | 322 |
| 94 | 3300025928 | Ga0207700_10225372 | Ga0207700_102253722 | 322 |
| 95 | 3300025933 | Ga0207706_10261915 | Ga0207706_102619151 | 322 |
| 96 | 3300025937 | Ga0207669_10014837 | Ga0207669_100148372 | 322 |
| 97 | 3300025940 | Ga0207691_10096419 | Ga0207691_100964192 | 322 |
| 98 | 3300026118 | Ga0207675_100497816 | Ga0207675_1004978161 | 322 |
| 99 | 3300028017 | Ga0265356_1003466 | Ga0265356_10034662 | 322 |
| 100 | 3300031247 | Ga0265340_10000063 | Ga0265340_1000006342 | 322 |
| 101 | 3300031247 | Ga0265340_10008184 | Ga0265340_100081843 | 322 |
| 102 | 3300031250 | Ga0265331_10073789 | Ga0265331_100737892 | 322 |
| 103 | 3300031711 | Ga0265314_10081542 | Ga0265314_100815423 | 322 |
| 104 | 3300031712 | Ga0265342_10156413 | Ga0265342_101564132 | 322 |
| 105 | 3300035692 | Ga0373935_0014067 | Ga0373935_0014067_2044_3012 | 322 |
| 106 | 3300037068 | Ga0373925_0056250 | Ga0373925_0056250_625_1593 | 322 |
| 107 | 3300046684 | Ga0495669_0041253 | Ga0495669_0041253_747_1715 | 322 |
| 108 | 3300048911 | Ga0496108_0068250 | Ga0496108_0068250_111_1079 | 322 |
| 109 | 3300050511 | nmdc:mga08y16_243382_c1 | nmdc:mga08y16_243382_c1_253_1230 | 322 |
| 110 | 3300005435 | Ga0070714_100022687 | Ga0070714_1000226874 | 323 |
| 111 | 3300006852 | Ga0075433_10034835 | Ga0075433_100348355 | 323 |
| 112 | 3300021441 | Ga0213871_10005885 | Ga0213871_100058852 | 323 |
| 113 | 3300025929 | Ga0207664_10023621 | Ga0207664_100236215 | 323 |
| 114 | 3300046517 | Ga0495630_0048371 | Ga0495630_0048371_46_1017 | 323 |
| 115 | 3300046642 | Ga0495634_0046185 | Ga0495634_0046185_70_1041 | 323 |
| 116 | 3300046681 | Ga0495647_0003491 | Ga0495647_0003491_3732_4703 | 323 |
| 117 | 3300046683 | Ga0495658_0033749 | Ga0495658_0033749_653_1624 | 323 |
| 118 | 3300047319 | Ga0495674_0023452 | Ga0495674_0023452_2092_3063 | 323 |
| 119 | 3300047321 | Ga0495676_0110216 | Ga0495676_0110216_688_1659 | 323 |
| 120 | 3300047322 | Ga0495680_0018468 | Ga0495680_0018468_1432_2403 | 323 |
| 121 | 3300050515 | nmdc:mga0a205_4607_c2 | nmdc:mga0a205_4607_c2_9013_9984 | 323 |
| 122 | 3300005438 | Ga0070701_10117144 | Ga0070701_101171442 | 324 |
| 123 | 3300005468 | Ga0070707_100005026 | Ga0070707_10000502611 | 324 |
| 124 | 3300005545 | Ga0070695_100280202 | Ga0070695_1002802022 | 324 |
| 125 | 3300005577 | Ga0068857_100354097 | Ga0068857_1003540971 | 324 |
| 126 | 3300005617 | Ga0068859_100203850 | Ga0068859_1002038502 | 324 |
| 127 | 3300005618 | Ga0068864_100193458 | Ga0068864_1001934581 | 324 |
| 128 | 3300005840 | Ga0068870_10197921 | Ga0068870_101979211 | 324 |
| 129 | 3300006931 | Ga0097620_100203840 | Ga0097620_1002038402 | 324 |
| 130 | 3300009094 | Ga0111539_10002767 | Ga0111539_100027676 | 324 |
| 131 | 3300011119 | Ga0105246_10001684 | Ga0105246_100016845 | 324 |
| 132 | 3300013102 | Ga0157371_10149956 | Ga0157371_101499562 | 324 |
| 133 | 3300014325 | Ga0163163_10175626 | Ga0163163_101756262 | 324 |
| 134 | 3300025922 | Ga0207646_10002252 | Ga0207646_1000225211 | 324 |
| 135 | 3300025961 | Ga0207712_10275345 | Ga0207712_102753451 | 324 |
| 136 | 3300026118 | Ga0207675_100337025 | Ga0207675_1003370251 | 324 |
| 137 | 3300035170 | Ga0373943_0173378 | Ga0373943_0173378_11_985 | 324 |
| 138 | 3300035692 | Ga0373935_0071185 | Ga0373935_0071185_858_1835 | 324 |
| 139 | 3300035725 | Ga0373947_0186641 | Ga0373947_0186641_196_1173 | 324 |
| 140 | 3300046683 | Ga0495658_0043144 | Ga0495658_0043144_1144_2121 | 324 |
| 141 | 3300046689 | Ga0495613_0258846 | Ga0495613_0258846_78_1052 | 324 |
| 142 | 3300000545 | CNXas_1000152 | CNXas_100015210 | 325 |
| 143 | 3300005336 | Ga0070680_100116408 | Ga0070680_1001164083 | 325 |
| 144 | 3300005355 | Ga0070671_100023222 | Ga0070671_1000232223 | 325 |
| 145 | 3300005445 | Ga0070708_100079623 | Ga0070708_1000796232 | 325 |
| 146 | 3300005458 | Ga0070681_10026804 | Ga0070681_100268043 | 325 |
| 147 | 3300005467 | Ga0070706_100005450 | Ga0070706_10000545010 | 325 |
| 148 | 3300005467 | Ga0070706_100015275 | Ga0070706_1000152753 | 325 |
| 149 | 3300005468 | Ga0070707_100035544 | Ga0070707_1000355445 | 325 |
| 150 | 3300005468 | Ga0070707_100097342 | Ga0070707_1000973422 | 325 |
| 151 | 3300005530 | Ga0070679_100150527 | Ga0070679_1001505273 | 325 |
| 152 | 3300005536 | Ga0070697_100000275 | Ga0070697_1000002754 | 325 |
| 153 | 3300005536 | Ga0070697_100029367 | Ga0070697_1000293674 | 325 |
| 154 | 3300005536 | Ga0070697_100030468 | Ga0070697_1000304681 | 325 |
| 155 | 3300005536 | Ga0070697_100040013 | Ga0070697_1000400133 | 325 |
| 156 | 3300005563 | Ga0068855_100064379 | Ga0068855_1000643792 | 325 |
| 157 | 3300005983 | Ga0081540_1000991 | Ga0081540_100099118 | 325 |
| 158 | 3300005983 | Ga0081540_1001558 | Ga0081540_10015584 | 325 |
| 159 | 3300006175 | Ga0070712_100256831 | Ga0070712_1002568312 | 325 |
| 160 | 3300006847 | Ga0075431_100079683 | Ga0075431_1000796833 | 325 |
| 161 | 3300006914 | Ga0075436_100038385 | Ga0075436_1000383853 | 325 |
| 162 | 3300009093 | Ga0105240_10076373 | Ga0105240_100763732 | 325 |
| 163 | 3300014969 | Ga0157376_10031655 | Ga0157376_100316553 | 325 |
| 164 | 3300025910 | Ga0207684_10004512 | Ga0207684_100045129 | 325 |
| 165 | 3300025915 | Ga0207693_10120786 | Ga0207693_101207861 | 325 |
| 166 | 3300025917 | Ga0207660_10135055 | Ga0207660_101350552 | 325 |
| 167 | 3300025921 | Ga0207652_10062623 | Ga0207652_100626232 | 325 |
| 168 | 3300025922 | Ga0207646_10026434 | Ga0207646_100264343 | 325 |
| 169 | 3300025922 | Ga0207646_10183219 | Ga0207646_101832192 | 325 |
| 170 | 3300025931 | Ga0207644_10042102 | Ga0207644_100421022 | 325 |
| 171 | 3300028800 | Ga0265338_10002571 | Ga0265338_100025712 | 325 |
| 172 | 3300029957 | Ga0265324_10002563 | Ga0265324_100025636 | 325 |
| 173 | 3300031241 | Ga0265325_10112006 | Ga0265325_101120062 | 325 |
| 174 | 3300031711 | Ga0265314_10006475 | Ga0265314_100064759 | 325 |
| 175 | 3300035691 | Ga0373931_0017592 | Ga0373931_0017592_360_1337 | 325 |
| 176 | 3300037068 | Ga0373925_0242148 | Ga0373925_0242148_413_1390 | 325 |
| 177 | 3300046516 | Ga0495628_0022445 | Ga0495628_0022445_1389_2366 | 325 |
| 178 | 3300046683 | Ga0495658_0071452 | Ga0495658_0071452_144_1121 | 325 |
| 179 | 3300050514 | nmdc:mga08x19_32132_c1 | nmdc:mga08x19_32132_c1_1589_2596 | 325 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2zpu-assembly1.cif.gz_A | crystal structure of modified serine racemase from s.pombe. | 0.9041 | 8 | 322 |
| 2gn2-assembly1.cif.gz_A | crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) | 0.9007 | 5 | 324 |
| 2zpu-assembly1.cif.gz_A | crystal structure of modified serine racemase from s.pombe. | 0.8905 | 8 | 322 |
| 1ve5-assembly1.cif.gz_A | crystal structure of t.th. hb8 threonine deaminase | 0.8879 | 12 | 312 |
| 1ve5-assembly1.cif.gz_B | crystal structure of t.th. hb8 threonine deaminase | 0.8878 | 12 | 312 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1wtcA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.909 | 14 | 322 | 3.40.50.1100 |
| 5d86A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8984 | 56 | 128 | 3.40.50.1100 |
| 1ve5C01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8893 | 12 | 309 | 3.40.50.1100 |
| 3hmkA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8871 | 7 | 314 | 3.40.50.1100 |
| 1wtcA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8856 | 14 | 322 | 3.40.50.1100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534GBF2-F1-model_v4 | Pyridoxal-phosphate dependent enzyme | 0.9868 | 1 | 274 |
GO:0003941
GO:0004794 GO:0006565 GO:0006567 GO:0009097 |
| AF-A0A534ELY7-F1-model_v4 | Pyridoxal-phosphate dependent enzyme | 0.9839 | 1 | 325 |
GO:0003941
GO:0004794 GO:0006565 GO:0006567 GO:0009097 |
| AF-A0A534GBF2-F1-model_v4 | Pyridoxal-phosphate dependent enzyme | 0.9833 | 1 | 274 |
GO:0003941
GO:0004794 GO:0006565 GO:0006567 GO:0009097 |
| AF-A0A534ELY7-F1-model_v4 | Pyridoxal-phosphate dependent enzyme | 0.9809 | 1 | 325 |
GO:0003941
GO:0004794 GO:0006565 GO:0006567 GO:0009097 |
| AF-A0A1H7BG75-F1-model_v4 | Threonine dehydratase | 0.9757 | 16 | 322 |
GO:0003941
GO:0004794 GO:0006565 GO:0006567 GO:0009097 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar