F273532

General Info

Members Datasets Scaffolds Average Seq Length
179 113 358 554

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100079117|Ga0068859_1000791171
Length 609
Sequence MSPSWESRTFPPTWDVQHGGAFGIQPLTYVAPTFDDDFAETASVRCLNVRFKMNQYRNFWVTLMNHYFLFVISLLIVGAIYPVSAQTVSTGPAIEYKSKRTIDNTDPKAPVIFEDVTSLTPLSSFKHRSGSADKNYIFDVPSGGVAVLDYDNDGLPDIYLLNGSTLAALQGNEKPPRAALFHNLGNWKFEDVTEKANVANERWGMGVAVGDYDNDGYPDMFVSNWGVSYVDIDLNKLPPTPADASAQSLCQFRGIPTMCGPRGLNGEGDTLYHQKSDGTFEDVSVKAGVNDPQKYYGFTSSFVHINDDNLLDLIVVNDSNPKQMYINRGNGTFEETGYQSGVALNENGREQAGMGLAVGDYDNDGRVDFHITNFSDDSNILYHNDGAGNFSDVTYSSGLGEVTLPFLGWGTSFIDYDNDGWKDIMVANGHVYPIVDQHQWGTSYAQQPLLFRNLRNGKFARVGAAPGSGLAEAWCSRGMASADFDLDGRVDLVLNNIDSSPVLLKNVTQQAGHWLELKLVGDVGRRSPRDAVGAVVYVTANKIRQRQDLVSGTSYASQNDLTVHFGLGNATRIDRLEIEWPNGLSEQVSVQKVDRKVTVTQGAKISGSL

Samples

Sample ID Description Type Environment
1 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
104 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
105 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
106 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
107 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
108 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
109 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
110 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
111 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
112 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
113 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.56
Rhizosphere 99.44
Stem 0
Stem Tuber 0
Unclassified 14.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068859_100079117 3300005617 Unclassified 3327
2 JGI24751J29686_10000032 3300002459 Bacteria 87712
3 JGI25406J46586_10003585 3300003203 Bacteria 7281
4 Ga0065712_10002204 3300005290 Bacteria 4998
5 Ga0065715_10090256 3300005293 Bacteria 7339
6 Ga0065707_10087210 3300005295 Bacteria 5117
7 Ga0065707_10104723 3300005295 Unclassified 2681
8 Ga0070690_100000594 3300005330 Bacteria 18212
9 Ga0070690_100001990 3300005330 Bacteria 10878
10 Ga0070670_100000071 3300005331 Bacteria 102454
11 Ga0068869_100008694 3300005334 Bacteria 6559
12 Ga0070680_100000440 3300005336 Bacteria 28281
13 Ga0070687_100005270 3300005343 Bacteria 5226
14 Ga0070669_100038936 3300005353 Bacteria 3453
15 Ga0070669_100039680 3300005353 Unclassified 3422
16 Ga0070675_100124354 3300005354 Unclassified 2194
17 Ga0070659_100007520 3300005366 Bacteria 7914
18 Ga0070659_100024628 3300005366 Bacteria 4615
19 Ga0070703_10000234 3300005406 Bacteria 26843
20 Ga0070703_10000362 3300005406 Bacteria 19599
21 Ga0070709_10000037 3300005434 Bacteria 109706
22 Ga0070701_10029497 3300005438 Unclassified 2707
23 Ga0070711_100000024 3300005439 Bacteria 117125
24 Ga0070700_100017051 3300005441 Unclassified 4147
25 Ga0070694_100010441 3300005444 Bacteria 5730
26 Ga0070694_100018052 3300005444 Bacteria 4470
27 Ga0070694_100064558 3300005444 Bacteria 2506
28 Ga0070708_100000665 3300005445 Bacteria 26058
29 Ga0070708_100029945 3300005445 Bacteria 4700
30 Ga0070708_100038635 3300005445 Bacteria 4171
31 Ga0070681_10000048 3300005458 Bacteria 82548
32 Ga0070681_10001236 3300005458 Bacteria 22239
33 Ga0070706_100001562 3300005467 Bacteria 23916
34 Ga0070706_100002093 3300005467 Bacteria 20344
35 Ga0070698_100000808 3300005471 Bacteria 34171
36 Ga0070698_100006595 3300005471 Bacteria 12586
37 Ga0070698_100007829 3300005471 Bacteria 11567
38 Ga0070698_100011927 3300005471 Bacteria 9222
39 Ga0070698_100022770 3300005471 Bacteria 6552
40 Ga0070699_100002682 3300005518 Bacteria 15907
41 Ga0070679_100000079 3300005530 Bacteria 72586
42 Ga0070679_100083886 3300005530 Bacteria 3174
43 Ga0070697_100000366 3300005536 Bacteria 35335
44 Ga0070697_100040032 3300005536 Unclassified 3791
45 Ga0068853_100140166 3300005539 Bacteria 2170
46 Ga0070686_100002229 3300005544 Bacteria 10698
47 Ga0070686_100020086 3300005544 Bacteria 3950
48 Ga0070695_100039642 3300005545 Bacteria 2979
49 Ga0070696_100004180 3300005546 Bacteria 9615
50 Ga0070696_100038180 3300005546 Bacteria 3314
51 Ga0070704_100011301 3300005549 Bacteria 5469
52 Ga0070664_100000569 3300005564 Bacteria 28150
53 Ga0068857_100004840 3300005577 Bacteria 11411
54 Ga0068854_100104164 3300005578 Bacteria 2131
55 Ga0068856_100119806 3300005614 Bacteria 2633
56 Ga0068864_100008754 3300005618 Bacteria 8343
57 Ga0068864_100125279 3300005618 Bacteria 2301
58 Ga0068861_100004382 3300005719 Bacteria 9466
59 Ga0068861_100014733 3300005719 Bacteria 5492
60 Ga0068861_100106994 3300005719 Unclassified 2235
61 Ga0068863_100162537 3300005841 Unclassified 2140
62 Ga0068860_100098503 3300005843 Bacteria 2788
63 Ga0068860_100163765 3300005843 Bacteria 2145
64 Ga0081539_10000898 3300005985 Bacteria 56680
65 Ga0081539_10004866 3300005985 Bacteria 14356
66 Ga0070715_10000002 3300006163 Bacteria 389554
67 Ga0070716_100000010 3300006173 Bacteria 157261
68 Ga0070716_100011241 3300006173 Bacteria 4507
69 Ga0075428_100122203 3300006844 Unclassified 2835
70 Ga0075428_100240058 3300006844 Bacteria 1955
71 Ga0075433_10033040 3300006852 Bacteria 4434
72 Ga0068865_100008540 3300006881 Bacteria 6331
73 Ga0075436_100000006 3300006914 Bacteria 306066
74 Ga0075436_100003052 3300006914 Bacteria 11476
75 Ga0075436_100012304 3300006914 Bacteria 5863
76 Ga0097620_100079116 3300006931 Unclassified 3327
77 Ga0075435_100001651 3300007076 Bacteria 14471
78 Ga0075435_100002530 3300007076 Bacteria 12167
79 Ga0099794_10000688 3300007265 Bacteria 11367
80 Ga0111539_10005719 3300009094 Bacteria 16078
81 Ga0111539_10034897 3300009094 Bacteria 6093
82 Ga0111539_10093373 3300009094 Unclassified 3534
83 Ga0114129_10009735 3300009147 Bacteria 13709
84 Ga0114129_10045687 3300009147 Bacteria 6155
85 Ga0114129_10046392 3300009147 Bacteria 6106
86 Ga0114129_10129544 3300009147 Unclassified 3467
87 Ga0105243_10000338 3300009148 Bacteria 51096
88 Ga0105243_10000859 3300009148 Bacteria 28797
89 Ga0105243_10054744 3300009148 Bacteria 3168
90 Ga0105242_10000080 3300009176 Bacteria 66010
91 Ga0105242_10020606 3300009176 Bacteria 5172
92 Ga0105248_10048195 3300009177 Unclassified 4779
93 Ga0105248_10131953 3300009177 Bacteria 2819
94 Ga0105238_10006680 3300009551 Bacteria 11505
95 Ga0105249_10004522 3300009553 Bacteria 12016
96 Ga0105249_10005471 3300009553 Bacteria 10966
97 Ga0105249_10016896 3300009553 Bacteria 6474
98 Ga0105249_10050201 3300009553 Bacteria 3804
99 Ga0105239_10125039 3300010375 Bacteria 2858
100 Ga0157373_10019353 3300013100 Bacteria 4958
101 Ga0157378_10000094 3300013297 Bacteria 84481
102 Ga0157378_10064985 3300013297 Bacteria 3265
103 Ga0157378_10069294 3300013297 Unclassified 3164
104 Ga0157378_10125923 3300013297 Bacteria 2366
105 Ga0163162_10003391 3300013306 Bacteria 15222
106 Ga0163162_10070236 3300013306 Bacteria 3553
107 Ga0157375_10005225 3300013308 Bacteria 11267
108 Ga0157375_10033924 3300013308 Unclassified 4856
109 Ga0163163_10000188 3300014325 Bacteria 63392
110 Ga0163163_10019770 3300014325 Bacteria 6333
111 Ga0157380_10027176 3300014326 Unclassified 4350
112 Ga0157380_10035662 3300014326 Bacteria 3843
113 Ga0157380_10043346 3300014326 Bacteria 3523
114 Ga0163161_10061491 3300017792 Bacteria 2734
115 Ga0207653_10000018 3300025885 Bacteria 141131
116 Ga0207653_10000190 3300025885 Bacteria 42234
117 Ga0207685_10000030 3300025905 Bacteria 89606
118 Ga0207699_10000048 3300025906 Bacteria 109686
119 Ga0207643_10035455 3300025908 Bacteria 2798
120 Ga0207707_10000015 3300025912 Bacteria 259670
121 Ga0207663_10000012 3300025916 Bacteria 167739
122 Ga0207660_10002047 3300025917 Bacteria 13400
123 Ga0207662_10003556 3300025918 Bacteria 8040
124 Ga0207662_10009336 3300025918 Bacteria 5393
125 Ga0207652_10001437 3300025921 Bacteria 21106
126 Ga0207646_10003844 3300025922 Bacteria 16677
127 Ga0207681_10001684 3300025923 Bacteria 14222
128 Ga0207694_10003572 3300025924 Bacteria 12333
129 Ga0207650_10000006 3300025925 Bacteria 544730
130 Ga0207690_10006586 3300025932 Bacteria 6881
131 Ga0207706_10073008 3300025933 Bacteria 3017
132 Ga0207686_10000109 3300025934 Bacteria 66014
133 Ga0207686_10021939 3300025934 Unclassified 3672
134 Ga0207709_10000025 3300025935 Bacteria 364795
135 Ga0207709_10025614 3300025935 Bacteria 3379
136 Ga0207670_10078764 3300025936 Bacteria 2299
137 Ga0207665_10000010 3300025939 Bacteria 157219
138 Ga0207665_10086094 3300025939 Bacteria 2170
139 Ga0207691_10012717 3300025940 Bacteria 8062
140 Ga0207689_10010481 3300025942 Bacteria 7982
141 Ga0207679_10005767 3300025945 Bacteria 7774
142 Ga0207651_10109207 3300025960 Bacteria 2072
143 Ga0207712_10015900 3300025961 Bacteria 4862
144 Ga0207639_10021280 3300026041 Bacteria 4656
145 Ga0207708_10005260 3300026075 Bacteria 9529
146 Ga0207708_10010351 3300026075 Bacteria 6924
147 Ga0207708_10082127 3300026075 Bacteria 2477
148 Ga0207641_10131000 3300026088 Bacteria 2252
149 Ga0207676_10101527 3300026095 Unclassified 2386
150 Ga0207674_10001516 3300026116 Bacteria 29946
151 Ga0207675_100001533 3300026118 Bacteria 23147
152 Ga0207675_100004412 3300026118 Bacteria 13590
153 Ga0207675_100009883 3300026118 Bacteria 8926
154 Ga0207675_100030597 3300026118 Bacteria 5015
155 Ga0207428_10055218 3300027907 Unclassified 3159
156 Ga0207428_10090715 3300027907 Unclassified 2373
157 Ga0207428_10095931 3300027907 Unclassified 2297
158 Ga0307408_100040164 3300031548 Bacteria 3312
159 Ga0307410_10023618 3300031852 Bacteria 3826
160 Ga0307406_10011092 3300031901 Bacteria 5105
161 Ga0307411_10002983 3300032005 Bacteria 7697
162 Ga0373942_0009225 3300035207 Unclassified 2306
163 Ga0395905_0031168 3300037471 Bacteria 5021
164 Ga0242420_001857 3300038996 Unclassified 2912
165 Ga0453683_0053424 3300044673 Unclassified 2528
166 Ga0495663_0004114 3300046525 Bacteria 4118
167 Ga0495598_0000178 3300046537 Bacteria 11050
168 Ga0495621_0000157 3300046539 Bacteria 15043
169 Ga0496106_0006116 3300048909 Bacteria 8904
170 Ga0501038_0002371 3300049574 Bacteria 17541
171 nmdc:mga05p37_114368_c1 3300050507 Bacteria 3317
172 nmdc:mga05p37_44504_c1 3300050507 Bacteria 5461
173 nmdc:mga05p37_69215_c1 3300050507 Unclassified 4341
174 nmdc:mga08y16_14640_c1 3300050511 Bacteria 8248
175 nmdc:mga08y16_35875_c1 3300050511 Bacteria 5208
176 nmdc:mga0rr50_2359_c1 3300050513 Bacteria 10624
177 nmdc:mga08x19_13_c1 3300050514 Bacteria 366166
178 nmdc:mga08x19_7319_c1 3300050514 Bacteria 6557
179 nmdc:mga08x19_7_c1 3300050514 Bacteria 437351
180 Ga0068859_100079117
181 JGI24751J29686_10000032
182 JGI25406J46586_10003585
183 Ga0065712_10002204
184 Ga0065715_10090256
185 Ga0065707_10087210
186 Ga0065707_10104723
187 Ga0070690_100000594
188 Ga0070690_100001990
189 Ga0070670_100000071
190 Ga0068869_100008694
191 Ga0070680_100000440
192 Ga0070687_100005270
193 Ga0070669_100038936
194 Ga0070669_100039680
195 Ga0070675_100124354
196 Ga0070659_100007520
197 Ga0070659_100024628
198 Ga0070703_10000234
199 Ga0070703_10000362
200 Ga0070709_10000037
201 Ga0070701_10029497
202 Ga0070711_100000024
203 Ga0070700_100017051
204 Ga0070694_100010441
205 Ga0070694_100018052
206 Ga0070694_100064558
207 Ga0070708_100000665
208 Ga0070708_100029945
209 Ga0070708_100038635
210 Ga0070681_10000048
211 Ga0070681_10001236
212 Ga0070706_100001562
213 Ga0070706_100002093
214 Ga0070698_100000808
215 Ga0070698_100006595
216 Ga0070698_100007829
217 Ga0070698_100011927
218 Ga0070698_100022770
219 Ga0070699_100002682
220 Ga0070679_100000079
221 Ga0070679_100083886
222 Ga0070697_100000366
223 Ga0070697_100040032
224 Ga0068853_100140166
225 Ga0070686_100002229
226 Ga0070686_100020086
227 Ga0070695_100039642
228 Ga0070696_100004180
229 Ga0070696_100038180
230 Ga0070704_100011301
231 Ga0070664_100000569
232 Ga0068857_100004840
233 Ga0068854_100104164
234 Ga0068856_100119806
235 Ga0068864_100008754
236 Ga0068864_100125279
237 Ga0068861_100004382
238 Ga0068861_100014733
239 Ga0068861_100106994
240 Ga0068863_100162537
241 Ga0068860_100098503
242 Ga0068860_100163765
243 Ga0081539_10000898
244 Ga0081539_10004866
245 Ga0070715_10000002
246 Ga0070716_100000010
247 Ga0070716_100011241
248 Ga0075428_100122203
249 Ga0075428_100240058
250 Ga0075433_10033040
251 Ga0068865_100008540
252 Ga0075436_100000006
253 Ga0075436_100003052
254 Ga0075436_100012304
255 Ga0097620_100079116
256 Ga0075435_100001651
257 Ga0075435_100002530
258 Ga0099794_10000688
259 Ga0111539_10005719
260 Ga0111539_10034897
261 Ga0111539_10093373
262 Ga0114129_10009735
263 Ga0114129_10045687
264 Ga0114129_10046392
265 Ga0114129_10129544
266 Ga0105243_10000338
267 Ga0105243_10000859
268 Ga0105243_10054744
269 Ga0105242_10000080
270 Ga0105242_10020606
271 Ga0105248_10048195
272 Ga0105248_10131953
273 Ga0105238_10006680
274 Ga0105249_10004522
275 Ga0105249_10005471
276 Ga0105249_10016896
277 Ga0105249_10050201
278 Ga0105239_10125039
279 Ga0157373_10019353
280 Ga0157378_10000094
281 Ga0157378_10064985
282 Ga0157378_10069294
283 Ga0157378_10125923
284 Ga0163162_10003391
285 Ga0163162_10070236
286 Ga0157375_10005225
287 Ga0157375_10033924
288 Ga0163163_10000188
289 Ga0163163_10019770
290 Ga0157380_10027176
291 Ga0157380_10035662
292 Ga0157380_10043346
293 Ga0163161_10061491
294 Ga0207653_10000018
295 Ga0207653_10000190
296 Ga0207685_10000030
297 Ga0207699_10000048
298 Ga0207643_10035455
299 Ga0207707_10000015
300 Ga0207663_10000012
301 Ga0207660_10002047
302 Ga0207662_10003556
303 Ga0207662_10009336
304 Ga0207652_10001437
305 Ga0207646_10003844
306 Ga0207681_10001684
307 Ga0207694_10003572
308 Ga0207650_10000006
309 Ga0207690_10006586
310 Ga0207706_10073008
311 Ga0207686_10000109
312 Ga0207686_10021939
313 Ga0207709_10000025
314 Ga0207709_10025614
315 Ga0207670_10078764
316 Ga0207665_10000010
317 Ga0207665_10086094
318 Ga0207691_10012717
319 Ga0207689_10010481
320 Ga0207679_10005767
321 Ga0207651_10109207
322 Ga0207712_10015900
323 Ga0207639_10021280
324 Ga0207708_10005260
325 Ga0207708_10010351
326 Ga0207708_10082127
327 Ga0207641_10131000
328 Ga0207676_10101527
329 Ga0207674_10001516
330 Ga0207675_100001533
331 Ga0207675_100004412
332 Ga0207675_100009883
333 Ga0207675_100030597
334 Ga0207428_10055218
335 Ga0207428_10090715
336 Ga0207428_10095931
337 Ga0307408_100040164
338 Ga0307410_10023618
339 Ga0307406_10011092
340 Ga0307411_10002983
341 Ga0373942_0009225
342 Ga0395905_0031168
343 Ga0242420_001857
344 Ga0453683_0053424
345 Ga0495663_0004114
346 Ga0495598_0000178
347 Ga0495621_0000157
348 Ga0496106_0006116
349 Ga0501038_0002371
350 nmdc:mga05p37_114368_c1
351 nmdc:mga05p37_44504_c1
352 nmdc:mga05p37_69215_c1
353 nmdc:mga08y16_14640_c1
354 nmdc:mga08y16_35875_c1
355 nmdc:mga0rr50_2359_c1
356 nmdc:mga08x19_13_c1
357 nmdc:mga08x19_7319_c1
358 nmdc:mga08x19_7_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07593

UnbV_ASPIC

ASPIC and UnbV

531

598

0.94

PF13517

FG-GAP_3

FG-GAP-like repeat

149

222

0.89

PF13517

FG-GAP_3

FG-GAP-like repeat

360

426

0.88

PF13517

FG-GAP_3

FG-GAP-like repeat

304

371

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hq1-assembly1.cif.gz_D crystal structure of human lgi1-adam22 complex in space group c2 0.5757 88 458
5e6s-assembly3.cif.gz_E structures of leukocyte integrin alb2: the ai domain, the headpiece, and the pocket for the internal ligand 0.5453 217 457
7zei-assembly4.cif.gz_D thermostable gh159 glycoside hydrolase from caldicellulosiruptor at 1.7 a 0.5447 73 412
2p4o-assembly1.cif.gz_A crystal structure of a putative lactonase of the smp-30/gluconolactonase/lre-like region family (npun_f0524) from nostoc punctiforme pcc 73102 at 1.90 a resolution 0.5437 37 456
4csd-assembly2.cif.gz_B structure of monomeric ralstonia solanacearum lectin 0.5392 90 460
ID Description Score Start End Superfamily
af_A1XF92_202_447_2.130.10.130 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Integrin alpha, N-terminal 0.7549 230 459 2.130.10.130
af_A1XF92_202_447_2.130.10.130 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Integrin alpha, N-terminal 0.6691 230 459 2.130.10.130
af_P76655_254_342_2.60.40.3110 Mainly Beta;Sandwich;Immunoglobulin-like;Outer membrane usher protein 0.6474 482 540 2.60.40.3110
af_Q99KW9_185_610_2.130.10.130 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Integrin alpha, N-terminal 0.6221 247 546 2.130.10.130
af_A0A1D6N1K5_130_400_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6139 219 459 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A2V9NS08-F1-model_v4 CRTAC1 family protein 0.9556 246 551
AF-A0A2V9JIR5-F1-model_v4 ASPIC/UnbV domain-containing protein 0.9552 267 553
AF-A0A6B0XD11-F1-model_v4 CRTAC1 family protein 0.951 362 551
AF-A0A2V9N7A3-F1-model_v4 ASPIC/UnbV domain-containing protein 0.9506 309 551
AF-A0A1Z8M4C8-F1-model_v4 ASPIC/UnbV domain-containing protein 0.9484 303 551

Map