F273524

General Info

Members Datasets Scaffolds Average Seq Length
179 121 358 170

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100056083|Ga0068856_1000560832
Length 182
Sequence MRGAHKRQMMELNELRALVRDVPDFPKPGILFRDITPLIGHARAFAALVDMMAAPFLGKVDTVLGIESRGFIIGAPVAYRLGVGLTIARKPGKLPFHTIGETYDLEYGSAGLEVHEDGMVRGARVLIVDDLLATGGTAVATINLAQKLQASIVSCAFVIELAALGGRKRIEPVQCFSLIQYD

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
51 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
52 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
54 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
82 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
83 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
84 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
88 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
89 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
90 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
91 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
92 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
95 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
96 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
97 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
98 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
99 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
100 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
101 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
102 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
103 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
104 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
105 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
106 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
107 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
116 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
117 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
118 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
119 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
120 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
121 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.23
Rhizosphere 95.53
Stem 0
Stem Tuber 0
Unclassified 6.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100056083 3300005614 Bacteria 3888
2 Ga0065715_10347519 3300005293 Bacteria 956
3 Ga0070676_10917752 3300005328 Bacteria 653
4 Ga0070683_100369022 3300005329 Bacteria 1367
5 Ga0070682_100000015 3300005337 Bacteria 249390
6 Ga0068868_100000813 3300005338 Bacteria 21171
7 Ga0068868_100863506 3300005338 Bacteria 820
8 Ga0070692_10314280 3300005345 Bacteria 961
9 Ga0070675_100000023 3300005354 Bacteria 122380
10 Ga0070673_100086420 3300005364 Bacteria 2555
11 Ga0070673_100445061 3300005364 Bacteria 1165
12 Ga0070667_100375869 3300005367 Bacteria 1290
13 Ga0070709_11384083 3300005434 Bacteria 569
14 Ga0070713_100730964 3300005436 Bacteria 946
15 Ga0070713_101400071 3300005436 Bacteria 678
16 Ga0070701_10000254 3300005438 Bacteria 17206
17 Ga0070708_100016281 3300005445 Bacteria 6166
18 Ga0070663_100567195 3300005455 Bacteria 951
19 Ga0070678_100041104 3300005456 Bacteria 3276
20 Ga0070706_100162844 3300005467 Bacteria 2083
21 Ga0070706_100210321 3300005467 Bacteria 1816
22 Ga0070706_100237975 3300005467 Bacteria 1700
23 Ga0070699_100037063 3300005518 Bacteria 4219
24 Ga0070699_100549819 3300005518 Bacteria 1051
25 Ga0070697_100039522 3300005536 Bacteria 3814
26 Ga0070672_100000828 3300005543 Bacteria 18508
27 Ga0070672_100756257 3300005543 Bacteria 853
28 Ga0070686_100262182 3300005544 Bacteria 1267
29 Ga0070693_100075898 3300005547 Bacteria 1991
30 Ga0070693_100189145 3300005547 Bacteria 1330
31 Ga0070665_100440301 3300005548 Bacteria 1312
32 Ga0070704_100362807 3300005549 Bacteria 1226
33 Ga0070704_100793266 3300005549 Bacteria 846
34 Ga0068855_100442635 3300005563 Bacteria 1419
35 Ga0068854_100964370 3300005578 Bacteria 753
36 Ga0068856_100948165 3300005614 Bacteria 879
37 Ga0068852_101053039 3300005616 Bacteria 833
38 Ga0068859_100100595 3300005617 Bacteria 2947
39 Ga0068864_100000009 3300005618 Bacteria 373756
40 Ga0068864_101700429 3300005618 Bacteria 636
41 Ga0068858_100001267 3300005842 Bacteria 26131
42 Ga0070716_100033096 3300006173 Bacteria 2825
43 Ga0070716_100129881 3300006173 Bacteria 1591
44 Ga0075428_100734789 3300006844 Bacteria 1051
45 Ga0075434_100165620 3300006871 Bacteria 2230
46 Ga0075434_100515544 3300006871 Bacteria 1216
47 Ga0075434_100850900 3300006871 Bacteria 927
48 Ga0075434_101100067 3300006871 Bacteria 808
49 Ga0075429_100218453 3300006880 Bacteria 1670
50 Ga0075436_100002425 3300006914 Bacteria 12848
51 Ga0075435_100000092 3300007076 Bacteria 48269
52 Ga0075435_100096093 3300007076 Bacteria 2451
53 Ga0105244_10008222 3300009036 Bacteria 6538
54 Ga0105240_10061147 3300009093 Bacteria 4694
55 Ga0105240_10114555 3300009093 Bacteria 3257
56 Ga0105240_10348609 3300009093 Unclassified 1680
57 Ga0111539_10415095 3300009094 Bacteria 1568
58 Ga0105245_10000214 3300009098 Bacteria 55083
59 Ga0105245_10005363 3300009098 Bacteria 11263
60 Ga0105245_10100007 3300009098 Bacteria 2682
61 Ga0105245_10556416 3300009098 Bacteria 1169
62 Ga0105245_12335765 3300009098 Bacteria 588
63 Ga0105247_10223275 3300009101 Bacteria 1276
64 Ga0114129_10144060 3300009147 Bacteria 3265
65 Ga0114129_10341502 3300009147 Bacteria 1986
66 Ga0114129_10822414 3300009147 Bacteria 1183
67 Ga0105239_10138148 3300010375 Bacteria 2714
68 Ga0157369_10644002 3300013105 Bacteria 1093
69 Ga0157378_10055269 3300013297 Bacteria 3536
70 Ga0163162_12225317 3300013306 Bacteria 629
71 Ga0157375_10000011 3300013308 Bacteria 334557
72 Ga0157380_10025015 3300014326 Bacteria 4524
73 Ga0157377_11176290 3300014745 Bacteria 592
74 Ga0213873_10045669 3300021358 Unclassified 1143
75 Ga0213876_10004123 3300021384 Bacteria 8166
76 Ga0224712_10223665 3300022467 Bacteria 862
77 Ga0228598_1054885 3300024227 Bacteria 791
78 Ga0207655_1030936 3300025728 Bacteria 2478
79 Ga0207684_10103182 3300025910 Bacteria 2438
80 Ga0207684_10161173 3300025910 Bacteria 1932
81 Ga0207684_10205567 3300025910 Bacteria 1699
82 Ga0207695_10019134 3300025913 Bacteria 7893
83 Ga0207695_10070727 3300025913 Bacteria 3565
84 Ga0207695_10211089 3300025913 Unclassified 1852
85 Ga0207671_10642305 3300025914 Bacteria 845
86 Ga0207646_10102734 3300025922 Bacteria 2563
87 Ga0207646_11217438 3300025922 Bacteria 660
88 Ga0207659_10000009 3300025926 Bacteria 308304
89 Ga0207659_10299182 3300025926 Bacteria 1321
90 Ga0207687_10001823 3300025927 Bacteria 14659
91 Ga0207687_10007779 3300025927 Bacteria 7030
92 Ga0207687_10723852 3300025927 Bacteria 846
93 Ga0207700_10731230 3300025928 Bacteria 884
94 Ga0207644_10269110 3300025931 Bacteria 1365
95 Ga0207686_10003949 3300025934 Bacteria 7950
96 Ga0207665_10019221 3300025939 Bacteria 4489
97 Ga0207665_10088817 3300025939 Bacteria 2139
98 Ga0207665_10813401 3300025939 Bacteria 739
99 Ga0207691_10002187 3300025940 Bacteria 19115
100 Ga0207691_10577954 3300025940 Bacteria 952
101 Ga0207689_10544112 3300025942 Bacteria 975
102 Ga0207689_11599898 3300025942 Bacteria 542
103 Ga0207661_10448948 3300025944 Bacteria 1174
104 Ga0207667_10121138 3300025949 Bacteria 2696
105 Ga0207651_10197258 3300025960 Bacteria 1610
106 Ga0207651_10954597 3300025960 Bacteria 765
107 Ga0207677_10000081 3300026023 Bacteria 78954
108 Ga0207677_11101457 3300026023 Bacteria 724
109 Ga0207677_11422018 3300026023 Bacteria 639
110 Ga0207703_10000213 3300026035 Bacteria 67884
111 Ga0207639_10000026 3300026041 Bacteria 205256
112 Ga0207678_10344063 3300026067 Bacteria 1285
113 Ga0207708_10000077 3300026075 Bacteria 77555
114 Ga0207702_10111600 3300026078 Bacteria 2432
115 Ga0207648_10228225 3300026089 Bacteria 1656
116 Ga0207648_10751164 3300026089 Bacteria 906
117 Ga0207676_10000007 3300026095 Bacteria 591074
118 Ga0207676_11093777 3300026095 Bacteria 788
119 Ga0207675_100380712 3300026118 Bacteria 1388
120 Ga0207683_10062179 3300026121 Bacteria 3288
121 Ga0207683_10469102 3300026121 Bacteria 1161
122 Ga0268266_11258931 3300028379 Bacteria 715
123 Ga0265334_10000034 3300028573 Bacteria 105710
124 Ga0265318_10046205 3300028577 Bacteria 1644
125 Ga0265332_10400274 3300031238 Bacteria 567
126 Ga0265340_10115388 3300031247 Bacteria 1238
127 Ga0265340_10199957 3300031247 Unclassified 899
128 Ga0265327_10002553 3300031251 Bacteria 18928
129 Ga0265316_10954243 3300031344 Bacteria 598
130 Ga0265342_10425222 3300031712 Bacteria 684
131 Ga0316583_10137940 3300032133 Bacteria 850
132 Ga0373929_0069201 3300035085 Bacteria 841
133 Ga0373941_0114962 3300035115 Bacteria 953
134 Ga0373941_0191118 3300035115 Bacteria 773
135 Ga0373957_0307728 3300035120 Bacteria 673
136 Ga0373927_0114513 3300035695 Bacteria 1758
137 Ga0373927_0390338 3300035695 Bacteria 918
138 Ga0436365_0133468 3300039437 Bacteria 12024
139 Ga0436365_0480831 3300039437 Unclassified 1645
140 Ga0436365_1689486 3300039437 Unclassified 703
141 Ga0436361_1207477 3300039447 Unclassified 1184
142 Ga0436362_0719692 3300039453 Bacteria 2859
143 Ga0436362_1073089 3300039453 Unclassified 1931
144 Ga0451577_0006168 3300042876 Bacteria 12046
145 Ga0453683_0022306 3300044673 Bacteria 4039
146 Ga0453684_0036033 3300044712 Bacteria 6826
147 Ga0453684_0647810 3300044712 Unclassified 1153
148 Ga0451576_0001681 3300045051 Bacteria 36675
149 Ga0451576_0002025 3300045051 Bacteria 32026
150 Ga0451576_0970795 3300045051 Bacteria 891
151 Ga0495653_0058841 3300046463 Bacteria 2920
152 Ga0495652_0171739 3300046529 Bacteria 1673
153 Ga0495623_0241893 3300046679 Bacteria 1019
154 Ga0495604_0021287 3300047317 Bacteria 5177
155 Ga0495674_0233656 3300047319 Unclassified 1517
156 Ga0495602_0048666 3300048088 Bacteria 3807
157 Ga0496104_0366155 3300048907 Bacteria 1354
158 Ga0496104_0831266 3300048907 Bacteria 829
159 Ga0496108_0426196 3300048911 Bacteria 1159
160 Ga0496110_0055030 3300048913 Bacteria 3501
161 Ga0501032_0575661 3300049569 Unclassified 717
162 Ga0501033_0020985 3300049570 Bacteria 4932
163 Ga0501036_0103490 3300049572 Bacteria 2408
164 Ga0501037_0030675 3300049573 Bacteria 3972
165 Ga0501038_0926579 3300049574 Bacteria 642
166 Ga0501046_0030392 3300049580 Bacteria 4384
167 Ga0501044_0080237 3300049823 Bacteria 3305
168 nmdc:mga05p37_328295_c1 3300050507 Bacteria 1808
169 nmdc:mga05p37_360871_c1 3300050507 Bacteria 1708
170 nmdc:mga05p37_491941_c1 3300050507 Bacteria 1410
171 nmdc:mga08y16_748620_c1 3300050511 Bacteria 973
172 nmdc:mga0n895_1032953_c1 3300050512 Bacteria 802
173 nmdc:mga0n895_111076_c1 3300050512 Unclassified 2757
174 nmdc:mga0n895_590858_c1 3300050512 Bacteria 1113
175 nmdc:mga0n895_793576_c1 3300050512 Bacteria 938
176 nmdc:mga0rr50_23543_c1 3300050513 Bacteria 4248
177 nmdc:mga0rr50_466_c1 3300050513 Bacteria 21532
178 nmdc:mga08x19_419_c1 3300050514 Bacteria 29565
179 Ga0495655_0000447 3300053083 Bacteria 6957
180 Ga0068856_100056083
181 Ga0065715_10347519
182 Ga0070676_10917752
183 Ga0070683_100369022
184 Ga0070682_100000015
185 Ga0068868_100000813
186 Ga0068868_100863506
187 Ga0070692_10314280
188 Ga0070675_100000023
189 Ga0070673_100086420
190 Ga0070673_100445061
191 Ga0070667_100375869
192 Ga0070709_11384083
193 Ga0070713_100730964
194 Ga0070713_101400071
195 Ga0070701_10000254
196 Ga0070708_100016281
197 Ga0070663_100567195
198 Ga0070678_100041104
199 Ga0070706_100162844
200 Ga0070706_100210321
201 Ga0070706_100237975
202 Ga0070699_100037063
203 Ga0070699_100549819
204 Ga0070697_100039522
205 Ga0070672_100000828
206 Ga0070672_100756257
207 Ga0070686_100262182
208 Ga0070693_100075898
209 Ga0070693_100189145
210 Ga0070665_100440301
211 Ga0070704_100362807
212 Ga0070704_100793266
213 Ga0068855_100442635
214 Ga0068854_100964370
215 Ga0068856_100948165
216 Ga0068852_101053039
217 Ga0068859_100100595
218 Ga0068864_100000009
219 Ga0068864_101700429
220 Ga0068858_100001267
221 Ga0070716_100033096
222 Ga0070716_100129881
223 Ga0075428_100734789
224 Ga0075434_100165620
225 Ga0075434_100515544
226 Ga0075434_100850900
227 Ga0075434_101100067
228 Ga0075429_100218453
229 Ga0075436_100002425
230 Ga0075435_100000092
231 Ga0075435_100096093
232 Ga0105244_10008222
233 Ga0105240_10061147
234 Ga0105240_10114555
235 Ga0105240_10348609
236 Ga0111539_10415095
237 Ga0105245_10000214
238 Ga0105245_10005363
239 Ga0105245_10100007
240 Ga0105245_10556416
241 Ga0105245_12335765
242 Ga0105247_10223275
243 Ga0114129_10144060
244 Ga0114129_10341502
245 Ga0114129_10822414
246 Ga0105239_10138148
247 Ga0157369_10644002
248 Ga0157378_10055269
249 Ga0163162_12225317
250 Ga0157375_10000011
251 Ga0157380_10025015
252 Ga0157377_11176290
253 Ga0213873_10045669
254 Ga0213876_10004123
255 Ga0224712_10223665
256 Ga0228598_1054885
257 Ga0207655_1030936
258 Ga0207684_10103182
259 Ga0207684_10161173
260 Ga0207684_10205567
261 Ga0207695_10019134
262 Ga0207695_10070727
263 Ga0207695_10211089
264 Ga0207671_10642305
265 Ga0207646_10102734
266 Ga0207646_11217438
267 Ga0207659_10000009
268 Ga0207659_10299182
269 Ga0207687_10001823
270 Ga0207687_10007779
271 Ga0207687_10723852
272 Ga0207700_10731230
273 Ga0207644_10269110
274 Ga0207686_10003949
275 Ga0207665_10019221
276 Ga0207665_10088817
277 Ga0207665_10813401
278 Ga0207691_10002187
279 Ga0207691_10577954
280 Ga0207689_10544112
281 Ga0207689_11599898
282 Ga0207661_10448948
283 Ga0207667_10121138
284 Ga0207651_10197258
285 Ga0207651_10954597
286 Ga0207677_10000081
287 Ga0207677_11101457
288 Ga0207677_11422018
289 Ga0207703_10000213
290 Ga0207639_10000026
291 Ga0207678_10344063
292 Ga0207708_10000077
293 Ga0207702_10111600
294 Ga0207648_10228225
295 Ga0207648_10751164
296 Ga0207676_10000007
297 Ga0207676_11093777
298 Ga0207675_100380712
299 Ga0207683_10062179
300 Ga0207683_10469102
301 Ga0268266_11258931
302 Ga0265334_10000034
303 Ga0265318_10046205
304 Ga0265332_10400274
305 Ga0265340_10115388
306 Ga0265340_10199957
307 Ga0265327_10002553
308 Ga0265316_10954243
309 Ga0265342_10425222
310 Ga0316583_10137940
311 Ga0373929_0069201
312 Ga0373941_0114962
313 Ga0373941_0191118
314 Ga0373957_0307728
315 Ga0373927_0114513
316 Ga0373927_0390338
317 Ga0436365_0133468
318 Ga0436365_0480831
319 Ga0436365_1689486
320 Ga0436361_1207477
321 Ga0436362_0719692
322 Ga0436362_1073089
323 Ga0451577_0006168
324 Ga0453683_0022306
325 Ga0453684_0036033
326 Ga0453684_0647810
327 Ga0451576_0001681
328 Ga0451576_0002025
329 Ga0451576_0970795
330 Ga0495653_0058841
331 Ga0495652_0171739
332 Ga0495623_0241893
333 Ga0495604_0021287
334 Ga0495674_0233656
335 Ga0495602_0048666
336 Ga0496104_0366155
337 Ga0496104_0831266
338 Ga0496108_0426196
339 Ga0496110_0055030
340 Ga0501032_0575661
341 Ga0501033_0020985
342 Ga0501036_0103490
343 Ga0501037_0030675
344 Ga0501038_0926579
345 Ga0501046_0030392
346 Ga0501044_0080237
347 nmdc:mga05p37_328295_c1
348 nmdc:mga05p37_360871_c1
349 nmdc:mga05p37_491941_c1
350 nmdc:mga08y16_748620_c1
351 nmdc:mga0n895_1032953_c1
352 nmdc:mga0n895_111076_c1
353 nmdc:mga0n895_590858_c1
354 nmdc:mga0n895_793576_c1
355 nmdc:mga0rr50_23543_c1
356 nmdc:mga0rr50_466_c1
357 nmdc:mga08x19_419_c1
358 Ga0495655_0000447

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

37

182

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4m0k-assembly2.cif.gz_D crystal structure of adenine phosphoribosyltransferase from rhodothermus marinus dsm 4252, nysgrc target 029775. 0.8887 3 160
4lza-assembly1.cif.gz_B crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. 0.8815 2 160
4m0k-assembly2.cif.gz_D crystal structure of adenine phosphoribosyltransferase from rhodothermus marinus dsm 4252, nysgrc target 029775. 0.8732 3 160
4lza-assembly1.cif.gz_B crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. 0.8713 2 160
4x44-assembly1.cif.gz_A-2 crystal structure of mutant r89q of human adenine phosphoribosyltransferase 0.8694 3 160
ID Description Score Start End Superfamily
4m0kC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8752 3 160 3.40.50.2020
af_P9WQ07_33_212_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.866 2 160 3.40.50.2020
4m0kC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.86 3 160 3.40.50.2020
af_P9WQ07_33_212_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8559 2 160 3.40.50.2020
af_P69503_1_183_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8525 1 160 3.40.50.2020
ID Description Score Start End GO Terms
AF-X1BDQ0-F1-model_v4 Adenine phosphoribosyltransferase 0.9663 6 78 GO:0003999
GO:0005737
GO:0006166
AF-A0A356WXL5-F1-model_v4 Adenine phosphoribosyltransferase 0.9636 4 86 GO:0003999
GO:0005737
GO:0006166
AF-A0A358EJ22-F1-model_v4 adenine phosphoribosyltransferase (EC 2.4.2.7) 0.954 1 84 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-A0A2V7L3D3-F1-model_v4 adenine phosphoribosyltransferase (EC 2.4.2.7) 0.9519 3 160 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-A0A7X5IG81-F1-model_v4 Adenine phosphoribosyltransferase 0.9408 6 87 GO:0003999
GO:0005737
GO:0006166

Map