F273180

General Info

Members Datasets Scaffolds Average Seq Length
179 113 358 731

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100017789|Ga0070683_1000177893
Length 788
Sequence MARRLLTLADLRSFSLETRFRRIGVSTTYRGPPDDSCVVRLNGRCPKATDMNRLAPRRTAKSPRTLARRAAVVILCVPLLFAPPDARAQAPRPKVGVAFGGGSARGIAHIGIIQWFEENHIPIDTAAGTSMGGLIGGAWATGMSAAELRAFVNGIDWDTMFGSSSFPFKNLRRKEDARSYPSRLEFGVKRGIVPPTSLNDGQQVDLLLARLTAPYYGIRSFDELPTPFRVVAVDLRAGEKVVLDSGSFATALRSTMSLPAVFPPVERDGKVLVDGGALNNIPADVVRDQHPSVVIAVSVGYAPTNTVNYSLFGLLGQSVDAMMKATTEAALKHADLVIAVDVEGFGSLDWRRADELIARGYQAAEKRRDELLKYRVSDEEWQVWLAQRQSRRKTEIPQPAFLKTEGFAKVDAAFVERTLTPHLDKPIDIPLLEYDLASMAGLDRYQSVTWQMVDEGGRSGLLVRASPKVYAPPFLMLGLNIENTTSEDFRVRLAARYLTFDKVGSGSELRIDGAIGADPNIAVALYNPIGGSRLFARSFAGAHTQTFGIVNQGAIVAEYRENRLGAGGGFGVNLSRTSEVLNADVRTGDPGLPKLAGSEVNGELHWVVDTQDSPVLPSRGTRAVARLDHIFDAPQIPDISRTNKDLTQFELYASTFHSLSLQNRVFAVLAGGTSFDGHPLPTDQFTLGFPYLLDAFGVGERRGDHYAVLTLGAAHRVTRLPDFLGGPVFASAWFQNGSAFNSHEKVDINSQLGLGIVADTLVGPVLIGGSFGFDGAFRLLFGVGRIFR

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
71 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
72 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
73 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
74 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
75 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
76 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
77 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
78 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
79 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
80 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
81 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
82 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
83 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
84 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
85 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
86 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
87 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
88 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
89 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
90 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
91 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
92 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
98 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
99 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
100 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
101 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
102 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
103 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
104 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
105 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
106 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
107 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
108 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
109 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
110 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
111 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
112 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
113 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.68
Nodule 0
Rhizoplane 3.35
Rhizosphere 94.97
Stem 0
Stem Tuber 0
Unclassified 13.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100017789 3300005329 Bacteria 6281
2 Ga0065707_10002239 3300005295 Bacteria 6576
3 Ga0065707_10004513 3300005295 Bacteria 4842
4 Ga0070683_100036561 3300005329 Bacteria 4494
5 Ga0070690_100003293 3300005330 Bacteria 8824
6 Ga0070670_100001035 3300005331 Bacteria 22011
7 Ga0070670_100014526 3300005331 Bacteria 6762
8 Ga0070670_100069512 3300005331 Unclassified 3023
9 Ga0070666_10012093 3300005335 Bacteria 5435
10 Ga0070680_100015350 3300005336 Bacteria 6003
11 Ga0068868_100021431 3300005338 Bacteria 4866
12 Ga0068868_100021912 3300005338 Bacteria 4817
13 Ga0070689_100019325 3300005340 Bacteria 5037
14 Ga0070661_100005632 3300005344 Bacteria 8630
15 Ga0070671_100039932 3300005355 Bacteria 3896
16 Ga0070674_100002410 3300005356 Bacteria 10326
17 Ga0070673_100041673 3300005364 Bacteria 3534
18 Ga0070705_100032117 3300005440 Bacteria 2914
19 Ga0070700_100040425 3300005441 Bacteria 2854
20 Ga0070663_100056117 3300005455 Unclassified 2821
21 Ga0070679_100001726 3300005530 Bacteria 19708
22 Ga0070686_100000416 3300005544 Bacteria 26875
23 Ga0070665_100006308 3300005548 Bacteria 12108
24 Ga0070664_100010613 3300005564 Bacteria 7465
25 Ga0068857_100001164 3300005577 Bacteria 20541
26 Ga0068854_100003166 3300005578 Bacteria 10262
27 Ga0068870_10004260 3300005840 Bacteria 6150
28 Ga0068858_100003394 3300005842 Bacteria 15847
29 Ga0068858_100094806 3300005842 Bacteria 2780
30 Ga0068862_100012551 3300005844 Bacteria 7014
31 Ga0097621_100044114 3300006237 Unclassified 3597
32 Ga0075370_10011672 3300006353 Bacteria 4623
33 Ga0068871_100025253 3300006358 Bacteria 4620
34 Ga0075428_100005365 3300006844 Bacteria 14248
35 Ga0075428_100006541 3300006844 Bacteria 12953
36 Ga0075428_100011631 3300006844 Bacteria 9792
37 Ga0075428_100014952 3300006844 Bacteria 8625
38 Ga0075428_100057891 3300006844 Bacteria 4243
39 Ga0075430_100000313 3300006846 Bacteria 34525
40 Ga0075430_100013748 3300006846 Bacteria 6897
41 Ga0075431_100000738 3300006847 Bacteria 28232
42 Ga0075431_100002550 3300006847 Bacteria 17586
43 Ga0075431_100003060 3300006847 Bacteria 16193
44 Ga0075431_100013259 3300006847 Bacteria 8325
45 Ga0075431_100065706 3300006847 Bacteria 3746
46 Ga0075434_100008786 3300006871 Bacteria 9406
47 Ga0075434_100039023 3300006871 Bacteria 4705
48 Ga0075429_100000088 3300006880 Bacteria 48640
49 Ga0075429_100004837 3300006880 Bacteria 11603
50 Ga0075429_100027191 3300006880 Bacteria 4965
51 Ga0075429_100064412 3300006880 Unclassified 3193
52 Ga0068865_100028682 3300006881 Bacteria 3686
53 Ga0075435_100002968 3300007076 Bacteria 11399
54 Ga0075435_100005168 3300007076 Bacteria 9078
55 Ga0111539_10000039 3300009094 Bacteria 139160
56 Ga0111539_10007999 3300009094 Bacteria 13488
57 Ga0111539_10021056 3300009094 Bacteria 8030
58 Ga0111539_10032981 3300009094 Bacteria 6287
59 Ga0111539_10072950 3300009094 Unclassified 4047
60 Ga0111539_10127206 3300009094 Unclassified 2985
61 Ga0105245_10017628 3300009098 Bacteria 6234
62 Ga0114129_10000335 3300009147 Bacteria 55044
63 Ga0114129_10000410 3300009147 Bacteria 50569
64 Ga0114129_10001221 3300009147 Bacteria 34159
65 Ga0114129_10017854 3300009147 Bacteria 10103
66 Ga0114129_10022609 3300009147 Bacteria 8918
67 Ga0114129_10211045 3300009147 Bacteria 2625
68 Ga0105242_10001863 3300009176 Bacteria 16553
69 Ga0105242_10088986 3300009176 Bacteria 2594
70 Ga0105248_10028348 3300009177 Bacteria 6239
71 Ga0105249_10021740 3300009553 Bacteria 5744
72 Ga0105249_10025193 3300009553 Bacteria 5352
73 Ga0163163_10053109 3300014325 Unclassified 3999
74 Ga0157380_10007382 3300014326 Bacteria 7804
75 Ga0157379_10016786 3300014968 Bacteria 6444
76 Ga0157376_10009147 3300014969 Bacteria 7183
77 Ga0207688_10003598 3300025901 Bacteria 8460
78 Ga0207645_10005409 3300025907 Bacteria 9260
79 Ga0207643_10005550 3300025908 Bacteria 6741
80 Ga0207662_10009764 3300025918 Bacteria 5293
81 Ga0207652_10008775 3300025921 Bacteria 8139
82 Ga0207681_10019591 3300025923 Bacteria 4276
83 Ga0207650_10013482 3300025925 Bacteria 5662
84 Ga0207704_10001510 3300025938 Bacteria 10444
85 Ga0207691_10012681 3300025940 Bacteria 8073
86 Ga0207711_10023930 3300025941 Bacteria 5111
87 Ga0207711_10082405 3300025941 Unclassified 2812
88 Ga0207661_10032648 3300025944 Bacteria 4036
89 Ga0207661_10102111 3300025944 Bacteria 2410
90 Ga0207651_10005625 3300025960 Bacteria 6457
91 Ga0207712_10011565 3300025961 Bacteria 5626
92 Ga0207640_10056226 3300025981 Bacteria 2581
93 Ga0207677_10014787 3300026023 Bacteria 4570
94 Ga0207677_10042629 3300026023 Unclassified 3011
95 Ga0207677_10059231 3300026023 Bacteria 2641
96 Ga0207678_10010098 3300026067 Bacteria 8282
97 Ga0207678_10029163 3300026067 Bacteria 4816
98 Ga0207708_10004447 3300026075 Bacteria 10334
99 Ga0207648_10039205 3300026089 Bacteria 4166
100 Ga0207648_10053923 3300026089 Bacteria 3513
101 Ga0207674_10013817 3300026116 Bacteria 8932
102 Ga0207674_10060468 3300026116 Unclassified 3830
103 Ga0207675_100017695 3300026118 Bacteria 6649
104 Ga0207428_10002696 3300027907 Bacteria 17696
105 Ga0207428_10007095 3300027907 Bacteria 10258
106 Ga0207428_10018254 3300027907 Bacteria 5996
107 Ga0268266_10006176 3300028379 Bacteria 11012
108 Ga0307408_100006722 3300031548 Bacteria 7626
109 Ga0307408_100007744 3300031548 Bacteria 7104
110 Ga0307408_100037870 3300031548 Bacteria 3399
111 Ga0307406_10036280 3300031901 Unclassified 3037
112 Ga0307416_100014501 3300032002 Bacteria 5406
113 Ga0307411_10007355 3300032005 Bacteria 5601
114 Ga0373950_0001295 3300034818 Bacteria 3237
115 Ga0373938_0002623 3300034957 Unclassified 2901
116 Ga0373929_0001131 3300035085 Bacteria 5163
117 Ga0373940_0001654 3300035088 Bacteria 4110
118 Ga0373949_0000220 3300035090 Bacteria 21606
119 Ga0373932_0001085 3300035112 Bacteria 7836
120 Ga0373960_0000019 3300035121 Bacteria 20370
121 Ga0373942_0000799 3300035207 Bacteria 8673
122 Ga0373962_0002041 3300035242 Bacteria 4812
123 Ga0373931_0007583 3300035691 Bacteria 5112
124 Ga0450908_000435 3300042184 Bacteria 8086
125 Ga0439464_0000964 3300042439 Bacteria 6514
126 Ga0451576_0023442 3300045051 Bacteria 6682
127 Ga0495645_0003559 3300046543 Bacteria 10547
128 Ga0495658_0020627 3300046683 Bacteria 3462
129 Ga0496106_0091760 3300048909 Unclassified 2345
130 Ga0496108_0001710 3300048911 Bacteria 17383
131 Ga0496109_0000798 3300048912 Bacteria 26241
132 Ga0496111_0033768 3300048914 Unclassified 3650
133 Ga0496112_0060052 3300048915 Bacteria 3746
134 Ga0496114_0056268 3300048917 Bacteria 3282
135 Ga0501036_0094966 3300049572 Bacteria 2520
136 Ga0501040_0020762 3300049576 Bacteria 4380
137 Ga0501042_0033024 3300049578 Unclassified 3667
138 Ga0501042_0065169 3300049578 Bacteria 2604
139 Ga0501046_0030665 3300049580 Unclassified 4363
140 Ga0501048_0061027 3300049582 Bacteria 2671
141 Ga0501071_0030291 3300049587 Unclassified 3827
142 Ga0501072_0021341 3300049588 Bacteria 5024
143 Ga0501072_0048880 3300049588 Bacteria 3330
144 Ga0501074_0045924 3300049590 Unclassified 3159
145 Ga0501075_0033688 3300049591 Unclassified 3811
146 Ga0501075_0038910 3300049591 Unclassified 3557
147 Ga0501075_0093187 3300049591 Unclassified 2287
148 Ga0501076_0041272 3300049592 Unclassified 3629
149 Ga0501076_0083438 3300049592 Bacteria 2566
150 Ga0501080_0069385 3300049742 Unclassified 3278
151 nmdc:mga00v17_3302_c1 3300050491 Bacteria 8320
152 nmdc:mga06z11_32750_c1 3300050494 Bacteria 2537
153 nmdc:mga05p37_20153_c1 3300050507 Bacteria 8069
154 nmdc:mga05p37_230_c1 3300050507 Bacteria 56762
155 nmdc:mga05p37_27698_c1 3300050507 Bacteria 6903
156 nmdc:mga05p37_39943_c1 3300050507 Bacteria 5761
157 nmdc:mga05p37_54_c2 3300050507 Bacteria 73831
158 nmdc:mga05p37_6761_c1 3300050507 Bacteria 13520
159 nmdc:mga05p37_93165_c1 3300050507 Bacteria 3712
160 nmdc:mga09592_10969_c1 3300050508 Bacteria 7370
161 nmdc:mga09592_135115_c1 3300050508 Bacteria 2124
162 nmdc:mga09592_13531_c1 3300050508 Bacteria 6663
163 nmdc:mga06r32_3004_c1 3300050510 Bacteria 15109
164 nmdc:mga06r32_37555_c1 3300050510 Unclassified 4582
165 nmdc:mga06r32_47961_c1 3300050510 Bacteria 4082
166 nmdc:mga06r32_579_c1 3300050510 Bacteria 31881
167 nmdc:mga08y16_108152_c1 3300050511 Bacteria 2895
168 nmdc:mga08y16_2279_c1 3300050511 Bacteria 19663
169 nmdc:mga08y16_2870_c1 3300050511 Bacteria 17731
170 nmdc:mga08y16_30921_c1 3300050511 Bacteria 5630
171 nmdc:mga0n895_34090_c1 3300050512 Bacteria 4898
172 nmdc:mga0n895_58182_c1 3300050512 Bacteria 3810
173 nmdc:mga0rr50_1608_c1 3300050513 Bacteria 12426
174 nmdc:mga0rr50_27151_c1 3300050513 Bacteria 4004
175 nmdc:mga0rr50_3916_c1 3300050513 Bacteria 8663
176 nmdc:mga0a205_19129_c1 3300050515 Bacteria 6456
177 Ga0495619_0009460 3300053085 Bacteria 6147
178 Ga0495619_0061076 3300053085 Bacteria 2507
179 Ga0530510_0006796 3300061734 Bacteria 7968
180 Ga0070683_100017789
181 Ga0065707_10002239
182 Ga0065707_10004513
183 Ga0070683_100036561
184 Ga0070690_100003293
185 Ga0070670_100001035
186 Ga0070670_100014526
187 Ga0070670_100069512
188 Ga0070666_10012093
189 Ga0070680_100015350
190 Ga0068868_100021431
191 Ga0068868_100021912
192 Ga0070689_100019325
193 Ga0070661_100005632
194 Ga0070671_100039932
195 Ga0070674_100002410
196 Ga0070673_100041673
197 Ga0070705_100032117
198 Ga0070700_100040425
199 Ga0070663_100056117
200 Ga0070679_100001726
201 Ga0070686_100000416
202 Ga0070665_100006308
203 Ga0070664_100010613
204 Ga0068857_100001164
205 Ga0068854_100003166
206 Ga0068870_10004260
207 Ga0068858_100003394
208 Ga0068858_100094806
209 Ga0068862_100012551
210 Ga0097621_100044114
211 Ga0075370_10011672
212 Ga0068871_100025253
213 Ga0075428_100005365
214 Ga0075428_100006541
215 Ga0075428_100011631
216 Ga0075428_100014952
217 Ga0075428_100057891
218 Ga0075430_100000313
219 Ga0075430_100013748
220 Ga0075431_100000738
221 Ga0075431_100002550
222 Ga0075431_100003060
223 Ga0075431_100013259
224 Ga0075431_100065706
225 Ga0075434_100008786
226 Ga0075434_100039023
227 Ga0075429_100000088
228 Ga0075429_100004837
229 Ga0075429_100027191
230 Ga0075429_100064412
231 Ga0068865_100028682
232 Ga0075435_100002968
233 Ga0075435_100005168
234 Ga0111539_10000039
235 Ga0111539_10007999
236 Ga0111539_10021056
237 Ga0111539_10032981
238 Ga0111539_10072950
239 Ga0111539_10127206
240 Ga0105245_10017628
241 Ga0114129_10000335
242 Ga0114129_10000410
243 Ga0114129_10001221
244 Ga0114129_10017854
245 Ga0114129_10022609
246 Ga0114129_10211045
247 Ga0105242_10001863
248 Ga0105242_10088986
249 Ga0105248_10028348
250 Ga0105249_10021740
251 Ga0105249_10025193
252 Ga0163163_10053109
253 Ga0157380_10007382
254 Ga0157379_10016786
255 Ga0157376_10009147
256 Ga0207688_10003598
257 Ga0207645_10005409
258 Ga0207643_10005550
259 Ga0207662_10009764
260 Ga0207652_10008775
261 Ga0207681_10019591
262 Ga0207650_10013482
263 Ga0207704_10001510
264 Ga0207691_10012681
265 Ga0207711_10023930
266 Ga0207711_10082405
267 Ga0207661_10032648
268 Ga0207661_10102111
269 Ga0207651_10005625
270 Ga0207712_10011565
271 Ga0207640_10056226
272 Ga0207677_10014787
273 Ga0207677_10042629
274 Ga0207677_10059231
275 Ga0207678_10010098
276 Ga0207678_10029163
277 Ga0207708_10004447
278 Ga0207648_10039205
279 Ga0207648_10053923
280 Ga0207674_10013817
281 Ga0207674_10060468
282 Ga0207675_100017695
283 Ga0207428_10002696
284 Ga0207428_10007095
285 Ga0207428_10018254
286 Ga0268266_10006176
287 Ga0307408_100006722
288 Ga0307408_100007744
289 Ga0307408_100037870
290 Ga0307406_10036280
291 Ga0307416_100014501
292 Ga0307411_10007355
293 Ga0373950_0001295
294 Ga0373938_0002623
295 Ga0373929_0001131
296 Ga0373940_0001654
297 Ga0373949_0000220
298 Ga0373932_0001085
299 Ga0373960_0000019
300 Ga0373942_0000799
301 Ga0373962_0002041
302 Ga0373931_0007583
303 Ga0450908_000435
304 Ga0439464_0000964
305 Ga0451576_0023442
306 Ga0495645_0003559
307 Ga0495658_0020627
308 Ga0496106_0091760
309 Ga0496108_0001710
310 Ga0496109_0000798
311 Ga0496111_0033768
312 Ga0496112_0060052
313 Ga0496114_0056268
314 Ga0501036_0094966
315 Ga0501040_0020762
316 Ga0501042_0033024
317 Ga0501042_0065169
318 Ga0501046_0030665
319 Ga0501048_0061027
320 Ga0501071_0030291
321 Ga0501072_0021341
322 Ga0501072_0048880
323 Ga0501074_0045924
324 Ga0501075_0033688
325 Ga0501075_0038910
326 Ga0501075_0093187
327 Ga0501076_0041272
328 Ga0501076_0083438
329 Ga0501080_0069385
330 nmdc:mga00v17_3302_c1
331 nmdc:mga06z11_32750_c1
332 nmdc:mga05p37_20153_c1
333 nmdc:mga05p37_230_c1
334 nmdc:mga05p37_27698_c1
335 nmdc:mga05p37_39943_c1
336 nmdc:mga05p37_54_c2
337 nmdc:mga05p37_6761_c1
338 nmdc:mga05p37_93165_c1
339 nmdc:mga09592_10969_c1
340 nmdc:mga09592_135115_c1
341 nmdc:mga09592_13531_c1
342 nmdc:mga06r32_3004_c1
343 nmdc:mga06r32_37555_c1
344 nmdc:mga06r32_47961_c1
345 nmdc:mga06r32_579_c1
346 nmdc:mga08y16_108152_c1
347 nmdc:mga08y16_2279_c1
348 nmdc:mga08y16_2870_c1
349 nmdc:mga08y16_30921_c1
350 nmdc:mga0n895_34090_c1
351 nmdc:mga0n895_58182_c1
352 nmdc:mga0rr50_1608_c1
353 nmdc:mga0rr50_27151_c1
354 nmdc:mga0rr50_3916_c1
355 nmdc:mga0a205_19129_c1
356 Ga0495619_0009460
357 Ga0495619_0061076
358 Ga0530510_0006796

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01734

Patatin

Patatin-like phospholipase

97

287

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fya-assembly1.cif.gz_A cubic crystal of the native plpd 0.9362 27 307
5fya-assembly1.cif.gz_A cubic crystal of the native plpd 0.929 27 307
5fqu-assembly1.cif.gz_B orthorhombic crystal structure of of plpd (selenomethionine derivative) 0.9269 26 307
5fqu-assembly1.cif.gz_A orthorhombic crystal structure of of plpd (selenomethionine derivative) 0.9216 26 307
5fqu-assembly1.cif.gz_B orthorhombic crystal structure of of plpd (selenomethionine derivative) 0.9196 26 307
ID Description Score Start End Superfamily
2x8xX01 Alpha Beta;Roll;Ubiquitin-like (UB roll);membrane protein fhac 0.816 331 401 3.10.20.310
4c00A04 Mainly Beta;Beta Barrel;Porin;membrane protein fhac: a member of the omp85/tpsb transporter family 0.7834 409 726 2.40.160.50
af_O69695_801_1044_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.7824 27 288 3.40.1090.10
af_O69695_801_1044_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.7705 27 288 3.40.1090.10
af_Q10478_139_474_2.40.160.50 Mainly Beta;Beta Barrel;Porin;membrane protein fhac: a member of the omp85/tpsb transporter family 0.7697 426 730 2.40.160.50
ID Description Score Start End GO Terms
AF-A0A7Y5Q4J4-F1-model_v4 Patatin-like phospholipase family protein 0.9325 20 729 GO:0004622
GO:0016042
GO:0019867
GO:0046470
AF-A0A2W0BHJ2-F1-model_v4 Patatin 0.9297 18 729 GO:0016042
GO:0016787
AF-A0A534ALV0-F1-model_v4 Patatin-like phospholipase family protein 0.9151 18 280 GO:0016042
GO:0016787
AF-A0A272EW17-F1-model_v4 Haemolysin activator HlyB C-terminal domain-containing protein 0.9143 496 726
AF-A0A534AXL7-F1-model_v4 PNPLA domain-containing protein 0.9134 54 726 GO:0016042
GO:0016787
GO:0019867

Map