F273110

General Info

Members Datasets Scaffolds Average Seq Length
179 126 177 158

Family's Representative Sequence

Representative Sequence 3300005288|Ga0065714_10003796|Ga0065714_1000379627
Length 166
Sequence VDIFDEEILNFWRALQEYNVQYIMVGGYATNLHGYQRFTGDLDIWLKDTLENRKQLRKAFVKCDMGDYPLIETMQFILGWTDFHLNNGLRLDILIEMKGLEGYTFDECLEMASIADIDNVNVPFLHINQLIENKKIVNRPKDQIDVAALEQIRKLRDDFXFDTICF

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738543023 Pedobacter sp. OK628 Isolate Unclassified
3 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
58 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
59 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
86 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
89 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
90 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
97 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
98 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
99 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
100 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
101 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
102 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
103 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
104 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
105 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
106 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
107 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
108 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
109 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
110 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
111 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
112 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
113 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
116 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
123 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
124 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
125 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
126 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.32
Metatranscriptomes 0.56
Isolates 1.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.35
Nodule 0
Rhizoplane 1.12
Rhizosphere 86.59
Stem 0
Stem Tuber 0
Unclassified 8.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1494727 2162886007 Bacteria 34556
2 rootH2_10006302 3300003320 Bacteria 47168
3 rootH2_10076397 3300003320 Unclassified 2713
4 rootH2_10222155 3300003320 Bacteria 2333
5 rootH2_10289179 3300003320 Unclassified 1734
6 rootL2_10147654 3300003322 Bacteria 2537
7 rootL2_10207179 3300003322 Bacteria 2711
8 rootH1_10314718 3300003323 Bacteria 3563
9 Ga0065714_10003796 3300005288 Bacteria 20147
10 Ga0065714_10019464 3300005288 Bacteria 1356
11 Ga0065704_10070204 3300005289 Bacteria 85748
12 Ga0070658_10732914 3300005327 Bacteria 858
13 Ga0070676_10140457 3300005328 Unclassified 1537
14 Ga0070683_101095316 3300005329 Bacteria 765
15 Ga0070670_100041711 3300005331 Bacteria 3943
16 Ga0070670_100919447 3300005331 Bacteria 794
17 Ga0068869_100529424 3300005334 Bacteria 987
18 Ga0070666_10003275 3300005335 Bacteria 9832
19 Ga0070680_100403000 3300005336 Bacteria 1166
20 Ga0068868_100022166 3300005338 Bacteria 4791
21 Ga0070660_100007758 3300005339 Bacteria 7484
22 Ga0070691_10267181 3300005341 Bacteria 923
23 Ga0070671_100008099 3300005355 Bacteria 8416
24 Ga0070673_100069661 3300005364 Bacteria 2820
25 Ga0070659_100004632 3300005366 Bacteria 9825
26 Ga0068867_100165746 3300005459 Bacteria 1746
27 Ga0070679_100373553 3300005530 Unclassified 1373
28 Ga0068853_100417414 3300005539 Bacteria 1258
29 Ga0068853_101211631 3300005539 Bacteria 729
30 Ga0070672_100076624 3300005543 Bacteria 2672
31 Ga0068855_100003370 3300005563 Bacteria 19566
32 Ga0068855_100082706 3300005563 Bacteria 3720
33 Ga0070664_100126311 3300005564 Bacteria 2244
34 Ga0068857_100003942 3300005577 Bacteria 12490
35 Ga0068854_100004069 3300005578 Bacteria 9185
36 Ga0068854_100024969 3300005578 Unclassified 4099
37 Ga0068856_100029749 3300005614 Bacteria 5336
38 Ga0068852_100011304 3300005616 Bacteria 6715
39 Ga0068852_100054366 3300005616 Bacteria 3451
40 Ga0068866_10355932 3300005718 Bacteria 932
41 Ga0068851_10081200 3300005834 Bacteria 1693
42 Ga0075366_10002067 3300006195 Bacteria 10197
43 Ga0097621_100000033 3300006237 Bacteria 69289
44 Ga0097621_100026729 3300006237 Bacteria 4531
45 Ga0068871_100000020 3300006358 Bacteria 84930
46 Ga0068871_100035174 3300006358 Bacteria 3978
47 Ga0068871_100324186 3300006358 Bacteria 1357
48 Ga0105240_10018663 3300009093 Bacteria 9295
49 Ga0105240_10167517 3300009093 Bacteria 2605
50 Ga0105240_10511605 3300009093 Bacteria 1334
51 Ga0105241_10317734 3300009174 Bacteria 1342
52 Ga0105237_10032399 3300009545 Bacteria 5291
53 Ga0105237_10121790 3300009545 Unclassified 2603
54 Ga0105237_10136282 3300009545 Unclassified 2449
55 Ga0105237_10392396 3300009545 Unclassified 1393
56 Ga0105237_10430985 3300009545 Bacteria 1324
57 Ga0105238_10009544 3300009551 Bacteria 9709
58 Ga0105238_11260936 3300009551 Unclassified 764
59 Ga0105238_12677566 3300009551 Bacteria 535
60 Ga0105239_11400492 3300010375 Bacteria 807
61 Ga0157373_10000290 3300013100 Bacteria 40415
62 Ga0157373_10047018 3300013100 Unclassified 3078
63 Ga0157373_10051012 3300013100 Bacteria 2946
64 Ga0157373_11156983 3300013100 Bacteria 582
65 Ga0157371_10000438 3300013102 Bacteria 51021
66 Ga0157370_10204195 3300013104 Unclassified 1833
67 Ga0157374_10016221 3300013296 Bacteria 6546
68 Ga0157374_10037837 3300013296 Bacteria 4431
69 Ga0157378_10027784 3300013297 Bacteria 4990
70 Ga0163162_10055141 3300013306 Bacteria 4000
71 Ga0157372_10001359 3300013307 Bacteria 26477
72 Ga0157372_10046766 3300013307 Bacteria 4805
73 Ga0157372_10139988 3300013307 Unclassified 2787
74 Ga0157372_10525083 3300013307 Bacteria 1380
75 Ga0157372_10540146 3300013307 Bacteria 1359
76 Ga0157372_10598232 3300013307 Unclassified 1285
77 Ga0157375_10017370 3300013308 Bacteria 6490
78 Ga0157375_10067557 3300013308 Bacteria 3572
79 Ga0157375_10341559 3300013308 Bacteria 1663
80 Ga0163163_10030721 3300014325 Bacteria 5179
81 Ga0157377_10003522 3300014745 Bacteria 7086
82 Ga0157379_10034212 3300014968 Bacteria 4529
83 Ga0157376_10274419 3300014969 Bacteria 1585
84 Ga0182006_1006531 3300015261 Bacteria 5412
85 Ga0163161_10000530 3300017792 Bacteria 31199
86 Ga0163161_10915260 3300017792 Bacteria 744
87 Ga0206356_11782394 3300020070 Bacteria 777
88 Ga0213872_10069090 3300021361 Bacteria 1593
89 Ga0209026_1001760 3300025250 Bacteria 8975
90 Ga0207656_10235633 3300025321 Bacteria 893
91 Ga0207642_10368794 3300025899 Bacteria 852
92 Ga0207680_10003332 3300025903 Bacteria 7564
93 Ga0207647_10027522 3300025904 Bacteria 3706
94 Ga0207645_10344256 3300025907 Bacteria 997
95 Ga0207705_10621164 3300025909 Unclassified 840
96 Ga0207654_10352082 3300025911 Bacteria 1014
97 Ga0207695_10157873 3300025913 Unclassified 2202
98 Ga0207695_10505648 3300025913 Bacteria 1090
99 Ga0207671_10018671 3300025914 Bacteria 5314
100 Ga0207657_10023261 3300025919 Bacteria 5773
101 Ga0207652_10332069 3300025921 Unclassified 1373
102 Ga0207694_10004728 3300025924 Bacteria 10594
103 Ga0207694_10865638 3300025924 Unclassified 764
104 Ga0207650_10008401 3300025925 Bacteria 7049
105 Ga0207659_10116772 3300025926 Bacteria 2038
106 Ga0207690_10003137 3300025932 Bacteria 9933
107 Ga0207706_10801470 3300025933 Unclassified 800
108 Ga0207679_10159462 3300025945 Bacteria 1845
109 Ga0207667_10000412 3300025949 Bacteria 57917
110 Ga0207667_10080798 3300025949 Bacteria 3368
111 Ga0207651_10262192 3300025960 Bacteria 1419
112 Ga0207640_10018515 3300025981 Bacteria 4095
113 Ga0207677_10017600 3300026023 Bacteria 4267
114 Ga0207677_10678313 3300026023 Bacteria 912
115 Ga0207648_10018848 3300026089 Bacteria 6237
116 Ga0207648_11403410 3300026089 Unclassified 656
117 Ga0207674_10002240 3300026116 Bacteria 24495
118 Ga0207698_10025215 3300026142 Bacteria 4185
119 Ga0207698_10126534 3300026142 Bacteria 2174
120 Ga0209968_1007957 3300027526 Bacteria 1610
121 Ga0209999_1008385 3300027543 Unclassified 1862
122 Ga0307517_10024726 3300028786 Bacteria 7385
123 Ga0307515_10018401 3300028794 Bacteria 12647
124 Ga0307515_10041625 3300028794 Bacteria 7214
125 Ga0307412_10000023 3300031911 Bacteria 237005
126 Ga0307414_10001191 3300032004 Bacteria 13367
127 Ga0307507_10000015 3300033179 Bacteria 237419
128 Ga0307510_10000365 3300033180 Bacteria 42827
129 Ga0307510_10012066 3300033180 Bacteria 10244
130 Ga0395899_0000001 3300037312 Bacteria 1750322
131 Ga0395899_0000269 3300037312 Bacteria 68033
132 Ga0395899_0003043 3300037312 Bacteria 13394
133 Ga0395900_0000251 3300037418 Bacteria 83846
134 Ga0395900_0009360 3300037418 Bacteria 10045
135 Ga0395898_0048564 3300037466 Bacteria 4161
136 Ga0395905_0000495 3300037471 Bacteria 54122
137 Ga0395905_0000579 3300037471 Bacteria 49357
138 Ga0395901_0000145 3300038443 Bacteria 91739
139 Ga0395901_0001854 3300038443 Bacteria 21864
140 Ga0466968_0129635 3300044735 Bacteria 1147
141 Ga0495585_0003576 3300046492 Bacteria 10431
142 Ga0495606_0030637 3300046507 Bacteria 3755
143 Ga0495610_0000512 3300046512 Bacteria 39304
144 Ga0495616_0005183 3300046513 Bacteria 8071
145 Ga0495648_0003649 3300046524 Bacteria 13464
146 Ga0495648_0160871 3300046524 Unclassified 1161
147 Ga0495654_0109228 3300046530 Bacteria 1264
148 Ga0495622_0025974 3300046557 Bacteria 2737
149 Ga0495633_0000044 3300046558 Bacteria 171185
150 Ga0495633_0000864 3300046558 Bacteria 26390
151 Ga0495668_0000011 3300046616 Bacteria 472186
152 Ga0495625_0000009 3300046660 Bacteria 404954
153 Ga0495625_0000873 3300046660 Bacteria 41027
154 Ga0495625_0016686 3300046660 Bacteria 5769
155 Ga0495661_0051788 3300046665 Bacteria 2477
156 Ga0495658_0103829 3300046683 Bacteria 1700
157 Ga0495649_0000008 3300046694 Bacteria 483706
158 Ga0495683_0015215 3300047323 Bacteria 4006
159 Ga0495686_0001314 3300047472 Bacteria 27885
160 Ga0495686_0021135 3300047472 Bacteria 4329
161 Ga0495614_0005414 3300048089 Bacteria 5758
162 Ga0496105_0351077 3300048908 Unclassified 1178
163 Ga0496108_0220338 3300048911 Bacteria 1649
164 Ga0495682_0056939 3300049460 Bacteria 1416
165 Ga0501033_0213669 3300049570 Unclassified 1375
166 Ga0501038_0753328 3300049574 Unclassified 726
167 Ga0501039_0185071 3300049575 Bacteria 1638
168 Ga0501043_0012244 3300049579 Bacteria 6705
169 Ga0501043_0270068 3300049579 Unclassified 1306
170 Ga0501035_0350451 3300049822 Bacteria 1235
171 Ga0501035_0631876 3300049822 Unclassified 870
172 Ga0501044_0158929 3300049823 Unclassified 2238
173 nmdc:mga0k408_1117_c1 3300050493 Bacteria 13717
174 Ga0500651_0000464 3300053093 Bacteria 21441
175 Ga0500618_000002 3300053125 Bacteria 370822
176 Ga0500658_0363294 3300053134 Bacteria 664
177 Ga0500622_0047194 3300053156 Bacteria 2225

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005578 Ga0068854_100024969 Ga0068854_1000249692 135
2 3300005614 Ga0068856_100029749 Ga0068856_1000297494 135
3 3300025924 Ga0207694_10004728 Ga0207694_100047284 135
4 3300026116 Ga0207674_10002240 Ga0207674_100022403 135
5 3300005331 Ga0070670_100919447 Ga0070670_1009194472 136
6 3300005336 Ga0070680_100403000 Ga0070680_1004030002 136
7 3300009545 Ga0105237_10121790 Ga0105237_101217902 136
8 3300013307 Ga0157372_10139988 Ga0157372_101399882 136
9 3300025907 Ga0207645_10344256 Ga0207645_103442562 136
10 3300047472 Ga0495686_0021135 Ga0495686_0021135_3265_3678 136
11 3300053134 Ga0500658_0363294 Ga0500658_0363294_36_446 136
12 iso_pu_bacteria 2775506987 2776612631 140
13 3300053093 Ga0500651_0000464 Ga0500651_0000464_20211_20681 145
14 3300037312 Ga0395899_0000269 Ga0395899_0000269_17979_18509 153
15 3300037418 Ga0395900_0000251 Ga0395900_0000251_20781_21311 153
16 3300037466 Ga0395898_0048564 Ga0395898_0048564_1730_2260 153
17 3300037471 Ga0395905_0000495 Ga0395905_0000495_31390_31920 153
18 3300038443 Ga0395901_0000145 Ga0395901_0000145_8241_8771 153
19 iso_pu_bacteria 2738543023 2739301433 155
20 3300009551 Ga0105238_11260936 Ga0105238_112609361 157
21 3300025924 Ga0207694_10865638 Ga0207694_108656381 157
22 3300037312 Ga0395899_0003043 Ga0395899_0003043_12267_12740 157
23 3300037418 Ga0395900_0009360 Ga0395900_0009360_6200_6673 157
24 3300037471 Ga0395905_0000579 Ga0395905_0000579_4283_4756 157
25 3300038443 Ga0395901_0001854 Ga0395901_0001854_10855_11328 157
26 3300003320 rootH2_10006302 rootH2_1000630239 158
27 3300003320 rootH2_10222155 rootH2_102221552 158
28 3300003320 rootH2_10289179 rootH2_102891793 158
29 3300003322 rootL2_10207179 rootL2_102071792 158
30 3300003323 rootH1_10314718 rootH1_103147184 158
31 3300005329 Ga0070683_101095316 Ga0070683_1010953162 158
32 3300005338 Ga0068868_100022166 Ga0068868_1000221665 158
33 3300005341 Ga0070691_10267181 Ga0070691_102671813 158
34 3300005539 Ga0068853_101211631 Ga0068853_1012116312 158
35 3300005563 Ga0068855_100003370 Ga0068855_10000337013 158
36 3300005577 Ga0068857_100003942 Ga0068857_10000394213 158
37 3300005616 Ga0068852_100054366 Ga0068852_1000543662 158
38 3300006237 Ga0097621_100000033 Ga0097621_10000003348 158
39 3300006237 Ga0097621_100026729 Ga0097621_1000267292 158
40 3300006358 Ga0068871_100000020 Ga0068871_10000002051 158
41 3300006358 Ga0068871_100035174 Ga0068871_1000351746 158
42 3300009093 Ga0105240_10018663 Ga0105240_100186634 158
43 3300009174 Ga0105241_10317734 Ga0105241_103177343 158
44 3300009545 Ga0105237_10392396 Ga0105237_103923963 158
45 3300009551 Ga0105238_10009544 Ga0105238_100095446 158
46 3300013100 Ga0157373_10047018 Ga0157373_100470183 158
47 3300013100 Ga0157373_10051012 Ga0157373_100510122 158
48 3300013100 Ga0157373_11156983 Ga0157373_111569831 158
49 3300013104 Ga0157370_10204195 Ga0157370_102041952 158
50 3300013297 Ga0157378_10027784 Ga0157378_100277844 158
51 3300013306 Ga0163162_10055141 Ga0163162_100551413 158
52 3300013307 Ga0157372_10001359 Ga0157372_100013599 158
53 3300013307 Ga0157372_10046766 Ga0157372_100467664 158
54 3300013307 Ga0157372_10525083 Ga0157372_105250833 158
55 3300013308 Ga0157375_10067557 Ga0157375_100675575 158
56 3300014745 Ga0157377_10003522 Ga0157377_100035225 158
57 3300014968 Ga0157379_10034212 Ga0157379_100342122 158
58 3300014969 Ga0157376_10274419 Ga0157376_102744192 158
59 3300017792 Ga0163161_10915260 Ga0163161_109152602 158
60 3300020070 Ga0206356_11782394 Ga0206356_117823941 158
61 3300021361 Ga0213872_10069090 Ga0213872_100690903 158
62 3300025904 Ga0207647_10027522 Ga0207647_100275223 158
63 3300025911 Ga0207654_10352082 Ga0207654_103520822 158
64 3300025913 Ga0207695_10157873 Ga0207695_101578733 158
65 3300025949 Ga0207667_10000412 Ga0207667_1000041237 158
66 3300026023 Ga0207677_10017600 Ga0207677_100176005 158
67 3300026089 Ga0207648_11403410 Ga0207648_114034101 158
68 3300026142 Ga0207698_10126534 Ga0207698_101265342 158
69 3300027526 Ga0209968_1007957 Ga0209968_10079572 158
70 3300027543 Ga0209999_1008385 Ga0209999_10083853 158
71 3300037312 Ga0395899_0000001 Ga0395899_0000001_1749193_1749669 158
72 3300048908 Ga0496105_0351077 Ga0496105_0351077_530_1015 158
73 3300053156 Ga0500622_0047194 Ga0500622_0047194_1275_1751 158
74 2162886007 SwRhRL2b_contig_1494727 SwRhRL2b_0150.00010430 159
75 3300003320 rootH2_10076397 rootH2_100763972 159
76 3300003322 rootL2_10147654 rootL2_101476542 159
77 3300005288 Ga0065714_10003796 Ga0065714_1000379627 159
78 3300005288 Ga0065714_10019464 Ga0065714_100194641 159
79 3300005289 Ga0065704_10070204 Ga0065704_1007020461 159
80 3300005327 Ga0070658_10732914 Ga0070658_107329141 159
81 3300005328 Ga0070676_10140457 Ga0070676_101404572 159
82 3300005331 Ga0070670_100041711 Ga0070670_1000417112 159
83 3300005334 Ga0068869_100529424 Ga0068869_1005294242 159
84 3300005335 Ga0070666_10003275 Ga0070666_100032757 159
85 3300005339 Ga0070660_100007758 Ga0070660_1000077584 159
86 3300005355 Ga0070671_100008099 Ga0070671_1000080994 159
87 3300005364 Ga0070673_100069661 Ga0070673_1000696612 159
88 3300005366 Ga0070659_100004632 Ga0070659_1000046329 159
89 3300005459 Ga0068867_100165746 Ga0068867_1001657462 159
90 3300005530 Ga0070679_100373553 Ga0070679_1003735534 159
91 3300005539 Ga0068853_100417414 Ga0068853_1004174142 159
92 3300005543 Ga0070672_100076624 Ga0070672_1000766243 159
93 3300005563 Ga0068855_100082706 Ga0068855_1000827064 159
94 3300005564 Ga0070664_100126311 Ga0070664_1001263112 159
95 3300005578 Ga0068854_100004069 Ga0068854_1000040696 159
96 3300005616 Ga0068852_100011304 Ga0068852_1000113045 159
97 3300005718 Ga0068866_10355932 Ga0068866_103559321 159
98 3300005834 Ga0068851_10081200 Ga0068851_100812002 159
99 3300006195 Ga0075366_10002067 Ga0075366_100020677 159
100 3300006358 Ga0068871_100324186 Ga0068871_1003241862 159
101 3300009093 Ga0105240_10167517 Ga0105240_101675172 159
102 3300009093 Ga0105240_10511605 Ga0105240_105116052 159
103 3300009545 Ga0105237_10032399 Ga0105237_100323992 159
104 3300009545 Ga0105237_10136282 Ga0105237_101362823 159
105 3300009545 Ga0105237_10430985 Ga0105237_104309852 159
106 3300009551 Ga0105238_12677566 Ga0105238_126775661 159
107 3300010375 Ga0105239_11400492 Ga0105239_114004922 159
108 3300013100 Ga0157373_10000290 Ga0157373_1000029022 159
109 3300013102 Ga0157371_10000438 Ga0157371_1000043852 159
110 3300013296 Ga0157374_10016221 Ga0157374_100162215 159
111 3300013296 Ga0157374_10037837 Ga0157374_100378373 159
112 3300013307 Ga0157372_10540146 Ga0157372_105401461 159
113 3300013307 Ga0157372_10598232 Ga0157372_105982323 159
114 3300013308 Ga0157375_10017370 Ga0157375_100173708 159
115 3300013308 Ga0157375_10341559 Ga0157375_103415592 159
116 3300014325 Ga0163163_10030721 Ga0163163_100307215 159
117 3300015261 Ga0182006_1006531 Ga0182006_10065318 159
118 3300017792 Ga0163161_10000530 Ga0163161_1000053031 159
119 3300025250 Ga0209026_1001760 Ga0209026_10017603 159
120 3300025321 Ga0207656_10235633 Ga0207656_102356332 159
121 3300025899 Ga0207642_10368794 Ga0207642_103687941 159
122 3300025903 Ga0207680_10003332 Ga0207680_100033324 159
123 3300025909 Ga0207705_10621164 Ga0207705_106211642 159
124 3300025913 Ga0207695_10505648 Ga0207695_105056482 159
125 3300025914 Ga0207671_10018671 Ga0207671_100186715 159
126 3300025919 Ga0207657_10023261 Ga0207657_100232618 159
127 3300025921 Ga0207652_10332069 Ga0207652_103320692 159
128 3300025925 Ga0207650_10008401 Ga0207650_100084012 159
129 3300025926 Ga0207659_10116772 Ga0207659_101167722 159
130 3300025932 Ga0207690_10003137 Ga0207690_100031379 159
131 3300025933 Ga0207706_10801470 Ga0207706_108014702 159
132 3300025945 Ga0207679_10159462 Ga0207679_101594622 159
133 3300025949 Ga0207667_10080798 Ga0207667_100807982 159
134 3300025960 Ga0207651_10262192 Ga0207651_102621921 159
135 3300025981 Ga0207640_10018515 Ga0207640_100185152 159
136 3300026023 Ga0207677_10678313 Ga0207677_106783132 159
137 3300026089 Ga0207648_10018848 Ga0207648_100188487 159
138 3300026142 Ga0207698_10025215 Ga0207698_100252154 159
139 3300028786 Ga0307517_10024726 Ga0307517_100247263 159
140 3300028794 Ga0307515_10018401 Ga0307515_1001840111 159
141 3300028794 Ga0307515_10041625 Ga0307515_100416258 159
142 3300031911 Ga0307412_10000023 Ga0307412_10000023113 159
143 3300032004 Ga0307414_10001191 Ga0307414_100011914 159
144 3300033179 Ga0307507_10000015 Ga0307507_10000015122 159
145 3300033180 Ga0307510_10000365 Ga0307510_1000036516 159
146 3300033180 Ga0307510_10012066 Ga0307510_100120664 159
147 3300044735 Ga0466968_0129635 Ga0466968_0129635_438_917 159
148 3300046492 Ga0495585_0003576 Ga0495585_0003576_840_1319 159
149 3300046507 Ga0495606_0030637 Ga0495606_0030637_2756_3235 159
150 3300046512 Ga0495610_0000512 Ga0495610_0000512_2532_3014 159
151 3300046513 Ga0495616_0005183 Ga0495616_0005183_4325_4807 159
152 3300046524 Ga0495648_0003649 Ga0495648_0003649_5686_6165 159
153 3300046524 Ga0495648_0160871 Ga0495648_0160871_551_1030 159
154 3300046530 Ga0495654_0109228 Ga0495654_0109228_389_868 159
155 3300046557 Ga0495622_0025974 Ga0495622_0025974_989_1468 159
156 3300046558 Ga0495633_0000044 Ga0495633_0000044_8665_9147 159
157 3300046558 Ga0495633_0000864 Ga0495633_0000864_10465_10947 159
158 3300046616 Ga0495668_0000011 Ga0495668_0000011_144139_144618 159
159 3300046660 Ga0495625_0000009 Ga0495625_0000009_228940_229422 159
160 3300046660 Ga0495625_0000873 Ga0495625_0000873_9361_9840 159
161 3300046660 Ga0495625_0016686 Ga0495625_0016686_3784_4263 159
162 3300046665 Ga0495661_0051788 Ga0495661_0051788_1434_1916 159
163 3300046683 Ga0495658_0103829 Ga0495658_0103829_963_1442 159
164 3300046694 Ga0495649_0000008 Ga0495649_0000008_19666_20148 159
165 3300047323 Ga0495683_0015215 Ga0495683_0015215_3468_3947 159
166 3300047472 Ga0495686_0001314 Ga0495686_0001314_212_691 159
167 3300048089 Ga0495614_0005414 Ga0495614_0005414_2536_3015 159
168 3300048911 Ga0496108_0220338 Ga0496108_0220338_414_908 159
169 3300049460 Ga0495682_0056939 Ga0495682_0056939_497_976 159
170 3300049570 Ga0501033_0213669 Ga0501033_0213669_274_762 159
171 3300049574 Ga0501038_0753328 Ga0501038_0753328_139_627 159
172 3300049575 Ga0501039_0185071 Ga0501039_0185071_194_682 159
173 3300049579 Ga0501043_0012244 Ga0501043_0012244_5466_5954 159
174 3300049579 Ga0501043_0270068 Ga0501043_0270068_671_1165 159
175 3300049822 Ga0501035_0350451 Ga0501035_0350451_193_681 159
176 3300049822 Ga0501035_0631876 Ga0501035_0631876_319_813 159
177 3300049823 Ga0501044_0158929 Ga0501044_0158929_1152_1640 159
178 3300050493 nmdc:mga0k408_1117_c1 nmdc:mga0k408_1117_c1_5464_5943 159
179 3300053125 Ga0500618_000002 Ga0500618_000002_353947_354426 159

Structural Annotation

Top 5 Hits

ID Description Score Start End
8an5-assembly1.cif.gz_A menat1 toxin-antitoxin complex (rv0078a-rv0078b) from mycobacterium tuberculosis h37rv 0.7178 13 152
8an5-assembly1.cif.gz_B menat1 toxin-antitoxin complex (rv0078a-rv0078b) from mycobacterium tuberculosis h37rv 0.7062 9 152
8an4-assembly2.cif.gz_B ment1 toxin (rv0078a) from mycobacterium tuberculosis h37rv 0.6986 9 152
8an4-assembly1.cif.gz_A ment1 toxin (rv0078a) from mycobacterium tuberculosis h37rv 0.6679 6 152
8an5-assembly1.cif.gz_B menat1 toxin-antitoxin complex (rv0078a-rv0078b) from mycobacterium tuberculosis h37rv 0.6471 9 152
ID Description Score Start End Superfamily
af_L7N686_1_158_3.30.460.40 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.6884 1 149 3.30.460.40
2ewrA00 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.67 8 158 3.30.460.40
af_L7N686_1_158_3.30.460.40 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.65 1 149 3.30.460.40
2ewrA00 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.6288 8 158 3.30.460.40
4e8iA00 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.6067 1 152 3.30.460.40
ID Description Score Start End GO Terms
AF-A0A4R8DHH6-F1-model_v4 Nucleotidyltransferase DUF2204 0.992 1 159
AF-A0A556MIM3-F1-model_v4 Nucleotidyltransferase family protein 0.9891 1 158
AF-A0A7W8YSG1-F1-model_v4 Nucleotidyltransferase 0.9789 1 62
AF-A0A5S5DRW9-F1-model_v4 Nucleotidyltransferase DUF2204 0.9784 1 108
AF-A0A556MIM3-F1-model_v4 Nucleotidyltransferase family protein 0.9769 1 158

Feature Viewer

pLDDT pTM Quality
92.81 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map