F273110
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 179 | 126 | 177 | 158 |
Family's Representative Sequence
| Representative Sequence | 3300005288|Ga0065714_10003796|Ga0065714_1000379627 |
| Length | 166 |
| Sequence | VDIFDEEILNFWRALQEYNVQYIMVGGYATNLHGYQRFTGDLDIWLKDTLENRKQLRKAFVKCDMGDYPLIETMQFILGWTDFHLNNGLRLDILIEMKGLEGYTFDECLEMASIADIDNVNVPFLHINQLIENKKIVNRPKDQIDVAALEQIRKLRDDFXFDTICF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 3 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 33 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 34 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 35 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 37 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 55 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 57 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 58 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 59 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 86 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 87 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 88 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 89 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 90 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 91 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 92 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 93 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 94 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 95 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 96 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 97 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 114 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 115 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 117 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 118 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 119 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 120 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 121 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 123 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 124 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 125 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 126 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.32 |
| Metatranscriptomes | 0.56 |
| Isolates | 1.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.35 |
| Nodule | 0 |
| Rhizoplane | 1.12 |
| Rhizosphere | 86.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1494727 | 2162886007 | Bacteria | 34556 |
| 2 | rootH2_10006302 | 3300003320 | Bacteria | 47168 |
| 3 | rootH2_10076397 | 3300003320 | Unclassified | 2713 |
| 4 | rootH2_10222155 | 3300003320 | Bacteria | 2333 |
| 5 | rootH2_10289179 | 3300003320 | Unclassified | 1734 |
| 6 | rootL2_10147654 | 3300003322 | Bacteria | 2537 |
| 7 | rootL2_10207179 | 3300003322 | Bacteria | 2711 |
| 8 | rootH1_10314718 | 3300003323 | Bacteria | 3563 |
| 9 | Ga0065714_10003796 | 3300005288 | Bacteria | 20147 |
| 10 | Ga0065714_10019464 | 3300005288 | Bacteria | 1356 |
| 11 | Ga0065704_10070204 | 3300005289 | Bacteria | 85748 |
| 12 | Ga0070658_10732914 | 3300005327 | Bacteria | 858 |
| 13 | Ga0070676_10140457 | 3300005328 | Unclassified | 1537 |
| 14 | Ga0070683_101095316 | 3300005329 | Bacteria | 765 |
| 15 | Ga0070670_100041711 | 3300005331 | Bacteria | 3943 |
| 16 | Ga0070670_100919447 | 3300005331 | Bacteria | 794 |
| 17 | Ga0068869_100529424 | 3300005334 | Bacteria | 987 |
| 18 | Ga0070666_10003275 | 3300005335 | Bacteria | 9832 |
| 19 | Ga0070680_100403000 | 3300005336 | Bacteria | 1166 |
| 20 | Ga0068868_100022166 | 3300005338 | Bacteria | 4791 |
| 21 | Ga0070660_100007758 | 3300005339 | Bacteria | 7484 |
| 22 | Ga0070691_10267181 | 3300005341 | Bacteria | 923 |
| 23 | Ga0070671_100008099 | 3300005355 | Bacteria | 8416 |
| 24 | Ga0070673_100069661 | 3300005364 | Bacteria | 2820 |
| 25 | Ga0070659_100004632 | 3300005366 | Bacteria | 9825 |
| 26 | Ga0068867_100165746 | 3300005459 | Bacteria | 1746 |
| 27 | Ga0070679_100373553 | 3300005530 | Unclassified | 1373 |
| 28 | Ga0068853_100417414 | 3300005539 | Bacteria | 1258 |
| 29 | Ga0068853_101211631 | 3300005539 | Bacteria | 729 |
| 30 | Ga0070672_100076624 | 3300005543 | Bacteria | 2672 |
| 31 | Ga0068855_100003370 | 3300005563 | Bacteria | 19566 |
| 32 | Ga0068855_100082706 | 3300005563 | Bacteria | 3720 |
| 33 | Ga0070664_100126311 | 3300005564 | Bacteria | 2244 |
| 34 | Ga0068857_100003942 | 3300005577 | Bacteria | 12490 |
| 35 | Ga0068854_100004069 | 3300005578 | Bacteria | 9185 |
| 36 | Ga0068854_100024969 | 3300005578 | Unclassified | 4099 |
| 37 | Ga0068856_100029749 | 3300005614 | Bacteria | 5336 |
| 38 | Ga0068852_100011304 | 3300005616 | Bacteria | 6715 |
| 39 | Ga0068852_100054366 | 3300005616 | Bacteria | 3451 |
| 40 | Ga0068866_10355932 | 3300005718 | Bacteria | 932 |
| 41 | Ga0068851_10081200 | 3300005834 | Bacteria | 1693 |
| 42 | Ga0075366_10002067 | 3300006195 | Bacteria | 10197 |
| 43 | Ga0097621_100000033 | 3300006237 | Bacteria | 69289 |
| 44 | Ga0097621_100026729 | 3300006237 | Bacteria | 4531 |
| 45 | Ga0068871_100000020 | 3300006358 | Bacteria | 84930 |
| 46 | Ga0068871_100035174 | 3300006358 | Bacteria | 3978 |
| 47 | Ga0068871_100324186 | 3300006358 | Bacteria | 1357 |
| 48 | Ga0105240_10018663 | 3300009093 | Bacteria | 9295 |
| 49 | Ga0105240_10167517 | 3300009093 | Bacteria | 2605 |
| 50 | Ga0105240_10511605 | 3300009093 | Bacteria | 1334 |
| 51 | Ga0105241_10317734 | 3300009174 | Bacteria | 1342 |
| 52 | Ga0105237_10032399 | 3300009545 | Bacteria | 5291 |
| 53 | Ga0105237_10121790 | 3300009545 | Unclassified | 2603 |
| 54 | Ga0105237_10136282 | 3300009545 | Unclassified | 2449 |
| 55 | Ga0105237_10392396 | 3300009545 | Unclassified | 1393 |
| 56 | Ga0105237_10430985 | 3300009545 | Bacteria | 1324 |
| 57 | Ga0105238_10009544 | 3300009551 | Bacteria | 9709 |
| 58 | Ga0105238_11260936 | 3300009551 | Unclassified | 764 |
| 59 | Ga0105238_12677566 | 3300009551 | Bacteria | 535 |
| 60 | Ga0105239_11400492 | 3300010375 | Bacteria | 807 |
| 61 | Ga0157373_10000290 | 3300013100 | Bacteria | 40415 |
| 62 | Ga0157373_10047018 | 3300013100 | Unclassified | 3078 |
| 63 | Ga0157373_10051012 | 3300013100 | Bacteria | 2946 |
| 64 | Ga0157373_11156983 | 3300013100 | Bacteria | 582 |
| 65 | Ga0157371_10000438 | 3300013102 | Bacteria | 51021 |
| 66 | Ga0157370_10204195 | 3300013104 | Unclassified | 1833 |
| 67 | Ga0157374_10016221 | 3300013296 | Bacteria | 6546 |
| 68 | Ga0157374_10037837 | 3300013296 | Bacteria | 4431 |
| 69 | Ga0157378_10027784 | 3300013297 | Bacteria | 4990 |
| 70 | Ga0163162_10055141 | 3300013306 | Bacteria | 4000 |
| 71 | Ga0157372_10001359 | 3300013307 | Bacteria | 26477 |
| 72 | Ga0157372_10046766 | 3300013307 | Bacteria | 4805 |
| 73 | Ga0157372_10139988 | 3300013307 | Unclassified | 2787 |
| 74 | Ga0157372_10525083 | 3300013307 | Bacteria | 1380 |
| 75 | Ga0157372_10540146 | 3300013307 | Bacteria | 1359 |
| 76 | Ga0157372_10598232 | 3300013307 | Unclassified | 1285 |
| 77 | Ga0157375_10017370 | 3300013308 | Bacteria | 6490 |
| 78 | Ga0157375_10067557 | 3300013308 | Bacteria | 3572 |
| 79 | Ga0157375_10341559 | 3300013308 | Bacteria | 1663 |
| 80 | Ga0163163_10030721 | 3300014325 | Bacteria | 5179 |
| 81 | Ga0157377_10003522 | 3300014745 | Bacteria | 7086 |
| 82 | Ga0157379_10034212 | 3300014968 | Bacteria | 4529 |
| 83 | Ga0157376_10274419 | 3300014969 | Bacteria | 1585 |
| 84 | Ga0182006_1006531 | 3300015261 | Bacteria | 5412 |
| 85 | Ga0163161_10000530 | 3300017792 | Bacteria | 31199 |
| 86 | Ga0163161_10915260 | 3300017792 | Bacteria | 744 |
| 87 | Ga0206356_11782394 | 3300020070 | Bacteria | 777 |
| 88 | Ga0213872_10069090 | 3300021361 | Bacteria | 1593 |
| 89 | Ga0209026_1001760 | 3300025250 | Bacteria | 8975 |
| 90 | Ga0207656_10235633 | 3300025321 | Bacteria | 893 |
| 91 | Ga0207642_10368794 | 3300025899 | Bacteria | 852 |
| 92 | Ga0207680_10003332 | 3300025903 | Bacteria | 7564 |
| 93 | Ga0207647_10027522 | 3300025904 | Bacteria | 3706 |
| 94 | Ga0207645_10344256 | 3300025907 | Bacteria | 997 |
| 95 | Ga0207705_10621164 | 3300025909 | Unclassified | 840 |
| 96 | Ga0207654_10352082 | 3300025911 | Bacteria | 1014 |
| 97 | Ga0207695_10157873 | 3300025913 | Unclassified | 2202 |
| 98 | Ga0207695_10505648 | 3300025913 | Bacteria | 1090 |
| 99 | Ga0207671_10018671 | 3300025914 | Bacteria | 5314 |
| 100 | Ga0207657_10023261 | 3300025919 | Bacteria | 5773 |
| 101 | Ga0207652_10332069 | 3300025921 | Unclassified | 1373 |
| 102 | Ga0207694_10004728 | 3300025924 | Bacteria | 10594 |
| 103 | Ga0207694_10865638 | 3300025924 | Unclassified | 764 |
| 104 | Ga0207650_10008401 | 3300025925 | Bacteria | 7049 |
| 105 | Ga0207659_10116772 | 3300025926 | Bacteria | 2038 |
| 106 | Ga0207690_10003137 | 3300025932 | Bacteria | 9933 |
| 107 | Ga0207706_10801470 | 3300025933 | Unclassified | 800 |
| 108 | Ga0207679_10159462 | 3300025945 | Bacteria | 1845 |
| 109 | Ga0207667_10000412 | 3300025949 | Bacteria | 57917 |
| 110 | Ga0207667_10080798 | 3300025949 | Bacteria | 3368 |
| 111 | Ga0207651_10262192 | 3300025960 | Bacteria | 1419 |
| 112 | Ga0207640_10018515 | 3300025981 | Bacteria | 4095 |
| 113 | Ga0207677_10017600 | 3300026023 | Bacteria | 4267 |
| 114 | Ga0207677_10678313 | 3300026023 | Bacteria | 912 |
| 115 | Ga0207648_10018848 | 3300026089 | Bacteria | 6237 |
| 116 | Ga0207648_11403410 | 3300026089 | Unclassified | 656 |
| 117 | Ga0207674_10002240 | 3300026116 | Bacteria | 24495 |
| 118 | Ga0207698_10025215 | 3300026142 | Bacteria | 4185 |
| 119 | Ga0207698_10126534 | 3300026142 | Bacteria | 2174 |
| 120 | Ga0209968_1007957 | 3300027526 | Bacteria | 1610 |
| 121 | Ga0209999_1008385 | 3300027543 | Unclassified | 1862 |
| 122 | Ga0307517_10024726 | 3300028786 | Bacteria | 7385 |
| 123 | Ga0307515_10018401 | 3300028794 | Bacteria | 12647 |
| 124 | Ga0307515_10041625 | 3300028794 | Bacteria | 7214 |
| 125 | Ga0307412_10000023 | 3300031911 | Bacteria | 237005 |
| 126 | Ga0307414_10001191 | 3300032004 | Bacteria | 13367 |
| 127 | Ga0307507_10000015 | 3300033179 | Bacteria | 237419 |
| 128 | Ga0307510_10000365 | 3300033180 | Bacteria | 42827 |
| 129 | Ga0307510_10012066 | 3300033180 | Bacteria | 10244 |
| 130 | Ga0395899_0000001 | 3300037312 | Bacteria | 1750322 |
| 131 | Ga0395899_0000269 | 3300037312 | Bacteria | 68033 |
| 132 | Ga0395899_0003043 | 3300037312 | Bacteria | 13394 |
| 133 | Ga0395900_0000251 | 3300037418 | Bacteria | 83846 |
| 134 | Ga0395900_0009360 | 3300037418 | Bacteria | 10045 |
| 135 | Ga0395898_0048564 | 3300037466 | Bacteria | 4161 |
| 136 | Ga0395905_0000495 | 3300037471 | Bacteria | 54122 |
| 137 | Ga0395905_0000579 | 3300037471 | Bacteria | 49357 |
| 138 | Ga0395901_0000145 | 3300038443 | Bacteria | 91739 |
| 139 | Ga0395901_0001854 | 3300038443 | Bacteria | 21864 |
| 140 | Ga0466968_0129635 | 3300044735 | Bacteria | 1147 |
| 141 | Ga0495585_0003576 | 3300046492 | Bacteria | 10431 |
| 142 | Ga0495606_0030637 | 3300046507 | Bacteria | 3755 |
| 143 | Ga0495610_0000512 | 3300046512 | Bacteria | 39304 |
| 144 | Ga0495616_0005183 | 3300046513 | Bacteria | 8071 |
| 145 | Ga0495648_0003649 | 3300046524 | Bacteria | 13464 |
| 146 | Ga0495648_0160871 | 3300046524 | Unclassified | 1161 |
| 147 | Ga0495654_0109228 | 3300046530 | Bacteria | 1264 |
| 148 | Ga0495622_0025974 | 3300046557 | Bacteria | 2737 |
| 149 | Ga0495633_0000044 | 3300046558 | Bacteria | 171185 |
| 150 | Ga0495633_0000864 | 3300046558 | Bacteria | 26390 |
| 151 | Ga0495668_0000011 | 3300046616 | Bacteria | 472186 |
| 152 | Ga0495625_0000009 | 3300046660 | Bacteria | 404954 |
| 153 | Ga0495625_0000873 | 3300046660 | Bacteria | 41027 |
| 154 | Ga0495625_0016686 | 3300046660 | Bacteria | 5769 |
| 155 | Ga0495661_0051788 | 3300046665 | Bacteria | 2477 |
| 156 | Ga0495658_0103829 | 3300046683 | Bacteria | 1700 |
| 157 | Ga0495649_0000008 | 3300046694 | Bacteria | 483706 |
| 158 | Ga0495683_0015215 | 3300047323 | Bacteria | 4006 |
| 159 | Ga0495686_0001314 | 3300047472 | Bacteria | 27885 |
| 160 | Ga0495686_0021135 | 3300047472 | Bacteria | 4329 |
| 161 | Ga0495614_0005414 | 3300048089 | Bacteria | 5758 |
| 162 | Ga0496105_0351077 | 3300048908 | Unclassified | 1178 |
| 163 | Ga0496108_0220338 | 3300048911 | Bacteria | 1649 |
| 164 | Ga0495682_0056939 | 3300049460 | Bacteria | 1416 |
| 165 | Ga0501033_0213669 | 3300049570 | Unclassified | 1375 |
| 166 | Ga0501038_0753328 | 3300049574 | Unclassified | 726 |
| 167 | Ga0501039_0185071 | 3300049575 | Bacteria | 1638 |
| 168 | Ga0501043_0012244 | 3300049579 | Bacteria | 6705 |
| 169 | Ga0501043_0270068 | 3300049579 | Unclassified | 1306 |
| 170 | Ga0501035_0350451 | 3300049822 | Bacteria | 1235 |
| 171 | Ga0501035_0631876 | 3300049822 | Unclassified | 870 |
| 172 | Ga0501044_0158929 | 3300049823 | Unclassified | 2238 |
| 173 | nmdc:mga0k408_1117_c1 | 3300050493 | Bacteria | 13717 |
| 174 | Ga0500651_0000464 | 3300053093 | Bacteria | 21441 |
| 175 | Ga0500618_000002 | 3300053125 | Bacteria | 370822 |
| 176 | Ga0500658_0363294 | 3300053134 | Bacteria | 664 |
| 177 | Ga0500622_0047194 | 3300053156 | Bacteria | 2225 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005578 | Ga0068854_100024969 | Ga0068854_1000249692 | 135 |
| 2 | 3300005614 | Ga0068856_100029749 | Ga0068856_1000297494 | 135 |
| 3 | 3300025924 | Ga0207694_10004728 | Ga0207694_100047284 | 135 |
| 4 | 3300026116 | Ga0207674_10002240 | Ga0207674_100022403 | 135 |
| 5 | 3300005331 | Ga0070670_100919447 | Ga0070670_1009194472 | 136 |
| 6 | 3300005336 | Ga0070680_100403000 | Ga0070680_1004030002 | 136 |
| 7 | 3300009545 | Ga0105237_10121790 | Ga0105237_101217902 | 136 |
| 8 | 3300013307 | Ga0157372_10139988 | Ga0157372_101399882 | 136 |
| 9 | 3300025907 | Ga0207645_10344256 | Ga0207645_103442562 | 136 |
| 10 | 3300047472 | Ga0495686_0021135 | Ga0495686_0021135_3265_3678 | 136 |
| 11 | 3300053134 | Ga0500658_0363294 | Ga0500658_0363294_36_446 | 136 |
| 12 | iso_pu_bacteria | 2775506987 | 2776612631 | 140 |
| 13 | 3300053093 | Ga0500651_0000464 | Ga0500651_0000464_20211_20681 | 145 |
| 14 | 3300037312 | Ga0395899_0000269 | Ga0395899_0000269_17979_18509 | 153 |
| 15 | 3300037418 | Ga0395900_0000251 | Ga0395900_0000251_20781_21311 | 153 |
| 16 | 3300037466 | Ga0395898_0048564 | Ga0395898_0048564_1730_2260 | 153 |
| 17 | 3300037471 | Ga0395905_0000495 | Ga0395905_0000495_31390_31920 | 153 |
| 18 | 3300038443 | Ga0395901_0000145 | Ga0395901_0000145_8241_8771 | 153 |
| 19 | iso_pu_bacteria | 2738543023 | 2739301433 | 155 |
| 20 | 3300009551 | Ga0105238_11260936 | Ga0105238_112609361 | 157 |
| 21 | 3300025924 | Ga0207694_10865638 | Ga0207694_108656381 | 157 |
| 22 | 3300037312 | Ga0395899_0003043 | Ga0395899_0003043_12267_12740 | 157 |
| 23 | 3300037418 | Ga0395900_0009360 | Ga0395900_0009360_6200_6673 | 157 |
| 24 | 3300037471 | Ga0395905_0000579 | Ga0395905_0000579_4283_4756 | 157 |
| 25 | 3300038443 | Ga0395901_0001854 | Ga0395901_0001854_10855_11328 | 157 |
| 26 | 3300003320 | rootH2_10006302 | rootH2_1000630239 | 158 |
| 27 | 3300003320 | rootH2_10222155 | rootH2_102221552 | 158 |
| 28 | 3300003320 | rootH2_10289179 | rootH2_102891793 | 158 |
| 29 | 3300003322 | rootL2_10207179 | rootL2_102071792 | 158 |
| 30 | 3300003323 | rootH1_10314718 | rootH1_103147184 | 158 |
| 31 | 3300005329 | Ga0070683_101095316 | Ga0070683_1010953162 | 158 |
| 32 | 3300005338 | Ga0068868_100022166 | Ga0068868_1000221665 | 158 |
| 33 | 3300005341 | Ga0070691_10267181 | Ga0070691_102671813 | 158 |
| 34 | 3300005539 | Ga0068853_101211631 | Ga0068853_1012116312 | 158 |
| 35 | 3300005563 | Ga0068855_100003370 | Ga0068855_10000337013 | 158 |
| 36 | 3300005577 | Ga0068857_100003942 | Ga0068857_10000394213 | 158 |
| 37 | 3300005616 | Ga0068852_100054366 | Ga0068852_1000543662 | 158 |
| 38 | 3300006237 | Ga0097621_100000033 | Ga0097621_10000003348 | 158 |
| 39 | 3300006237 | Ga0097621_100026729 | Ga0097621_1000267292 | 158 |
| 40 | 3300006358 | Ga0068871_100000020 | Ga0068871_10000002051 | 158 |
| 41 | 3300006358 | Ga0068871_100035174 | Ga0068871_1000351746 | 158 |
| 42 | 3300009093 | Ga0105240_10018663 | Ga0105240_100186634 | 158 |
| 43 | 3300009174 | Ga0105241_10317734 | Ga0105241_103177343 | 158 |
| 44 | 3300009545 | Ga0105237_10392396 | Ga0105237_103923963 | 158 |
| 45 | 3300009551 | Ga0105238_10009544 | Ga0105238_100095446 | 158 |
| 46 | 3300013100 | Ga0157373_10047018 | Ga0157373_100470183 | 158 |
| 47 | 3300013100 | Ga0157373_10051012 | Ga0157373_100510122 | 158 |
| 48 | 3300013100 | Ga0157373_11156983 | Ga0157373_111569831 | 158 |
| 49 | 3300013104 | Ga0157370_10204195 | Ga0157370_102041952 | 158 |
| 50 | 3300013297 | Ga0157378_10027784 | Ga0157378_100277844 | 158 |
| 51 | 3300013306 | Ga0163162_10055141 | Ga0163162_100551413 | 158 |
| 52 | 3300013307 | Ga0157372_10001359 | Ga0157372_100013599 | 158 |
| 53 | 3300013307 | Ga0157372_10046766 | Ga0157372_100467664 | 158 |
| 54 | 3300013307 | Ga0157372_10525083 | Ga0157372_105250833 | 158 |
| 55 | 3300013308 | Ga0157375_10067557 | Ga0157375_100675575 | 158 |
| 56 | 3300014745 | Ga0157377_10003522 | Ga0157377_100035225 | 158 |
| 57 | 3300014968 | Ga0157379_10034212 | Ga0157379_100342122 | 158 |
| 58 | 3300014969 | Ga0157376_10274419 | Ga0157376_102744192 | 158 |
| 59 | 3300017792 | Ga0163161_10915260 | Ga0163161_109152602 | 158 |
| 60 | 3300020070 | Ga0206356_11782394 | Ga0206356_117823941 | 158 |
| 61 | 3300021361 | Ga0213872_10069090 | Ga0213872_100690903 | 158 |
| 62 | 3300025904 | Ga0207647_10027522 | Ga0207647_100275223 | 158 |
| 63 | 3300025911 | Ga0207654_10352082 | Ga0207654_103520822 | 158 |
| 64 | 3300025913 | Ga0207695_10157873 | Ga0207695_101578733 | 158 |
| 65 | 3300025949 | Ga0207667_10000412 | Ga0207667_1000041237 | 158 |
| 66 | 3300026023 | Ga0207677_10017600 | Ga0207677_100176005 | 158 |
| 67 | 3300026089 | Ga0207648_11403410 | Ga0207648_114034101 | 158 |
| 68 | 3300026142 | Ga0207698_10126534 | Ga0207698_101265342 | 158 |
| 69 | 3300027526 | Ga0209968_1007957 | Ga0209968_10079572 | 158 |
| 70 | 3300027543 | Ga0209999_1008385 | Ga0209999_10083853 | 158 |
| 71 | 3300037312 | Ga0395899_0000001 | Ga0395899_0000001_1749193_1749669 | 158 |
| 72 | 3300048908 | Ga0496105_0351077 | Ga0496105_0351077_530_1015 | 158 |
| 73 | 3300053156 | Ga0500622_0047194 | Ga0500622_0047194_1275_1751 | 158 |
| 74 | 2162886007 | SwRhRL2b_contig_1494727 | SwRhRL2b_0150.00010430 | 159 |
| 75 | 3300003320 | rootH2_10076397 | rootH2_100763972 | 159 |
| 76 | 3300003322 | rootL2_10147654 | rootL2_101476542 | 159 |
| 77 | 3300005288 | Ga0065714_10003796 | Ga0065714_1000379627 | 159 |
| 78 | 3300005288 | Ga0065714_10019464 | Ga0065714_100194641 | 159 |
| 79 | 3300005289 | Ga0065704_10070204 | Ga0065704_1007020461 | 159 |
| 80 | 3300005327 | Ga0070658_10732914 | Ga0070658_107329141 | 159 |
| 81 | 3300005328 | Ga0070676_10140457 | Ga0070676_101404572 | 159 |
| 82 | 3300005331 | Ga0070670_100041711 | Ga0070670_1000417112 | 159 |
| 83 | 3300005334 | Ga0068869_100529424 | Ga0068869_1005294242 | 159 |
| 84 | 3300005335 | Ga0070666_10003275 | Ga0070666_100032757 | 159 |
| 85 | 3300005339 | Ga0070660_100007758 | Ga0070660_1000077584 | 159 |
| 86 | 3300005355 | Ga0070671_100008099 | Ga0070671_1000080994 | 159 |
| 87 | 3300005364 | Ga0070673_100069661 | Ga0070673_1000696612 | 159 |
| 88 | 3300005366 | Ga0070659_100004632 | Ga0070659_1000046329 | 159 |
| 89 | 3300005459 | Ga0068867_100165746 | Ga0068867_1001657462 | 159 |
| 90 | 3300005530 | Ga0070679_100373553 | Ga0070679_1003735534 | 159 |
| 91 | 3300005539 | Ga0068853_100417414 | Ga0068853_1004174142 | 159 |
| 92 | 3300005543 | Ga0070672_100076624 | Ga0070672_1000766243 | 159 |
| 93 | 3300005563 | Ga0068855_100082706 | Ga0068855_1000827064 | 159 |
| 94 | 3300005564 | Ga0070664_100126311 | Ga0070664_1001263112 | 159 |
| 95 | 3300005578 | Ga0068854_100004069 | Ga0068854_1000040696 | 159 |
| 96 | 3300005616 | Ga0068852_100011304 | Ga0068852_1000113045 | 159 |
| 97 | 3300005718 | Ga0068866_10355932 | Ga0068866_103559321 | 159 |
| 98 | 3300005834 | Ga0068851_10081200 | Ga0068851_100812002 | 159 |
| 99 | 3300006195 | Ga0075366_10002067 | Ga0075366_100020677 | 159 |
| 100 | 3300006358 | Ga0068871_100324186 | Ga0068871_1003241862 | 159 |
| 101 | 3300009093 | Ga0105240_10167517 | Ga0105240_101675172 | 159 |
| 102 | 3300009093 | Ga0105240_10511605 | Ga0105240_105116052 | 159 |
| 103 | 3300009545 | Ga0105237_10032399 | Ga0105237_100323992 | 159 |
| 104 | 3300009545 | Ga0105237_10136282 | Ga0105237_101362823 | 159 |
| 105 | 3300009545 | Ga0105237_10430985 | Ga0105237_104309852 | 159 |
| 106 | 3300009551 | Ga0105238_12677566 | Ga0105238_126775661 | 159 |
| 107 | 3300010375 | Ga0105239_11400492 | Ga0105239_114004922 | 159 |
| 108 | 3300013100 | Ga0157373_10000290 | Ga0157373_1000029022 | 159 |
| 109 | 3300013102 | Ga0157371_10000438 | Ga0157371_1000043852 | 159 |
| 110 | 3300013296 | Ga0157374_10016221 | Ga0157374_100162215 | 159 |
| 111 | 3300013296 | Ga0157374_10037837 | Ga0157374_100378373 | 159 |
| 112 | 3300013307 | Ga0157372_10540146 | Ga0157372_105401461 | 159 |
| 113 | 3300013307 | Ga0157372_10598232 | Ga0157372_105982323 | 159 |
| 114 | 3300013308 | Ga0157375_10017370 | Ga0157375_100173708 | 159 |
| 115 | 3300013308 | Ga0157375_10341559 | Ga0157375_103415592 | 159 |
| 116 | 3300014325 | Ga0163163_10030721 | Ga0163163_100307215 | 159 |
| 117 | 3300015261 | Ga0182006_1006531 | Ga0182006_10065318 | 159 |
| 118 | 3300017792 | Ga0163161_10000530 | Ga0163161_1000053031 | 159 |
| 119 | 3300025250 | Ga0209026_1001760 | Ga0209026_10017603 | 159 |
| 120 | 3300025321 | Ga0207656_10235633 | Ga0207656_102356332 | 159 |
| 121 | 3300025899 | Ga0207642_10368794 | Ga0207642_103687941 | 159 |
| 122 | 3300025903 | Ga0207680_10003332 | Ga0207680_100033324 | 159 |
| 123 | 3300025909 | Ga0207705_10621164 | Ga0207705_106211642 | 159 |
| 124 | 3300025913 | Ga0207695_10505648 | Ga0207695_105056482 | 159 |
| 125 | 3300025914 | Ga0207671_10018671 | Ga0207671_100186715 | 159 |
| 126 | 3300025919 | Ga0207657_10023261 | Ga0207657_100232618 | 159 |
| 127 | 3300025921 | Ga0207652_10332069 | Ga0207652_103320692 | 159 |
| 128 | 3300025925 | Ga0207650_10008401 | Ga0207650_100084012 | 159 |
| 129 | 3300025926 | Ga0207659_10116772 | Ga0207659_101167722 | 159 |
| 130 | 3300025932 | Ga0207690_10003137 | Ga0207690_100031379 | 159 |
| 131 | 3300025933 | Ga0207706_10801470 | Ga0207706_108014702 | 159 |
| 132 | 3300025945 | Ga0207679_10159462 | Ga0207679_101594622 | 159 |
| 133 | 3300025949 | Ga0207667_10080798 | Ga0207667_100807982 | 159 |
| 134 | 3300025960 | Ga0207651_10262192 | Ga0207651_102621921 | 159 |
| 135 | 3300025981 | Ga0207640_10018515 | Ga0207640_100185152 | 159 |
| 136 | 3300026023 | Ga0207677_10678313 | Ga0207677_106783132 | 159 |
| 137 | 3300026089 | Ga0207648_10018848 | Ga0207648_100188487 | 159 |
| 138 | 3300026142 | Ga0207698_10025215 | Ga0207698_100252154 | 159 |
| 139 | 3300028786 | Ga0307517_10024726 | Ga0307517_100247263 | 159 |
| 140 | 3300028794 | Ga0307515_10018401 | Ga0307515_1001840111 | 159 |
| 141 | 3300028794 | Ga0307515_10041625 | Ga0307515_100416258 | 159 |
| 142 | 3300031911 | Ga0307412_10000023 | Ga0307412_10000023113 | 159 |
| 143 | 3300032004 | Ga0307414_10001191 | Ga0307414_100011914 | 159 |
| 144 | 3300033179 | Ga0307507_10000015 | Ga0307507_10000015122 | 159 |
| 145 | 3300033180 | Ga0307510_10000365 | Ga0307510_1000036516 | 159 |
| 146 | 3300033180 | Ga0307510_10012066 | Ga0307510_100120664 | 159 |
| 147 | 3300044735 | Ga0466968_0129635 | Ga0466968_0129635_438_917 | 159 |
| 148 | 3300046492 | Ga0495585_0003576 | Ga0495585_0003576_840_1319 | 159 |
| 149 | 3300046507 | Ga0495606_0030637 | Ga0495606_0030637_2756_3235 | 159 |
| 150 | 3300046512 | Ga0495610_0000512 | Ga0495610_0000512_2532_3014 | 159 |
| 151 | 3300046513 | Ga0495616_0005183 | Ga0495616_0005183_4325_4807 | 159 |
| 152 | 3300046524 | Ga0495648_0003649 | Ga0495648_0003649_5686_6165 | 159 |
| 153 | 3300046524 | Ga0495648_0160871 | Ga0495648_0160871_551_1030 | 159 |
| 154 | 3300046530 | Ga0495654_0109228 | Ga0495654_0109228_389_868 | 159 |
| 155 | 3300046557 | Ga0495622_0025974 | Ga0495622_0025974_989_1468 | 159 |
| 156 | 3300046558 | Ga0495633_0000044 | Ga0495633_0000044_8665_9147 | 159 |
| 157 | 3300046558 | Ga0495633_0000864 | Ga0495633_0000864_10465_10947 | 159 |
| 158 | 3300046616 | Ga0495668_0000011 | Ga0495668_0000011_144139_144618 | 159 |
| 159 | 3300046660 | Ga0495625_0000009 | Ga0495625_0000009_228940_229422 | 159 |
| 160 | 3300046660 | Ga0495625_0000873 | Ga0495625_0000873_9361_9840 | 159 |
| 161 | 3300046660 | Ga0495625_0016686 | Ga0495625_0016686_3784_4263 | 159 |
| 162 | 3300046665 | Ga0495661_0051788 | Ga0495661_0051788_1434_1916 | 159 |
| 163 | 3300046683 | Ga0495658_0103829 | Ga0495658_0103829_963_1442 | 159 |
| 164 | 3300046694 | Ga0495649_0000008 | Ga0495649_0000008_19666_20148 | 159 |
| 165 | 3300047323 | Ga0495683_0015215 | Ga0495683_0015215_3468_3947 | 159 |
| 166 | 3300047472 | Ga0495686_0001314 | Ga0495686_0001314_212_691 | 159 |
| 167 | 3300048089 | Ga0495614_0005414 | Ga0495614_0005414_2536_3015 | 159 |
| 168 | 3300048911 | Ga0496108_0220338 | Ga0496108_0220338_414_908 | 159 |
| 169 | 3300049460 | Ga0495682_0056939 | Ga0495682_0056939_497_976 | 159 |
| 170 | 3300049570 | Ga0501033_0213669 | Ga0501033_0213669_274_762 | 159 |
| 171 | 3300049574 | Ga0501038_0753328 | Ga0501038_0753328_139_627 | 159 |
| 172 | 3300049575 | Ga0501039_0185071 | Ga0501039_0185071_194_682 | 159 |
| 173 | 3300049579 | Ga0501043_0012244 | Ga0501043_0012244_5466_5954 | 159 |
| 174 | 3300049579 | Ga0501043_0270068 | Ga0501043_0270068_671_1165 | 159 |
| 175 | 3300049822 | Ga0501035_0350451 | Ga0501035_0350451_193_681 | 159 |
| 176 | 3300049822 | Ga0501035_0631876 | Ga0501035_0631876_319_813 | 159 |
| 177 | 3300049823 | Ga0501044_0158929 | Ga0501044_0158929_1152_1640 | 159 |
| 178 | 3300050493 | nmdc:mga0k408_1117_c1 | nmdc:mga0k408_1117_c1_5464_5943 | 159 |
| 179 | 3300053125 | Ga0500618_000002 | Ga0500618_000002_353947_354426 | 159 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8an5-assembly1.cif.gz_A | menat1 toxin-antitoxin complex (rv0078a-rv0078b) from mycobacterium tuberculosis h37rv | 0.7178 | 13 | 152 |
| 8an5-assembly1.cif.gz_B | menat1 toxin-antitoxin complex (rv0078a-rv0078b) from mycobacterium tuberculosis h37rv | 0.7062 | 9 | 152 |
| 8an4-assembly2.cif.gz_B | ment1 toxin (rv0078a) from mycobacterium tuberculosis h37rv | 0.6986 | 9 | 152 |
| 8an4-assembly1.cif.gz_A | ment1 toxin (rv0078a) from mycobacterium tuberculosis h37rv | 0.6679 | 6 | 152 |
| 8an5-assembly1.cif.gz_B | menat1 toxin-antitoxin complex (rv0078a-rv0078b) from mycobacterium tuberculosis h37rv | 0.6471 | 9 | 152 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_L7N686_1_158_3.30.460.40 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; | 0.6884 | 1 | 149 | 3.30.460.40 |
| 2ewrA00 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; | 0.67 | 8 | 158 | 3.30.460.40 |
| af_L7N686_1_158_3.30.460.40 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; | 0.65 | 1 | 149 | 3.30.460.40 |
| 2ewrA00 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; | 0.6288 | 8 | 158 | 3.30.460.40 |
| 4e8iA00 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; | 0.6067 | 1 | 152 | 3.30.460.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R8DHH6-F1-model_v4 | Nucleotidyltransferase DUF2204 | 0.992 | 1 | 159 |
|
| AF-A0A556MIM3-F1-model_v4 | Nucleotidyltransferase family protein | 0.9891 | 1 | 158 |
|
| AF-A0A7W8YSG1-F1-model_v4 | Nucleotidyltransferase | 0.9789 | 1 | 62 |
|
| AF-A0A5S5DRW9-F1-model_v4 | Nucleotidyltransferase DUF2204 | 0.9784 | 1 | 108 |
|
| AF-A0A556MIM3-F1-model_v4 | Nucleotidyltransferase family protein | 0.9769 | 1 | 158 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar