F272555

General Info

Members Datasets Scaffolds Average Seq Length
178 135 177 93

Family's Representative Sequence

Representative Sequence 3300046491|Ga0495584_0198844|Ga0495584_0198844_345_674
Length 109
Sequence MVHGREPIEGHRRYHAMDTDILSWSREELIAEVMRLRNGIRAHRDSSGHNLCWFHPQLWGLLPEPIPKDIAVPAWPQFLRGCVKYREALDRELPNAPRTLVEADDSGRE

Samples

Sample ID Description Type Environment
1 2738541337 Pelomonas sp. BT06 Isolate Unclassified
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
51 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
52 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
73 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
74 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
75 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
81 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
82 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
83 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
84 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
85 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
86 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
87 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
88 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
89 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
90 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
91 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
92 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
93 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
94 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
95 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
96 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
97 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
98 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
99 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
100 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
101 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
102 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
103 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
104 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
108 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
109 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
110 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
111 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
112 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
113 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
114 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
115 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
116 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
117 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
118 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
119 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
120 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
121 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
122 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
123 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
124 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
125 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
126 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
127 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
128 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
129 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
130 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
131 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
132 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
133 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
134 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
135 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0
Isolates 0.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.16
Nodule 0
Rhizoplane 3.37
Rhizosphere 71.35
Stem 0
Stem Tuber 0
Unclassified 1.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10044256 3300003187 Bacteria 1583
2 JGI25406J46586_10056167 3300003203 Bacteria 1293
3 JGI25404J52841_10083337 3300003659 Bacteria 668
4 Ga0055530_10001349 3300003791 Bacteria 18314
5 Ga0055531_10001025 3300003794 Bacteria 22117
6 Ga0055531_10009054 3300003794 Bacteria 5140
7 JGI25405J52794_10067765 3300003911 Unclassified 777
8 Ga0070677_10000056 3300005333 Bacteria 34868
9 Ga0070677_10102917 3300005333 Unclassified 1262
10 Ga0070669_101541375 3300005353 Unclassified 578
11 Ga0070671_100395709 3300005355 Bacteria 1181
12 Ga0070709_10015296 3300005434 Bacteria 4363
13 Ga0070709_10038018 3300005434 Bacteria 2944
14 Ga0070714_100086914 3300005435 Bacteria 2733
15 Ga0070714_100104773 3300005435 Bacteria 2496
16 Ga0070713_100040610 3300005436 Bacteria 3783
17 Ga0070710_10006987 3300005437 Bacteria 5445
18 Ga0070710_10083061 3300005437 Bacteria 1874
19 Ga0070711_100000362 3300005439 Bacteria 23459
20 Ga0070711_100044131 3300005439 Bacteria 3024
21 Ga0070700_100343912 3300005441 Archaea 1103
22 Ga0070694_100258015 3300005444 Unclassified 1321
23 Ga0070678_100540840 3300005456 Bacteria 1033
24 Ga0070665_100314641 3300005548 Bacteria 1570
25 Ga0068863_100193749 3300005841 Bacteria 1954
26 Ga0068860_100737799 3300005843 Unclassified 996
27 Ga0068862_100625805 3300005844 Bacteria 1036
28 Ga0081455_10001657 3300005937 Bacteria 26985
29 Ga0081455_10090119 3300005937 Bacteria 2487
30 Ga0081455_10317319 3300005937 Bacteria 1112
31 Ga0081455_10677543 3300005937 Unclassified 660
32 Ga0081540_1006028 3300005983 Bacteria 8918
33 Ga0081539_10002224 3300005985 Bacteria 28286
34 Ga0070717_10936172 3300006028 Bacteria 789
35 Ga0075365_10323791 3300006038 Bacteria 1085
36 Ga0075365_10404375 3300006038 Unclassified 964
37 Ga0075368_10124330 3300006042 Bacteria 1070
38 Ga0075363_100139187 3300006048 Bacteria 1366
39 Ga0075364_10331874 3300006051 Bacteria 1036
40 Ga0075364_10458832 3300006051 Unclassified 871
41 Ga0070715_10084683 3300006163 Bacteria 1446
42 Ga0070716_100010733 3300006173 Bacteria 4602
43 Ga0070716_100045100 3300006173 Bacteria 2473
44 Ga0070712_100009001 3300006175 Bacteria 6288
45 Ga0070712_100047211 3300006175 Bacteria 2979
46 Ga0075362_10051262 3300006177 Bacteria 1847
47 Ga0075367_10044847 3300006178 Bacteria 2593
48 Ga0075367_10080062 3300006178 Unclassified 1975
49 Ga0075369_10001931 3300006186 Bacteria 7279
50 Ga0075369_10178524 3300006186 Unclassified 977
51 Ga0075366_10879029 3300006195 Bacteria 558
52 Ga0075370_10109581 3300006353 Bacteria 1602
53 Ga0075370_10163356 3300006353 Bacteria 1307
54 Ga0075370_10328796 3300006353 Bacteria 911
55 Ga0075428_101225347 3300006844 Bacteria 791
56 Ga0075430_100749721 3300006846 Bacteria 805
57 Ga0075429_101944642 3300006880 Unclassified 509
58 Ga0099794_10009620 3300007265 Bacteria 4075
59 Ga0099795_10048231 3300007788 Bacteria 1541
60 Ga0114129_10388024 3300009147 Bacteria 1843
61 Ga0114129_11143688 3300009147 Bacteria 972
62 Ga0114129_12676309 3300009147 Unclassified 594
63 Ga0105248_11626644 3300009177 Bacteria 732
64 Ga0157370_10749586 3300013104 Bacteria 890
65 Ga0157374_12598607 3300013296 Bacteria 534
66 Ga0157378_11577698 3300013297 Bacteria 702
67 Ga0157375_11695487 3300013308 Unclassified 748
68 Ga0209025_1000554 3300025294 Bacteria 69453
69 Ga0209758_1000401 3300025297 Bacteria 74599
70 Ga0209050_1000031 3300025298 Bacteria 458181
71 Ga0209257_1000073 3300025304 Bacteria 325833
72 Ga0209257_1000308 3300025304 Bacteria 105012
73 Ga0207682_10000368 3300025893 Bacteria 20749
74 Ga0207692_10004530 3300025898 Bacteria 5512
75 Ga0207692_10004836 3300025898 Bacteria 5359
76 Ga0207685_10065511 3300025905 Bacteria 1455
77 Ga0207699_10011145 3300025906 Bacteria 4530
78 Ga0207699_10026166 3300025906 Bacteria 3212
79 Ga0207693_10001150 3300025915 Bacteria 23634
80 Ga0207693_10060310 3300025915 Bacteria 2971
81 Ga0207663_10000875 3300025916 Bacteria 13681
82 Ga0207663_10224568 3300025916 Bacteria 1368
83 Ga0207681_11640986 3300025923 Unclassified 538
84 Ga0207700_10022131 3300025928 Bacteria 4354
85 Ga0207700_10058618 3300025928 Bacteria 2909
86 Ga0207664_10201602 3300025929 Bacteria 1718
87 Ga0207665_10043329 3300025939 Bacteria 3008
88 Ga0207665_10158664 3300025939 Bacteria 1625
89 Ga0207711_11060601 3300025941 Bacteria 751
90 Ga0207677_11194652 3300026023 Unclassified 696
91 Ga0207641_10226383 3300026088 Bacteria 1736
92 Ga0209179_1154051 3300027512 Unclassified 513
93 Ga0209588_1003545 3300027671 Bacteria 4333
94 Ga0209813_10059291 3300027866 Bacteria 1218
95 Ga0268266_10000083 3300028379 Bacteria 202393
96 Ga0268266_10155063 3300028379 Bacteria 2068
97 Ga0268266_10383798 3300028379 Bacteria 1325
98 Ga0268265_10745039 3300028380 Bacteria 950
99 Ga0268265_12013927 3300028380 Bacteria 585
100 Ga0307408_100644199 3300031548 Bacteria 947
101 Ga0307405_10180534 3300031731 Bacteria 1515
102 Ga0307405_10193057 3300031731 Bacteria 1472
103 Ga0307410_10995325 3300031852 Bacteria 723
104 Ga0307406_10240711 3300031901 Bacteria 1357
105 Ga0307406_11307415 3300031901 Bacteria 633
106 Ga0307412_10963928 3300031911 Bacteria 751
107 Ga0307409_102500361 3300031995 Bacteria 545
108 Ga0307414_10000449 3300032004 Bacteria 21733
109 Ga0307414_10134889 3300032004 Bacteria 1923
110 Ga0307411_10120904 3300032005 Bacteria 1894
111 Ga0373943_0160324 3300035170 Bacteria 1224
112 Ga0373927_0082223 3300035695 Bacteria 2088
113 Ga0451843_0291122 3300041509 Bacteria 1821
114 Ga0439431_0270552 3300041997 Bacteria 507
115 Ga0439432_003655 3300042006 Bacteria 5685
116 Ga0439449_0304704 3300042007 Bacteria 602
117 Ga0439462_0051779 3300042015 Bacteria 1104
118 Ga0439434_0084323 3300042435 Bacteria 1011
119 Ga0439460_0031788 3300042461 Bacteria 1508
120 Ga0439460_0036940 3300042461 Bacteria 1419
121 Ga0439460_0050487 3300042461 Bacteria 1246
122 Ga0451577_0106855 3300042876 Bacteria 2502
123 Ga0451576_0067378 3300045051 Bacteria 3726
124 Ga0495603_0218102 3300046455 Bacteria 1101
125 Ga0495638_0109550 3300046460 Bacteria 1642
126 Ga0495605_0293845 3300046474 Bacteria 688
127 Ga0495584_0198844 3300046491 Unclassified 1019
128 Ga0495636_0478108 3300047318 Unclassified 601
129 Ga0496100_0126061 3300048903 Bacteria 1797
130 Ga0496104_1110368 3300048907 Unclassified 694
131 Ga0496106_1046196 3300048909 Unclassified 641
132 Ga0496108_1618156 3300048911 Unclassified 535
133 Ga0496110_0084864 3300048913 Bacteria 2827
134 Ga0496111_0331965 3300048914 Bacteria 1126
135 Ga0501297_045955 3300049520 Bacteria 629
136 Ga0501303_014673 3300049526 Bacteria 777
137 Ga0501034_0143737 3300049571 Bacteria 2364
138 Ga0501040_0120503 3300049576 Bacteria 1841
139 Ga0501042_0204296 3300049578 Bacteria 1425
140 Ga0501072_0717911 3300049588 Bacteria 785
141 Ga0501075_0868642 3300049591 Bacteria 686
142 Ga0501207_012109 3300049654 Bacteria 1293
143 Ga0501224_015423 3300049664 Bacteria 1133
144 Ga0501242_010784 3300049674 Bacteria 1095
145 Ga0501247_090377 3300049677 Bacteria 504
146 Ga0501250_002521 3300049680 Bacteria 1667
147 Ga0501257_155542 3300049686 Bacteria 633
148 Ga0501225_0179182 3300049705 Bacteria 661
149 Ga0501079_0230236 3300049741 Unclassified 1448
150 Ga0501241_063654 3300049758 Bacteria 744
151 Ga0501280_009917 3300049776 Bacteria 1327
152 Ga0501045_0262857 3300049824 Bacteria 1285
153 nmdc:mga03683_5672_c1 3300050489 Bacteria 4229
154 nmdc:mga03n38_78131_c1 3300050490 Bacteria 1548
155 nmdc:mga00v17_325820_c1 3300050491 Unclassified 998
156 nmdc:mga0yw44_345018_c1 3300050492 Bacteria 1002
157 nmdc:mga0yw44_485490_c1 3300050492 Unclassified 838
158 nmdc:mga06z11_36828_c1 3300050494 Bacteria 2418
159 nmdc:mga06z11_47386_c1 3300050494 Unclassified 2183
160 nmdc:mga04h51_456638_c1 3300050495 Bacteria 541
161 nmdc:mga04h51_60402_c1 3300050495 Bacteria 1298
162 nmdc:mga07m45_612763_c1 3300050496 Bacteria 628
163 nmdc:mga07m45_704245_c1 3300050496 Bacteria 581
164 nmdc:mga07m45_86463_c1 3300050496 Bacteria 1794
165 nmdc:mga05p37_1489279_c1 3300050507 Bacteria 675
166 nmdc:mga05p37_216825_c1 3300050507 Bacteria 2311
167 nmdc:mga05p37_374439_c1 3300050507 Bacteria 1670
168 nmdc:mga05p37_972155_c1 3300050507 Unclassified 906
169 nmdc:mga0sz30_151_c1 3300050516 Bacteria 25783
170 Ga0500643_000014 3300053087 Bacteria 318249
171 Ga0500592_017486 3300053116 Bacteria 1152
172 Ga0500568_0020322 3300053139 Bacteria 2875
173 Ga0500611_080601 3300053727 Bacteria 811
174 Ga0500645_117234 3300053730 Bacteria 744
175 Ga0501084_1301907 3300054114 Unclassified 609
176 Ga0501084_1385904 3300054114 Bacteria 589
177 Ga0590071_196282 3300059421 Bacteria 531

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2738541337 2739054492 86
2 3300006880 Ga0075429_101944642 Ga0075429_1019446421 87
3 3300005441 Ga0070700_100343912 Ga0070700_1003439122 88
4 3300005444 Ga0070694_100258015 Ga0070694_1002580152 88
5 3300006844 Ga0075428_101225347 Ga0075428_1012253472 88
6 3300009147 Ga0114129_11143688 Ga0114129_111436882 88
7 3300035170 Ga0373943_0160324 Ga0373943_0160324_788_1060 88
8 3300035695 Ga0373927_0082223 Ga0373927_0082223_916_1188 88
9 3300046455 Ga0495603_0218102 Ga0495603_0218102_791_1063 88
10 3300046474 Ga0495605_0293845 Ga0495605_0293845_126_398 88
11 3300050495 nmdc:mga04h51_456638_c1 nmdc:mga04h51_456638_c1_51_323 88
12 3300050507 nmdc:mga05p37_1489279_c1 nmdc:mga05p37_1489279_c1_319_585 88
13 3300003791 Ga0055530_10001349 Ga0055530_100013497 89
14 3300003794 Ga0055531_10001025 Ga0055531_100010259 89
15 3300005333 Ga0070677_10102917 Ga0070677_101029173 89
16 3300005353 Ga0070669_101541375 Ga0070669_1015413751 89
17 3300005456 Ga0070678_100540840 Ga0070678_1005408402 89
18 3300005843 Ga0068860_100737799 Ga0068860_1007377991 89
19 3300005844 Ga0068862_100625805 Ga0068862_1006258053 89
20 3300006038 Ga0075365_10323791 Ga0075365_103237912 89
21 3300006177 Ga0075362_10051262 Ga0075362_100512622 89
22 3300006178 Ga0075367_10044847 Ga0075367_100448474 89
23 3300006186 Ga0075369_10001931 Ga0075369_100019317 89
24 3300006353 Ga0075370_10163356 Ga0075370_101633562 89
25 3300006846 Ga0075430_100749721 Ga0075430_1007497212 89
26 3300007265 Ga0099794_10009620 Ga0099794_100096206 89
27 3300025297 Ga0209758_1000401 Ga0209758_100040113 89
28 3300025298 Ga0209050_1000031 Ga0209050_1000031181 89
29 3300025304 Ga0209257_1000073 Ga0209257_1000073199 89
30 3300025923 Ga0207681_11640986 Ga0207681_116409861 89
31 3300027671 Ga0209588_1003545 Ga0209588_10035452 89
32 3300028379 Ga0268266_10000083 Ga0268266_10000083113 89
33 3300028379 Ga0268266_10383798 Ga0268266_103837982 89
34 3300028380 Ga0268265_10745039 Ga0268265_107450392 89
35 3300028380 Ga0268265_12013927 Ga0268265_120139272 89
36 3300042461 Ga0439460_0031788 Ga0439460_0031788_651_920 89
37 3300042461 Ga0439460_0036940 Ga0439460_0036940_897_1166 89
38 3300042876 Ga0451577_0106855 Ga0451577_0106855_496_765 89
39 3300045051 Ga0451576_0067378 Ga0451576_0067378_2307_2576 89
40 3300049578 Ga0501042_0204296 Ga0501042_0204296_889_1158 89
41 3300050489 nmdc:mga03683_5672_c1 nmdc:mga03683_5672_c1_814_1083 89
42 3300050492 nmdc:mga0yw44_345018_c1 nmdc:mga0yw44_345018_c1_288_557 89
43 3300050492 nmdc:mga0yw44_485490_c1 nmdc:mga0yw44_485490_c1_50_319 89
44 3300050494 nmdc:mga06z11_36828_c1 nmdc:mga06z11_36828_c1_384_653 89
45 3300050496 nmdc:mga07m45_704245_c1 nmdc:mga07m45_704245_c1_186_455 89
46 3300050516 nmdc:mga0sz30_151_c1 nmdc:mga0sz30_151_c1_17864_18133 89
47 3300059421 Ga0590071_196282 Ga0590071_196282_33_323 89
48 3300003187 JGI25151J46595_10044256 JGI25151J46595_100442562 90
49 3300003203 JGI25406J46586_10056167 JGI25406J46586_100561672 90
50 3300003659 JGI25404J52841_10083337 JGI25404J52841_100833372 90
51 3300003794 Ga0055531_10009054 Ga0055531_100090542 90
52 3300003911 JGI25405J52794_10067765 JGI25405J52794_100677651 90
53 3300005333 Ga0070677_10000056 Ga0070677_1000005624 90
54 3300005355 Ga0070671_100395709 Ga0070671_1003957092 90
55 3300005434 Ga0070709_10015296 Ga0070709_100152962 90
56 3300005434 Ga0070709_10038018 Ga0070709_100380183 90
57 3300005435 Ga0070714_100086914 Ga0070714_1000869143 90
58 3300005435 Ga0070714_100104773 Ga0070714_1001047733 90
59 3300005436 Ga0070713_100040610 Ga0070713_1000406103 90
60 3300005437 Ga0070710_10006987 Ga0070710_100069871 90
61 3300005437 Ga0070710_10083061 Ga0070710_100830611 90
62 3300005439 Ga0070711_100000362 Ga0070711_10000036222 90
63 3300005439 Ga0070711_100044131 Ga0070711_1000441313 90
64 3300005548 Ga0070665_100314641 Ga0070665_1003146412 90
65 3300005841 Ga0068863_100193749 Ga0068863_1001937493 90
66 3300005937 Ga0081455_10001657 Ga0081455_1000165734 90
67 3300005937 Ga0081455_10090119 Ga0081455_100901191 90
68 3300005937 Ga0081455_10317319 Ga0081455_103173192 90
69 3300005937 Ga0081455_10677543 Ga0081455_106775432 90
70 3300005983 Ga0081540_1006028 Ga0081540_10060285 90
71 3300005985 Ga0081539_10002224 Ga0081539_1000222422 90
72 3300006028 Ga0070717_10936172 Ga0070717_109361722 90
73 3300006038 Ga0075365_10404375 Ga0075365_104043752 90
74 3300006042 Ga0075368_10124330 Ga0075368_101243302 90
75 3300006048 Ga0075363_100139187 Ga0075363_1001391873 90
76 3300006051 Ga0075364_10331874 Ga0075364_103318743 90
77 3300006051 Ga0075364_10458832 Ga0075364_104588322 90
78 3300006163 Ga0070715_10084683 Ga0070715_100846832 90
79 3300006173 Ga0070716_100010733 Ga0070716_1000107334 90
80 3300006173 Ga0070716_100045100 Ga0070716_1000451003 90
81 3300006175 Ga0070712_100009001 Ga0070712_1000090016 90
82 3300006175 Ga0070712_100047211 Ga0070712_1000472113 90
83 3300006178 Ga0075367_10080062 Ga0075367_100800624 90
84 3300006186 Ga0075369_10178524 Ga0075369_101785242 90
85 3300006195 Ga0075366_10879029 Ga0075366_108790292 90
86 3300006353 Ga0075370_10109581 Ga0075370_101095812 90
87 3300006353 Ga0075370_10328796 Ga0075370_103287962 90
88 3300007788 Ga0099795_10048231 Ga0099795_100482312 90
89 3300009147 Ga0114129_10388024 Ga0114129_103880242 90
90 3300009147 Ga0114129_12676309 Ga0114129_126763092 90
91 3300009177 Ga0105248_11626644 Ga0105248_116266441 90
92 3300013104 Ga0157370_10749586 Ga0157370_107495861 90
93 3300013296 Ga0157374_12598607 Ga0157374_125986071 90
94 3300013297 Ga0157378_11577698 Ga0157378_115776982 90
95 3300013308 Ga0157375_11695487 Ga0157375_116954871 90
96 3300025294 Ga0209025_1000554 Ga0209025_100055432 90
97 3300025304 Ga0209257_1000308 Ga0209257_100030857 90
98 3300025893 Ga0207682_10000368 Ga0207682_100003689 90
99 3300025898 Ga0207692_10004530 Ga0207692_100045303 90
100 3300025898 Ga0207692_10004836 Ga0207692_100048363 90
101 3300025905 Ga0207685_10065511 Ga0207685_100655112 90
102 3300025906 Ga0207699_10011145 Ga0207699_100111453 90
103 3300025906 Ga0207699_10026166 Ga0207699_100261663 90
104 3300025915 Ga0207693_10001150 Ga0207693_1000115022 90
105 3300025915 Ga0207693_10060310 Ga0207693_100603103 90
106 3300025916 Ga0207663_10000875 Ga0207663_1000087513 90
107 3300025916 Ga0207663_10224568 Ga0207663_102245682 90
108 3300025928 Ga0207700_10022131 Ga0207700_100221316 90
109 3300025928 Ga0207700_10058618 Ga0207700_100586183 90
110 3300025929 Ga0207664_10201602 Ga0207664_102016022 90
111 3300025939 Ga0207665_10043329 Ga0207665_100433293 90
112 3300025939 Ga0207665_10158664 Ga0207665_101586643 90
113 3300025941 Ga0207711_11060601 Ga0207711_110606012 90
114 3300026023 Ga0207677_11194652 Ga0207677_111946521 90
115 3300026088 Ga0207641_10226383 Ga0207641_102263834 90
116 3300027512 Ga0209179_1154051 Ga0209179_11540512 90
117 3300027866 Ga0209813_10059291 Ga0209813_100592912 90
118 3300028379 Ga0268266_10155063 Ga0268266_101550633 90
119 3300031548 Ga0307408_100644199 Ga0307408_1006441992 90
120 3300031731 Ga0307405_10180534 Ga0307405_101805341 90
121 3300031731 Ga0307405_10193057 Ga0307405_101930572 90
122 3300031852 Ga0307410_10995325 Ga0307410_109953252 90
123 3300031901 Ga0307406_10240711 Ga0307406_102407113 90
124 3300031901 Ga0307406_11307415 Ga0307406_113074152 90
125 3300031911 Ga0307412_10963928 Ga0307412_109639282 90
126 3300031995 Ga0307409_102500361 Ga0307409_1025003612 90
127 3300032004 Ga0307414_10000449 Ga0307414_1000044917 90
128 3300032004 Ga0307414_10134889 Ga0307414_101348892 90
129 3300032005 Ga0307411_10120904 Ga0307411_101209042 90
130 3300041509 Ga0451843_0291122 Ga0451843_0291122_70_351 90
131 3300041997 Ga0439431_0270552 Ga0439431_0270552_200_481 90
132 3300042006 Ga0439432_003655 Ga0439432_003655_270_560 90
133 3300042007 Ga0439449_0304704 Ga0439449_0304704_226_516 90
134 3300042015 Ga0439462_0051779 Ga0439462_0051779_497_778 90
135 3300042435 Ga0439434_0084323 Ga0439434_0084323_441_749 90
136 3300042461 Ga0439460_0050487 Ga0439460_0050487_185_457 90
137 3300046460 Ga0495638_0109550 Ga0495638_0109550_917_1222 90
138 3300046491 Ga0495584_0198844 Ga0495584_0198844_345_674 90
139 3300047318 Ga0495636_0478108 Ga0495636_0478108_121_435 90
140 3300048903 Ga0496100_0126061 Ga0496100_0126061_1486_1758 90
141 3300048907 Ga0496104_1110368 Ga0496104_1110368_395_667 90
142 3300048909 Ga0496106_1046196 Ga0496106_1046196_64_336 90
143 3300048911 Ga0496108_1618156 Ga0496108_1618156_225_497 90
144 3300048913 Ga0496110_0084864 Ga0496110_0084864_2203_2475 90
145 3300048914 Ga0496111_0331965 Ga0496111_0331965_495_767 90
146 3300049520 Ga0501297_045955 Ga0501297_045955_320_610 90
147 3300049526 Ga0501303_014673 Ga0501303_014673_191_481 90
148 3300049571 Ga0501034_0143737 Ga0501034_0143737_1559_1855 90
149 3300049576 Ga0501040_0120503 Ga0501040_0120503_869_1159 90
150 3300049588 Ga0501072_0717911 Ga0501072_0717911_384_659 90
151 3300049591 Ga0501075_0868642 Ga0501075_0868642_351_626 90
152 3300049654 Ga0501207_012109 Ga0501207_012109_661_951 90
153 3300049664 Ga0501224_015423 Ga0501224_015423_71_361 90
154 3300049674 Ga0501242_010784 Ga0501242_010784_123_413 90
155 3300049677 Ga0501247_090377 Ga0501247_090377_16_306 90
156 3300049680 Ga0501250_002521 Ga0501250_002521_1023_1313 90
157 3300049686 Ga0501257_155542 Ga0501257_155542_284_574 90
158 3300049705 Ga0501225_0179182 Ga0501225_0179182_247_537 90
159 3300049741 Ga0501079_0230236 Ga0501079_0230236_87_380 90
160 3300049758 Ga0501241_063654 Ga0501241_063654_109_399 90
161 3300049776 Ga0501280_009917 Ga0501280_009917_554_844 90
162 3300049824 Ga0501045_0262857 Ga0501045_0262857_103_399 90
163 3300050490 nmdc:mga03n38_78131_c1 nmdc:mga03n38_78131_c1_832_1137 90
164 3300050491 nmdc:mga00v17_325820_c1 nmdc:mga00v17_325820_c1_265_570 90
165 3300050494 nmdc:mga06z11_47386_c1 nmdc:mga06z11_47386_c1_1883_2161 90
166 3300050495 nmdc:mga04h51_60402_c1 nmdc:mga04h51_60402_c1_451_756 90
167 3300050496 nmdc:mga07m45_612763_c1 nmdc:mga07m45_612763_c1_170_451 90
168 3300050496 nmdc:mga07m45_86463_c1 nmdc:mga07m45_86463_c1_557_862 90
169 3300050507 nmdc:mga05p37_216825_c1 nmdc:mga05p37_216825_c1_1033_1326 90
170 3300050507 nmdc:mga05p37_374439_c1 nmdc:mga05p37_374439_c1_434_709 90
171 3300050507 nmdc:mga05p37_972155_c1 nmdc:mga05p37_972155_c1_62_334 90
172 3300053087 Ga0500643_000014 Ga0500643_000014_114377_114655 90
173 3300053116 Ga0500592_017486 Ga0500592_017486_472_756 90
174 3300053139 Ga0500568_0020322 Ga0500568_0020322_816_1106 90
175 3300053727 Ga0500611_080601 Ga0500611_080601_210_515 90
176 3300053730 Ga0500645_117234 Ga0500645_117234_65_343 90
177 3300054114 Ga0501084_1301907 Ga0501084_1301907_27_302 90
178 3300054114 Ga0501084_1385904 Ga0501084_1385904_31_327 90

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pip-assembly1.cif.gz_V crystal structure of the synergistic antibiotic pair lankamycin and lankacidin in complex with the large ribosomal subunit 0.5518 1 45
3pip-assembly1.cif.gz_V crystal structure of the synergistic antibiotic pair lankamycin and lankacidin in complex with the large ribosomal subunit 0.4091 1 45
ID Description Score Start End Superfamily
af_Q8T915_50_270_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.7487 9 45 3.60.20.10
af_Q8T915_50_270_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.3348 9 45 3.60.20.10
ID Description Score Start End GO Terms
AF-A0A742LJQ1-F1-model_v4 Uncharacterized protein 0.6053 2 82
AF-A0A4Q7MA84-F1-model_v4 Phage protein 0.5807 2 89
AF-A0A4Q6BNA7-F1-model_v4 Uncharacterized protein 0.5736 1 88
AF-A0A369QUR9-F1-model_v4 Uncharacterized protein 0.5724 1 87
AF-A0A6A7KUL7-F1-model_v4 Uncharacterized protein 0.5665 1 87

Feature Viewer

pLDDT pTM Quality
77.52 0.52 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map